3HZQA

Structure of a tetrameric mscl in an expanded intermediate state
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
94
structure length
94
Chain Sequence
MLKEFKEFALKGNVLDLAIAVVMGAAFNKIICSLVENIIMPLIGKIFGSVDFAKEWSFWGIKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Large-conductance mechanosensitive channel
publication title Structure of a tetrameric MscL in an expanded intermediate state.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mw2
molecule tags Membrane protein
total genus 24
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2009-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.120 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3hzqA00
3HZQA 2OARA
chains in the Genus database with same CATH superfamily
2GZGA 5JPAA 3H4EA 2VLOA 1K73Q 4QKOA 1QRJA 2PEJA 2L6EA 2LTEA 5HGOA 2XZ1C 2PEQA 3OW2O 3G4SP 2VSQA 2LL8A 2JYGA 2FVFA 2PEMA 2OTLP 2K92A 3CCEP 2BHVA 4COPA 1HY8A 1OR5A 2MD9A 3NY7B 1M1KQ 2GDYA 1AF8A 3B4QA 1VHNA 5BS2A 1X3OA 3GZLA 4U0BA 2KGDA 3VRLC 2M5RA 2KORA 2Z45A 4U0AA 1M90Q 2FQ1A 2FAEA 1K8AQ 1QVFO 2KW2A 5KP8B 3CCLP 5F2KA 2MVUA 4IZ6A 2FVAA 3DS1A 1L0IA 3DS0A 2JB0A 1RNIA 2FADA 2QEXP 2EG5A 2GDWA 2MF4A 1HQBA 2GZEA 2FQ0A 3CCMP 4UHPB 2AFEA 4U0DA 3G71P 1RO2A 2ERHA 1D1DA 2E1MA 2K0DX 3DTJA 4PWVB 3GKLC 2N5HA 1Q86Q 3CE7A 5KP6B 3RG6C 3CMEP 2ONTA 3LRYA 2N5IA 4DG9A 1ZMBA 3CCQP 2MVVA 1VQMP 4XROA 2M8LA 1MZ8A 4COCA 5HGMA 3GJNA 2OARA 2AVAA 1UNKA 1IUQA 1AUMA 4XFYA 4M0IA 3E2DA 2N50A 1VQ7P 3DS2A 1FR2A 2EFJA 2FHSC 2FVEA 1AYIA 3B5IA 5EJDA 2DGYA 4BPHA 3CD6P 1YITP 3MGEA 5DCKA 2KOSA 1KD1Q 4BPFA 2L9FA 3CC7P 2K0YA 1YIJP 3CCRP 2N6ZA 2PENA 4CA3A 1DV5A 3U43A 1IMQA 5HGLA 1K30A 1E0HA 2K0XA 2DNWA 7CEIA 4XRQA 3P05A 1VQLP 5F2OA 5CZDB 4XFZA 2AFDA 4F37A 1QVGO 3CCJP 1RO0A 2K2QA 1Q82Q 5HGNA 2N6YA 2LF4A 3WBHA 3EJDA 4QNBA 1VQPP 2L22A 2WPTA 1GXHA 2CWOA 1UJZA 2MY5A 2KGCA 2LIUA 2VLQA 2CGQA 2XT1A 2L0QA 1JJ2O 1VQ8P 2NO8A 2Z44A 2KR5A 3I56P 5KP7B 2QA4P 1E6JP 3H47A 3EJEA 4PXHB 1S72P 2JYLA 1F80D 2M8NA 4H2XC 2N98A 2K5XA 2GZIA 2KODA 1YJWP 1KC8Q 3DS5A 4U0EA 3HZQA 2JU2A 2PEIA 3G0VA 2OTJP 2Z46A 3DS3A 2K93A 4IPYA 3LMOA 1VQ6P 3DS4A 4PH0A 4XFXA 2JGPA 2PEOA 1IMPA 1YHQP 2ROQA 3GZMA 4R0MA 1EOQA 2PEKA 2GDXA 2M8PA 4HKGA 2JU1A 2MR7A 2LOLA 3CXCO 3CCVP 3G29A 4H2WC 2BUOA 2VLPA 1Q81Q 3M1MA 1VQOP 3H0DA 3RG2A 2KWLA 1VQ4P 1VKUA 3I55P 2PNGA 3NTEA 2KOOA 3CPWO 