3HZQA

Structure of a tetrameric mscl in an expanded intermediate state
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
94
structure length
94
Chain Sequence
MLKEFKEFALKGNVLDLAIAVVMGAAFNKIICSLVENIIMPLIGKIFGSVDFAKEWSFWGIKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Large-conductance mechanosensitive channel
publication title Structure of a tetrameric MscL in an expanded intermediate state.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mw2
total genus 24
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2009-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.120 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3hzqA00
2OARA 3HZQA
chains in the Genus database with same CATH superfamily
2N6ZA 4XRQA 2LKIA 3CCEP 2OTLP 5HGNA 2DNWA 3OW2O 2LL8A 5BS2A 3G1GA 2EFJA 7CEIA 1VQ7P 1Q7YQ 1N8RQ 2MVVA 3G28A 4PWVB 2JB0A 1AYIA 2KGDA 2N5IA 1VQOP 2PEMA 3DS2A 2XZ1C 2PEQA 3M1MA 2M8LA 1VQ5P 2KOOA 1K8AQ 2FVEA 1Q81Q 3G6EP 3RG2A 2KG6A 1VQKP 3GKLC 2LTEA 1Q86Q 5HVCA 2K93A 3CCMP 2LPKA 4BPFA 1IUQA 2X2BA 3CPWO 1E0HA 5JPAA 4M0IA 2QEXP 1KD1Q 4F37A 2PENA 2M8NA 3MGEA 1S72P 5HGLA 2CGQA 1IMQA 2KG8A 3CE7A 2LOLA 2QA4P 3DS0A 3G1IA 2FACA 3CCLP 3H47A 1YHQP 2PEOA 2XV6A 2XZ0D 2EG5A 2L6EA 3WBHA 3DS5A 2K0XA 3LRYA 2AF8A 1RNIA 2KG9A 1QRJA 1HY8A 3CC7P 2KR5A 1K30A 3HYBA 1GXHA 5I4TG 3CCQP 1BXIA 1YI2P 1QVGO 3CC4P 4IPYA 4U0DA 2LIUA 4WYMA 1ACPA 4PH0A 1W2BO 1AF8A 5EW5E 1VQLP 1JJ2O 1RO2A 1HQBA 1VHNA 2BUOA 5EJDA 2GZJA 2PEJA 5KP6B 2ONTA 2FQ0A 2JBGA 4U0AA 2CNRA 1VQPP 2MR7A 2GZEA 4BPHA 2JGPA 5CZDB 1ZNVA 2CG5B 2ERHA 2MF4A 2JYGA 1DV5A 2L9FA 5F2NA 1EMVA 3CCJP 2N98A 4U0EA 1Z6MA 2VLQA 4H2XC 3Q20A 4GR6A 2JU1A 3G0VA 4H2WC 3VRLC 4XFZA 2KOSA 1M6EX 2JQ4A 2LIWA 2VSQA 1M6NA 2GZIA 1KLPA 2AFEA 4NEOA 2DGYA 4XROA 3EJEA 4H2YC 2VLNA 2M5RA 2Z44A 3G21A 5F2KA 1Q82Q 3DS3A 1E6JP 4MRTC 2L22A 5KP7B 3U43A 3EJBA 2GDWA 2FQ1A 3GZLA 1L0IA 5HGOA 2KODA 3H4EA 2GYKA 5F2OA 3G29A 2CWOA 1M90Q 2FADA 