3HZQA

Structure of a tetrameric mscl in an expanded intermediate state
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
94
structure length
94
Chain Sequence
MLKEFKEFALKGNVLDLAIAVVMGAAFNKIICSLVENIIMPLIGKIFGSVDFAKEWSFWGIKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Large-conductance mechanosensitive channel
publication title Structure of a tetrameric MscL in an expanded intermediate state.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mw2
molecule tags Membrane protein
total genus 24
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2009-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.120 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3hzqA00
2OARA 3HZQA
chains in the Genus database with same CATH superfamily
3GJNA 2PENA 2LMLA 1YIJP 3CCLP 1ACPA 1NQ4A 4UHPB 4XROA 3CCSP 2MVUA 3GZLA 2PEOA 2ROQA 1F80D 3G1IA 1VKUA 2MY5A 5EW5E 4U0FA 2E1MA 1VQ7P 2FHSC 3I56P 4QNBA 3CE7A 4GR6A 1AF8A 2KW2A 1VQMP 4NEOA 2BUOA 2VSQA 3LMOA 4XFYA 2KWLA 3CCUP 4R0MA 1RNIA 3CPWO 1HY8A 1YITP 3NY7B 1EIAA 1ZMBA 2XXMA 1A43A 2JBGA 1OR5A 3CCMP 2AVAA 2KOOA 3EJBA 7CEIA 2CQ8A 1X3OA 3DTJA 5BS1A 2EG5A 2KOSA 4U0DA 2KGDA 2K92A 4H2WC 2EHSA 4QKOA 2PNGA 2JO0A 2LIUA 4COCA 2PY8A 3CCQP 3G6EP 3OW2O 2VLNA 4U0BA 1D1DA 1DNYA 5I4TG 2ONTA 2FQ0A 2JAZA 3CCJP 3CMEP 2N98A 1YJ9P 2K0DX 1L0IA 2LL8A 2K94A 4BPFA 2KGEA 2K93A 2KODA 3H0DA 2KG6A 2EIAA 2K2QA 4M0IA 2MR7A 3MGEA 2FADA 1M6NA 2QEXP 3U43A 3HYBA 3HZQA 2N5IA 3DS2A 2KOQA 1BAJA 1RO0A 3CCEP 5DCKA 2DNWA 2AFEA 2GZIA 1KQSO 1M90Q 3EJDA 5HGNA 2KGAA 2Z45A 3G1GA 2Z46A 3G26A 2GZGA 5HVCA 1VQNP 1M6EX 3VRLC 5KP7B 1VQKP 4COPA 4MRTC 4HKGA 2JB0A 2FAEA 1VQ9P 2JGPA 2MD9A 1EMVA 1JJ2O 3I55P 4IPYA 1Z6MA 3DS4A 1K8AQ 1VQLP 3EJEA 2M8NA 3G4SP 1YI2P 2N5HA 1T8KA 1KLPA 3Q20A 2LTEA 2KGCA 5EJDA 2K0XA 4U0EA 1BXIA 2LOLA 3GZMA 5KP8B 4PXHB 3CCVP 2L9FA 1VHNA 1DV5A 1AYIA 2WPTA 1W2BO 1Q7YQ 2N6YA 3P05A 1FR2A 2XZ0D 3RG2A 1E6JP 2N6ZA 2CG5B 2PEKA 3DS1A 4H2XC 2GDYA 4CA3A 2M5RA 1UNKA 1GXGA 1QRJA 2PEIA 5HGLA 2Z44A 1VQOP 2MR8A 5CZDB 4XRQA 2CWOA 5HGMA 2KR5A 2KG8A 5JPAA 2AFDA 2OTLP 1UJZA 3CD6P 3G29A 3CXCO 1M1KQ 2XZ1C 1S72P 2XV6A 1HQBA 2PEJA 4WYMA 1K9MQ 2QNWA 1GXHA 2XT1A 5HGOA 1K73Q 3G28A 1NJIQ 3E2DA 1N8RQ 1VQPP 2AF8A 2FVEA 3CC2P 2OARA 2DGYA 3NTEA 4F37A 4GR2A 1QVGO 1KD1Q 3M1MA 2LPKA 2VLOA 2K5XA 2CGQA 2P9XA 5F2NA 3B4QA 2FACA 1M74A 2L22A 2LF4A 4U0CA 