1T8KA 1M6NA 4U0CA 2KGEA 3Q20A 2FQ2A 2CQ8A 4MRTC 5HVCA 1YI2P 2EHTA 2CNRA 2VLNA 1M6EX 1VQKP 2KG9A 1M74A 1GXGA 3HYBA 1KLPA 3CCSP 2GZFA 2KGAA 1YJ9P 4NEOA 1EMVA 1ZNVA 2KG6A 1N8RQ 1A8OA 3DPHA 1ACPA 2LIWA 3EJBA 4H2YC 2EHSA 5F2NA 1NQ4A 3CC4P 1VQ5P 1Z6MA 2KG8A 2CG5B 1W2BO 4GR6A 4U0FA 3G6EP 2GZJA 2JAZA 3G1IA 2XXMA 2XV6A 4BPGA 1K9MQ 1BAJA 4PH1A 5EW5E 2AF8A 4WYMA 2FACA 2KOPA 2EIAA 2PY8A 5I4TG 2LKIA 2MR8A 2X2BA 4GR2A 2P9XA 3CC2P 2K94A 3G28A 3CMAP 2JBGA 1KQSO 3G21A 2JQ4A 1BXIA 1Q7YQ 1A43A 1VQ9P 1NJIQ 5BS1A 2GYKA 5HV8A 1VQNP 2LMLA 2L4BA 1GPJA 1EIAA 2JO0A 3G26A 1DNYA 1L0HA 2QNWA 1CEIA 1YJNP 3G1GA 2KOQA 2XZ0D 3CCUP 2LPKA
chains in the Genus database with same CATH topology
1VQMP 3Q20A 4XROA 2M8LA 5JPAA 3H4EA 4COCA 5HGMA 1YI2P 1K73Q 2XT1A 1JJ2O 2OARA 1QRJA 1VQ8P 1M6EX 2PEJA 1VQKP 2L6EA 2Z44A 1IUQA 1M74A 5HGOA 3I56P 3HYBA 2QA4P 3CCSP 2PEQA 1E6JP 1AUMA 3H47A 4XFYA 3OW2O 4M0IA 3G4SP 1S72P 2JYLA 2JYGA 3E2DA 2PEMA 1VQ7P 2OTLP 1YJ9P 3DS2A 2EFJA 2M8NA 3CCEP 1N8RQ 1A8OA 2BHVA 3DPHA 4COPA 3B5IA 2DGYA 2KODA 1YJWP 1KC8Q 3DS5A 3CD6P 4U0EA 3HZQA 1YITP 1M1KQ 2PEIA 3MGEA 3G0VA 5DCKA 2OTJP 2Z46A 5F2NA 5BS2A 4U0BA 1KD1Q 3DS3A 3VRLC 3CC7P 3CC4P 1VQ5P 4IPYA 1W2BO 4GR6A 1VQ6P 3DS4A 4U0FA 4PH0A 3G6EP 4XFXA 1YIJP 2Z45A 4U0AA 1M90Q 2PEOA 3CCRP 1YHQP 3G1IA 1EOQA 1K8AQ 2XXMA 2PENA 2PEKA 1QVFO 2M8PA 3CCLP 2XV6A 5F2KA 1K9MQ 1BAJA 3DS1A 5HGLA 1K30A 4PH1A 3DS0A 1RNIA 4WYMA 2QEXP 2EG5A 3CXCO 3CCVP 3G29A 4XRQA 3P05A 2EIAA 1VQLP 2PY8A 5F2OA 5I4TG 4GR2A 3CCMP 2BUOA 3CCUP 2P9XA 4XFZA 3CC2P 4U0DA 3G71P 3G28A 3CMAP 1Q81Q 1RO2A 1KQSO 3M1MA 1VQOP 3G21A 1QVGO 1D1DA 2E1MA 3H0DA 3DTJA 1A43A 3CCJP 1Q7YQ 1NJIQ 1VQ9P 5BS1A 1RO0A 1VQNP 1Q86Q 1Q82Q 3I55P 1VQ4P 1EIAA 3WBHA 2LF4A 5HGNA 3RG6C 2JO0A 4QNBA 3CMEP 2ONTA 3G26A 3LRYA 3NTEA 1VQPP 3CPWO 2CWOA 1YJNP 3G1GA 4U0CA 1M6NA 1ZMBA 3CCQP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HZQ A;  2OAR A; 
#chains in the Genus database with same CATH topology
 2GZG A;  5JPA A;  3H4E A;  2VLO A;  1K73 Q;  4QKO A;  1QRJ A;  2PEJ A;  2L6E A;  2LTE A;  5HGO A;  2XZ1 C;  2PEQ A;  3OW2 O;  3G4S P;  2VSQ A;  2LL8 A;  2JYG A;  2FVF A;  2PEM A;  2OTL P;  2K92 A;  3CCE P;  2BHV A;  4COP A;  1HY8 A;  1OR5 A;  2MD9 A;  3NY7 B;  1M1K Q;  2GDY A;  1AF8 A;  3B4Q A;  1VHN A;  5BS2 A;  1X3O A;  3GZL A;  4U0B A;  2KGD A;  3VRL C;  2M5R A;  2KOR A;  2Z45 A;  