1EOQA 2JYLA 2AFDA 1EIAA 2QNWA 3CC2P 3DS4A 1YJWP 1VQ4P 1CEIA 4CA3A 3CCUP 2P9XA 3I55P 4DG9A 3CD6P 4U0CA 1T8KA 2K2QA 2FQ2A 1X3OA 2MVUA 3B5IA 2M8PA 2KOPA 2PNGA 3CCVP 2KOQA 1YJ9P 2PY8A 2FAEA 1L0HA 1RO0A 2GZFA 1K73Q 2OTJP 3CCRP 2K0YA 1NQ4A 1OR5A 1VQNP 1NJIQ 1UNKA 2L0QA 1D1DA 2XXMA 4COPA 2GDYA 1A43A 2FVAA 4COCA 4HKGA 3G26A 1KQSO 3NTEA 1YJNP 2FVFA 2EIAA 1FR2A 4GR2A 5HGMA 2EHSA 2GDXA 4BPGA 1AUMA 5KP8B 2KGEA 2KGAA 2VLOA 2KGCA 1VQ8P 4PH1A 4U0FA 1GXGA 1GPJA 2GZGA 2JO0A 2E1MA 2LMLA 1M74A 3RG6C 3CMEP 2JU2A 2KW2A 2N5HA 2ROQA 5HV8A 4PXHB 5DCKA 2L4BA 2VLPA 3I56P 2N6YA 1F80D 4IZ6A 4R0MA 5BS1A 4UHPB 1DNYA 1QVFO 3DS1A 3GJNA 3G4SP 2LF4A 2XT1A 1VQMP 1ZMBA 2MY5A 1M1KQ 2MR8A 3CCSP 1YITP 3LMOA 3DPHA 3P05A 2K94A 3CMAP 1MZ8A 2PEIA 3E2DA 1UJZA 2FHSC 2MD9A 2K92A 3GZMA 2AVAA 3DTJA 1K9MQ 2KWLA 4QKOA 2K0DX 1IMPA 3G71P 2OARA 3H0DA 2BHVA 2N50A 2CQ8A 2NO8A 2PEKA 2Z46A 1VQ9P 2KORA 4QNBA 3HZQA 1BAJA 1A8OA 4XFXA 4XFYA 1VQ6P 3CXCO 1VKUA 2Z45A 2WPTA 2K5XA 4U0BA 3NY7B 3EJDA 1KC8Q 1YIJP 3B4QA 2JAZA 2EHTA
chains in the Genus database with same CATH topology
1E6JP 1YI2P 4XRQA 1QVGO 4IPYA 4U0DA 3CC4P 3CCEP 4WYMA 2JO0A 2E1MA 5HGOA 2OTLP 2KODA 1M74A 5HGNA 3RG6C 3CMEP 3OW2O 3H4EA 5F2OA 4PH0A 5BS2A 1W2BO 3G1GA 5DCKA 3I56P 1VQLP 3G29A 2CWOA 2EFJA 1VQ7P 1Q7YQ 1N8RQ 5BS1A 1M90Q 1EOQA 2JYLA 1JJ2O 3G28A 1EIAA 1QVFO 3DS1A 3CC2P 1RO2A 3G4SP 3DS4A 1YJWP 2LF4A 1VQOP 1VQ4P 2PEMA 3DS2A 2XT1A 3CCUP 2PEQA 2P9XA 3M1MA 2BUOA 5I4TG 1ZMBA 3I55P 1VQMP 2M8LA 1VQ5P 1K8AQ 3CD6P 4U0CA 2PEJA 2ONTA 1M1KQ 1Q81Q 3B5IA 2M8PA 3G6EP 4U0AA 3CCSP 1YITP 3CCVP 1VQPP 1YJ9P 3DPHA 3P05A 1VQKP 3CMAP 2PY8A 2PEIA 1RO0A 3E2DA 1Q86Q 1K73Q 3CCMP 2OTJP 1IUQA 3CPWO 3CCRP 5JPAA 4M0IA 2QEXP 3DTJA 1KD1Q 1K9MQ 1VQNP 2PENA 2JYGA 2M8NA 1NJIQ 3MGEA 1S72P 3G71P 5HGLA 2OARA 1D1DA 2XXMA 3H0DA 4COPA 5F2NA 2BHVA 1A43A 4COCA 3CCJP 3G26A 4U0EA 2PEKA 1KQSO 2QA4P 2Z46A 1VQ9P 3NTEA 3DS0A 3G1IA 4QNBA 1YJNP 3HZQA 3CCLP 3H47A 1YHQP 3Q20A 