1KC8Q 2OTJP 2N50A 5HV8A 2VLQA 2GZEA 3G21A 3DS0A 2JU2A 1Q86Q 2L4BA 1IMQA 2KOPA 1YJNP 2VLPA 1E0HA 3H4EA 2KORA 3LRYA 2JYLA 2EFJA 3RG6C 1VQ5P 3GKLC 2MVVA 1EOQA 2X2BA 1L0HA 1VQ6P 1IUQA 4PWVB 2BHVA 2FVAA 4PH0A 5F2OA 1CEIA 3CCRP 2GZJA 1A8OA 3DPHA 4IZ6A 3G0VA 3DS3A 4BPHA 1K30A 2LKIA 3G71P 1QVFO 3WBHA 2PEMA 1AUMA 2CNRA 1ZNVA 4XFZA 1MZ8A 3CC7P 1VQ4P 4H2YC 2GDXA 3DS5A 2GYKA 1RO2A 1VQ8P 4XFXA 4DG9A 1IMPA 2JQ4A 2K0YA 2FQ1A 2FVFA 3CC4P 2L0QA 2PEQA 2QA4P 2L6EA 2EHTA 2FQ2A 2GZFA 2KG9A 1GPJA 4PH1A 1YHQP 5F2KA 1Q81Q 5BS2A 4U0AA 4BPGA 1Q82Q 3CMAP 2M8PA 3H47A 1YJWP 2LIWA 2M8LA 3B5IA 2ERHA 2JYGA 2JU1A 2GDWA 2NO8A 2MF4A 5KP6B
chains in the Genus database with same CATH topology
2PENA 3H4EA 1YIJP 1W2BO 1Q7YQ 3P05A 3CCLP 3LRYA 3H0DA 2KODA 2JYLA 2EFJA 3RG6C 1VQ5P 2EIAA 4XROA 3CCSP 4M0IA 2PEOA 1EOQA 1E6JP 3MGEA 3DS1A 2PEKA 1M6NA 3G1IA 1QRJA 2PEIA 2E1MA 4U0FA 2QEXP 5HGLA 1VQ7P 2Z44A 1VQOP 3I56P 3HYBA 3HZQA 4QNBA 4XRQA 1VQ6P 3DS2A 1IUQA 2CWOA 2BHVA 4PH0A 1BAJA 5F2OA 5HGMA 1RO0A 3CCRP 3CCEP 4GR6A 5DCKA 1VQMP 1A8OA 5JPAA 3DPHA 2BUOA 3G0VA 2OTLP 1KQSO 3DS3A 1M90Q 3CD6P 3G29A 3CXCO 1M1KQ 1K30A 1S72P 2XV6A 4XFYA 5HGNA 2Z45A 3CCUP 2PEJA 3G71P 3G1GA 1QVFO 4WYMA 3WBHA 1RNIA 2Z46A 3CPWO 1K9MQ 3G26A 2XT1A 2PEMA 1YITP 5HGOA 1AUMA 1K73Q 1VQNP 1M6EX 1EIAA 1ZMBA 2XXMA 3VRLC 1VQKP 1A43A 4COPA 4XFZA 3G28A 1NJIQ 3E2DA 1N8RQ 3CC7P 1VQ4P 1VQ9P 1VQPP 3CCMP 1JJ2O 3CC2P 3DS5A 3I55P 4IPYA 1RO2A 3DTJA 2OARA 2DGYA 1VQ8P 3NTEA 4XFXA 5BS1A 2EG5A 4GR2A 3DS4A 1K8AQ 1QVGO 4U0DA 3CC4P 2PEQA 2QA4P 2L6EA 1VQLP 1KD1Q 2M8NA 3G4SP 1YI2P 3M1MA 3Q20A 2P9XA 4PH1A 1YHQP 2JO0A 4COCA 5F2KA 5F2NA 1Q81Q 5BS2A 4U0AA 2PY8A 3CCQP 1M74A 4U0CA 2LF4A 4U0BA 3G6EP 3OW2O 5I4TG 2ONTA 1KC8Q 2OTJP 1D1DA 4U0EA 1Q82Q 3CMAP 2M8PA 3H47A 1YJWP 3CCJP 2M8LA 3CMEP 3G21A 3DS0A 3B5IA 2JYGA 3CCVP 1YJ9P 1Q86Q 1YJNP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OAR A;  3HZQ A; 
#chains in the Genus database with same CATH topology
 3GJN A;  2PEN A;  2LML A;  1YIJ P;  3CCL P;  1ACP A;  1NQ4 A;  4UHP B;  4XRO A;  3CCS P;  2MVU A;  3GZL A;  2PEO A;  2ROQ A;  1F80 D;  3G1I A;  1VKU A;  2MY5 A;  5EW5 E;  4U0F A;  2E1M A;  1VQ7 P;  2FHS C;  3I56 P;  4QNB A;  3CE7 A;  4GR6 A;  1AF8 A;  2KW2 A;  1VQM P;  4NEO A;  2BUO A;  2VSQ A;  3LMO A;  4XFY A;  2KWL A;  3CCU P;  4R0M A;  1RNI A;  3CPW O;  1HY8 A;  1YIT P;  3NY7 B;  1EIA