4U0A A;  1M90 Q;  2FQ1 A;  2FAE A;  1K8A Q;  1QVF O;  2KW2 A;  5KP8 B;  3CCL P;  5F2K A;  2MVU A;  4IZ6 A;  2FVA A;  3DS1 A;  1L0I A;  3DS0 A;  2JB0 A;  1RNI A;  2FAD A;  2QEX P;  2EG5 A;  2GDW A;  2MF4 A;  1HQB A;  2GZE A;  2FQ0 A;  3CCM P;  4UHP B;  2AFE A;  4U0D A;  3G71 P;  1RO2 A;  2ERH A;  1D1D A;  2E1M A;  2K0D X;  3DTJ A;  4PWV B;  3GKL C;  2N5H A;  1Q86 Q;  3CE7 A;  5KP6 B;  3RG6 C;  3CME P;  2ONT A;  3LRY A;  2N5I A;  4DG9 A;  1ZMB A;  3CCQ P;  2MVV A;  1VQM P;  4XRO A;  2M8L A;  1MZ8 A;  4COC A;  5HGM A;  3GJN A;  2OAR A;  2AVA A;  1UNK A;  1IUQ A;  1AUM A;  4XFY A;  4M0I A;  3E2D A;  2N50 A;  1VQ7 P;  3DS2 A;  1FR2 A;  2EFJ A;  2FHS C;  2FVE A;  1AYI A;  3B5I A;  5EJD A;  2DGY A;  4BPH A;  3CD6 P;  1YIT P;  3MGE A;  5DCK A;  2KOS A;  1KD1 Q;  4BPF A;  2L9F A;  3CC7 P;  2K0Y A;  1YIJ P;  3CCR P;  2N6Z A;  2PEN A;  4CA3 A;  1DV5 A;  3U43 A;  1IMQ A;  5HGL A;  1K30 A;  1E0H A;  2K0X A;  2DNW A;  7CEI A;  4XRQ A;  3P05 A;  1VQL P;  5F2O A;  5CZD B;  4XFZ A;  2AFD A;  4F37 A;  1QVG O;  3CCJ P;  1RO0 A;  2K2Q A;  1Q82 Q;  5HGN A;  2N6Y A;  2LF4 A;  3WBH A;  3EJD A;  4QNB A;  1VQP P;  2L22 A;  2WPT A;  1GXH A;  2CWO A;  1UJZ A;  2MY5 A;  2KGC A;  2LIU A;  2VLQ A;  2CGQ A;  2XT1 A;  2L0Q A;  1JJ2 O;  1VQ8 P;  2NO8 A;  2Z44 A;  2KR5 A;  3I56 P;  5KP7 B;  2QA4 P;  1E6J P;  3H47 A;  3EJE A;  4PXH B;  1S72 P;  2JYL A;  1F80 D;  2M8N A;  4H2X C;  2N98 A;  2K5X A;  2GZI A;  2KOD A;  1YJW P;  1KC8 Q;  3DS5 A;  4U0E A;  3HZQ A;  2JU2 A;  2PEI A;  3G0V A;  2OTJ P;  2Z46 A;  3DS3 A;  2K93 A;  4IPY A;  3LMO A;  1VQ6 P;  3DS4 A;  4PH0 A;  4XFX A;  2JGP A;  2PEO A;  1IMP A;  1YHQ P;  2ROQ A;  3GZM A;  4R0M A;  1EOQ A;  2PEK A;  2GDX A;  2M8P A;  4HKG A;  2JU1 A;  2MR7 A;  2LOL A;  3CXC O;  3CCV P;  3G29 A;  4H2W C;  2BUO A;  2VLP A;  1Q81 Q;  3M1M A;  1VQO P;  3H0D A;  3RG2 A;  2KWL A;  1VQ4 P;  1VKU A;  3I55 P;  2PNG A;  3NTE A;  2KOO A;  3CPW O;  1T8K A;  1M6N A;  4U0C A;  2KGE A;  3Q20 A;  2FQ2 A;  2CQ8 A;  4MRT C;  5HVC A;  1YI2 P;  2EHT A;  2CNR A;  2VLN A;  1M6E X;  1VQK P;  2KG9 A;  1M74 A;  1GXG A;  3HYB A;  1KLP A;  3CCS P;  2GZF A;  2KGA A;  1YJ9 P;  4NEO A;  1EMV A;  1ZNV A;  2KG6 A;  1N8R Q;  1A8O A;  3DPH A;  1ACP A;  2LIW A;  3EJB A;  4H2Y C;  2EHS A;  5F2N A;  1NQ4 A;  3CC4 P;  1VQ5 P;  1Z6M A;  2KG8 A;  2CG5 B;  1W2B