1BAJA 2PEOA 2EIAA 4GR6A 1A8OA 4GR2A 2XV6A 4XFXA 4XFYA 3G0VA 3VRLC 2EG5A 2L6EA 4XFZA 5HGMA 3WBHA 1M6EX 1VQ6P 3DS5A 3CXCO 3LRYA 1AUMA 1M6NA 2Z45A 1RNIA 2DGYA 4XROA 1QRJA 4U0BA 1VQ8P 1KC8Q 2Z44A 3G21A 4PH1A 3CC7P 5F2KA 1K30A 3HYBA 1YIJP 1Q82Q 3DS3A 4U0FA 3CCQP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OAR A;  3HZQ A; 
#chains in the Genus database with same CATH topology
 2N6Z A;  4XRQ A;  2LKI A;  3CCE P;  2OTL P;  5HGN A;  2DNW A;  3OW2 O;  2LL8 A;  5BS2 A;  3G1G A;  2EFJ A;  7CEI A;  1VQ7 P;  1Q7Y Q;  1N8R Q;  2MVV A;  3G28 A;  4PWV B;  2JB0 A;  1AYI A;  2KGD A;  2N5I A;  1VQO P;  2PEM A;  3DS2 A;  2XZ1 C;  2PEQ A;  3M1M A;  2M8L A;  1VQ5 P;  2KOO A;  1K8A Q;  2FVE A;  1Q81 Q;  3G6E P;  3RG2 A;  2KG6 A;  1VQK P;  3GKL C;  2LTE A;  1Q86 Q;  5HVC A;  2K93 A;  3CCM P;  2LPK A;  4BPF A;  1IUQ A;  2X2B A;  3CPW O;  1E0H A;  5JPA A;  4M0I A;  2QEX P;  1KD1 Q;  4F37 A;  2PEN A;  2M8N A;  3MGE A;  1S72 P;  5HGL A;  2CGQ A;  1IMQ A;  2KG8 A;  3CE7 A;  2LOL A;  2QA4 P;  3DS0 A;  3G1I A;  2FAC A;  3CCL P;  3H47 A;  1YHQ P;  2PEO A;  2XV6 A;  2XZ0 D;  2EG5 A;  2L6E A;  3WBH A;  3DS5 A;  2K0X A;  3LRY A;  2AF8 A;  1RNI A;  2KG9 A;  1QRJ A;  1HY8 A;  3CC7 P;  2KR5 A;  1K30 A;  3HYB A;  1GXH A;  5I4T G;  3CCQ P;  1BXI A;  1YI2 P;  1QVG O;  3CC4 P;  4IPY A;  4U0D A;  2LIU A;  4WYM A;  1ACP A;  4PH0 A;  1W2B O;  1AF8 A;  5EW5 E;  1VQL P;  1JJ2 O;  1RO2 A;  1HQB A;  1VHN A;  2BUO A;  5EJD A;  2GZJ A;  2PEJ A;  5KP6 B;  2ONT A;  2FQ0 A;  2JBG A;  4U0A A;  2CNR A;  1VQP P;  2MR7 A;  2GZE A;  4BPH A;  2JGP A;  5CZD B;  1ZNV A;  2CG5 B;  2ERH A;  2MF4 A;  2JYG A;  1DV5 A;  2L9F A;  5F2N A;  1EMV A;  3CCJ P;  2N98 A;  4U0E A;  1Z6M A;  2VLQ A;  4H2X C;  3Q20 A;  4GR6 A;  2JU1 A;  3G0V A;  4H2W C;  3VRL C;  4XFZ A;  2KOS A;  1M6E X;  2JQ4 A;  2LIW A;  2VSQ A;  1M6N A;  2GZI A;  1KLP A;  2AFE A;  4NEO A;  2DGY A;  4XRO A;  3EJE A;  4H2Y C;  