A;  1ZMB A;  2XXM A;  1A43 A;  2JBG A;  1OR5 A;  3CCM P;  2AVA A;  2KOO A;  3EJB A;  7CEI A;  2CQ8 A;  1X3O A;  3DTJ A;  5BS1 A;  2EG5 A;  2KOS A;  4U0D A;  2KGD A;  2K92 A;  4H2W C;  2EHS A;  4QKO A;  2PNG A;  2JO0 A;  2LIU A;  4COC A;  2PY8 A;  3CCQ P;  3G6E P;  3OW2 O;  2VLN A;  4U0B A;  1D1D A;  1DNY A;  5I4T G;  2ONT A;  2FQ0 A;  2JAZ A;  3CCJ P;  3CME P;  2N98 A;  1YJ9 P;  2K0D X;  1L0I A;  2LL8 A;  2K94 A;  4BPF A;  2KGE A;  2K93 A;  2KOD A;  3H0D A;  2KG6 A;  2EIA A;  2K2Q A;  4M0I A;  2MR7 A;  3MGE A;  2FAD A;  1M6N A;  2QEX P;  3U43 A;  3HYB A;  3HZQ A;  2N5I A;  3DS2 A;  2KOQ A;  1BAJ A;  1RO0 A;  3CCE P;  5DCK A;  2DNW A;  2AFE A;  2GZI A;  1KQS O;  1M90 Q;  3EJD A;  5HGN A;  2KGA A;  2Z45 A;  3G1G A;  2Z46 A;  3G26 A;  2GZG A;  5HVC A;  1VQN P;  1M6E X;  3VRL C;  5KP7 B;  1VQK P;  4COP A;  4MRT C;  4HKG A;  2JB0 A;  2FAE A;  1VQ9 P;  2JGP A;  2MD9 A;  1EMV A;  1JJ2 O;  3I55 P;  4IPY A;  1Z6M A;  3DS4 A;  1K8A Q;  1VQL P;  3EJE A;  2M8N A;  3G4S P;  1YI2 P;  2N5H A;  1T8K A;  1KLP A;  3Q20 A;  2LTE A;  2KGC A;  5EJD A;  2K0X A;  4U0E A;  1BXI A;  2LOL A;  3GZM A;  5KP8 B;  4PXH B;  3CCV P;  2L9F A;  1VHN A;  1DV5 A;  1AYI A;  2WPT A;  1W2B O;  1Q7Y Q;  2N6Y A;  3P05 A;  1FR2 A;  2XZ0 D;  3RG2 A;  1E6J P;  2N6Z A;  2CG5 B;  2PEK A;  3DS1 A;  4H2X C;  2GDY A;  4CA3 A;  2M5R A;  1UNK A;  1GXG A;  1QRJ A;  2PEI A;  5HGL A;  2Z44 A;  1VQO P;  2MR8 A;  5CZD B;  4XRQ A;  2CWO A;  5HGM A;  2KR5 A;  2KG8 A;  5JPA A;  2AFD A;  2OTL P;  1UJZ A;  3CD6 P;  3G29 A;  3CXC O;  1M1K Q;  2XZ1 C;  1S72 P;  2XV6 A;  1HQB A;  2PEJ A;  4WYM A;  1K9M Q;  2QNW A;  1GXH A;  2XT1 A;  5HGO A;  1K73 Q;  3G28 A;  1NJI Q;  3E2D A;  1N8R Q;  1VQP P;  2AF8 A;  2FVE A;  3CC2 P;  2OAR A;  2DGY A;  3NTE A;  4F37 A;  4GR2 A;  1QVG O;  1KD1 Q;  3M1M A;  2LPK A;  2VLO A;  2K5X A;  2CGQ A;  2P9X A;  5F2N A;  3B4Q A;  2FAC A;  1M74 A;  2L22 A;  2LF4 A;  4U0C A;  1KC8 Q;  2OTJ P;  2N50 A;  5HV8 A;  2VLQ A;  2GZE A;  3G21 A;  3DS0 A;  2JU2 A;  1Q86 Q;  2L4B A;  1IMQ A;  2KOP A;  1YJN P;  2VLP A;  1E0H A;  3H4E A;  2KOR A;  3LRY A;  2JYL A;  2EFJ A;  3RG6 C;  1VQ5 P;  3GKL C;  2MVV A;  1EOQ A;  2X2B A;  1L0H A;  1VQ6 P;  1IUQ A;  4PWV B;  2BHV A;  2FVA A;  4PH0 A;  5F2O A;  1CEI A;  3CCR P;  2GZJ A;  1A8O A;  3DPH A;  4IZ6 A;  3G0V A;  3DS3 A;  4BPH