O;  4GR6 A;  4U0F A;  3G6E P;  2GZJ A;  2JAZ A;  3G1I A;  2XXM A;  2XV6 A;  4BPG A;  1K9M Q;  1BAJ A;  4PH1 A;  5EW5 E;  2AF8 A;  4WYM A;  2FAC A;  2KOP A;  2EIA A;  2PY8 A;  5I4T G;  2LKI A;  2MR8 A;  2X2B A;  4GR2 A;  2P9X A;  3CC2 P;  2K94 A;  3G28 A;  3CMA P;  2JBG A;  1KQS O;  3G21 A;  2JQ4 A;  1BXI A;  1Q7Y Q;  1A43 A;  1VQ9 P;  1NJI Q;  5BS1 A;  2GYK A;  5HV8 A;  1VQN P;  2LML A;  2L4B A;  1GPJ A;  1EIA A;  2JO0 A;  3G26 A;  1DNY A;  1L0H A;  2QNW A;  1CEI A;  1YJN P;  3G1G A;  2KOQ A;  2XZ0 D;  3CCU P;  2LPK A; 
#chains in the Genus database with same CATH homology
 1VQM P;  3Q20 A;  4XRO A;  2M8L A;  5JPA A;  3H4E A;  4COC A;  5HGM A;  1YI2 P;  1K73 Q;  2XT1 A;  1JJ2 O;  2OAR A;  1QRJ A;  1VQ8 P;  1M6E X;  2PEJ A;  1VQK P;  2L6E A;  2Z44 A;  1IUQ A;  1M74 A;  5HGO A;  3I56 P;  3HYB A;  2QA4 P;  3CCS P;  2PEQ A;  1E6J P;  1AUM A;  3H47 A;  4XFY A;  3OW2 O;  4M0I A;  3G4S P;  1S72 P;  2JYL A;  2JYG A;  3E2D A;  2PEM A;  1VQ7 P;  2OTL P;  1YJ9 P;  3DS2 A;  2EFJ A;  2M8N A;  3CCE P;  1N8R Q;  1A8O A;  2BHV A;  3DPH A;  4COP A;  3B5I A;  2DGY A;  2KOD A;  1YJW P;  1KC8 Q;  3DS5 A;  3CD6 P;  4U0E A;  3HZQ A;  1YIT P;  1M1K Q;  2PEI A;  3MGE A;  3G0V A;  5DCK A;  2OTJ P;  2Z46 A;  5F2N A;  5BS2 A;  4U0B A;  1KD1 Q;  3DS3 A;  3VRL C;  3CC7 P;  3CC4 P;  1VQ5 P;  4IPY A;  1W2B O;  4GR6 A;  1VQ6 P;  3DS4 A;  4U0F A;  4PH0 A;  3G6E P;  4XFX A;  1YIJ P;  2Z45 A;  4U0A A;  1M90 Q;  2PEO A;  3CCR P;  1YHQ P;  3G1I A;  1EOQ A;  1K8A Q;  2XXM A;  2PEN A;  2PEK A;  1QVF O;  2M8P A;  3CCL P;  2XV6 A;  5F2K A;  1K9M Q;  1BAJ A;  3DS1 A;  5HGL A;  1K30 A;  4PH1 A;  3DS0 A;  1RNI A;  4WYM A;  2QEX P;  2EG5 A;  3CXC O;  3CCV P;  3G29 A;  4XRQ A;  3P05 A;  2EIA A;  1VQL P;  2PY8 A;  5F2O A;  5I4T G;  4GR2 A;  3CCM P;  2BUO A;  3CCU P;  2P9X A;  4XFZ A;  3CC2 P;  4U0D A;  3G71 P;  3G28 A;  3CMA P;  1Q81 Q;  1RO2 A;  1KQS O;  3M1M A;  1VQO P;  3G21 A;  1QVG O;  1D1D A;  2E1M A;  3H0D A;  3DTJ A;  1A43 A;  3CCJ P;  1Q7Y Q;  1NJI Q;  1VQ9 P;  5BS1 A;  1RO0 A;  1VQN P;  1Q86 Q;  1Q82 Q;  3I55 P;  1VQ4 P;  1EIA A;  3WBH A;  2LF4 A;  5HGN A;  3RG6 C;  2JO0 A;  4QNB A;  3CME P;  2ONT A;  3G26 A;  3LRY A;  3NTE A;  1VQP P;  3CPW O;  2CWO A;  1YJN P;  3G1G A;  4U0C A;  1M6N A;  1ZMB A;  3CCQ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...