A;  1K30 A;  2LKI A;  3G71 P;  1QVF O;  3WBH A;  2PEM A;  1AUM A;  2CNR A;  1ZNV A;  4XFZ A;  1MZ8 A;  3CC7 P;  1VQ4 P;  4H2Y C;  2GDX A;  3DS5 A;  2GYK A;  1RO2 A;  1VQ8 P;  4XFX A;  4DG9 A;  1IMP A;  2JQ4 A;  2K0Y A;  2FQ1 A;  2FVF A;  3CC4 P;  2L0Q A;  2PEQ A;  2QA4 P;  2L6E A;  2EHT A;  2FQ2 A;  2GZF A;  2KG9 A;  1GPJ A;  4PH1 A;  1YHQ P;  5F2K A;  1Q81 Q;  5BS2 A;  4U0A A;  4BPG A;  1Q82 Q;  3CMA P;  2M8P A;  3H47 A;  1YJW P;  2LIW A;  2M8L A;  3B5I A;  2ERH A;  2JYG A;  2JU1 A;  2GDW A;  2NO8 A;  2MF4 A;  5KP6 B; 
#chains in the Genus database with same CATH homology
 2PEN A;  3H4E A;  1YIJ P;  1W2B O;  1Q7Y Q;  3P05 A;  3CCL P;  3LRY A;  3H0D A;  2KOD A;  2JYL A;  2EFJ A;  3RG6 C;  1VQ5 P;  2EIA A;  4XRO A;  3CCS P;  4M0I A;  2PEO A;  1EOQ A;  1E6J P;  3MGE A;  3DS1 A;  2PEK A;  1M6N A;  3G1I A;  1QRJ A;  2PEI A;  2E1M A;  4U0F A;  2QEX P;  5HGL A;  1VQ7 P;  2Z44 A;  1VQO P;  3I56 P;  3HYB A;  3HZQ A;  4QNB A;  4XRQ A;  1VQ6 P;  3DS2 A;  1IUQ A;  2CWO A;  2BHV A;  4PH0 A;  1BAJ A;  5F2O A;  5HGM A;  1RO0 A;  3CCR P;  3CCE P;  4GR6 A;  5DCK A;  1VQM P;  1A8O A;  5JPA A;  3DPH A;  2BUO A;  3G0V A;  2OTL P;  1KQS O;  3DS3 A;  1M90 Q;  3CD6 P;  3G29 A;  3CXC O;  1M1K Q;  1K30 A;  1S72 P;  2XV6 A;  4XFY A;  5HGN A;  2Z45 A;  3CCU P;  2PEJ A;  3G71 P;  3G1G A;  1QVF O;  4WYM A;  3WBH A;  1RNI A;  2Z46 A;  3CPW O;  1K9M Q;  3G26 A;  2XT1 A;  2PEM A;  1YIT P;  5HGO A;  1AUM A;  1K73 Q;  1VQN P;  1M6E X;  1EIA A;  1ZMB A;  2XXM A;  3VRL C;  1VQK P;  1A43 A;  4COP A;  4XFZ A;  3G28 A;  1NJI Q;  3E2D A;  1N8R Q;  3CC7 P;  1VQ4 P;  1VQ9 P;  1VQP P;  3CCM P;  1JJ2 O;  3CC2 P;  3DS5 A;  3I55 P;  4IPY A;  1RO2 A;  3DTJ A;  2OAR A;  2DGY A;  1VQ8 P;  3NTE A;  4XFX A;  5BS1 A;  2EG5 A;  4GR2 A;  3DS4 A;  1K8A Q;  1QVG O;  4U0D A;  3CC4 P;  2PEQ A;  2QA4 P;  2L6E A;  1VQL P;  1KD1 Q;  2M8N A;  3G4S P;  1YI2 P;  3M1M A;  3Q20 A;  2P9X A;  4PH1 A;  1YHQ P;  2JO0 A;  4COC A;  5F2K A;  5F2N A;  1Q81 Q;  5BS2 A;  4U0A A;  2PY8 A;  3CCQ P;  1M74 A;  4U0C A;  2LF4 A;  4U0B A;  3G6E P;  3OW2 O;  5I4T G;  2ONT A;  1KC8 Q;  2OTJ P;  1D1D A;  4U0E A;  1Q82 Q;  3CMA P;  2M8P A;  3H47 A;  1YJW P;  3CCJ P;  2M8L A;  3CME P;  3G21 A;  3DS0 A;  3B5I A;  2JYG A;  3CCV P;  1YJ9 P;  1Q86 Q;  1YJN P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...