2VLN A;  2M5R A;  2Z44 A;  3G21 A;  5F2K A;  1Q82 Q;  3DS3 A;  1E6J P;  4MRT C;  2L22 A;  5KP7 B;  3U43 A;  3EJB A;  2GDW A;  2FQ1 A;  3GZL A;  1L0I A;  5HGO A;  2KOD A;  3H4E A;  2GYK A;  5F2O A;  3G29 A;  2CWO A;  1M90 Q;  2FAD A;  1EOQ A;  2JYL A;  2AFD A;  1EIA A;  2QNW A;  3CC2 P;  3DS4 A;  1YJW P;  1VQ4 P;  1CEI A;  4CA3 A;  3CCU P;  2P9X A;  3I55 P;  4DG9 A;  3CD6 P;  4U0C A;  1T8K A;  2K2Q A;  2FQ2 A;  1X3O A;  2MVU A;  3B5I A;  2M8P A;  2KOP A;  2PNG A;  3CCV P;  2KOQ A;  1YJ9 P;  2PY8 A;  2FAE A;  1L0H A;  1RO0 A;  2GZF A;  1K73 Q;  2OTJ P;  3CCR P;  2K0Y A;  1NQ4 A;  1OR5 A;  1VQN P;  1NJI Q;  1UNK A;  2L0Q A;  1D1D A;  2XXM A;  4COP A;  2GDY A;  1A43 A;  2FVA A;  4COC A;  4HKG A;  3G26 A;  1KQS O;  3NTE A;  1YJN P;  2FVF A;  2EIA A;  1FR2 A;  4GR2 A;  5HGM A;  2EHS A;  2GDX A;  4BPG A;  1AUM A;  5KP8 B;  2KGE A;  2KGA A;  2VLO A;  2KGC A;  1VQ8 P;  4PH1 A;  4U0F A;  1GXG A;  1GPJ A;  2GZG A;  2JO0 A;  2E1M A;  2LML A;  1M74 A;  3RG6 C;  3CME P;  2JU2 A;  2KW2 A;  2N5H A;  2ROQ A;  5HV8 A;  4PXH B;  5DCK A;  2L4B A;  2VLP A;  3I56 P;  2N6Y A;  1F80 D;  4IZ6 A;  4R0M A;  5BS1 A;  4UHP B;  1DNY A;  1QVF O;  3DS1 A;  3GJN A;  3G4S P;  2LF4 A;  2XT1 A;  1VQM P;  1ZMB A;  2MY5 A;  1M1K Q;  2MR8 A;  3CCS P;  1YIT P;  3LMO A;  3DPH A;  3P05 A;  2K94 A;  3CMA P;  1MZ8 A;  2PEI A;  3E2D A;  1UJZ A;  2FHS C;  2MD9 A;  2K92 A;  3GZM A;  2AVA A;  3DTJ A;  1K9M Q;  2KWL A;  4QKO A;  2K0D X;  1IMP A;  3G71 P;  2OAR A;  3H0D A;  2BHV A;  2N50 A;  2CQ8 A;  2NO8 A;  2PEK A;  2Z46 A;  1VQ9 P;  2KOR A;  4QNB A;  3HZQ A;  1BAJ A;  1A8O A;  4XFX A;  4XFY A;  1VQ6 P;  3CXC O;  1VKU A;  2Z45 A;  2WPT A;  2K5X A;  4U0B A;  3NY7 B;  3EJD A;  1KC8 Q;  1YIJ P;  3B4Q A;  2JAZ A;  2EHT A; 
#chains in the Genus database with same CATH homology
 1E6J P;  1YI2 P;  4XRQ A;  1QVG O;  4IPY A;  4U0D A;  3CC4 P;  3CCE P;  4WYM A;  2JO0 A;  2E1M A;  5HGO A;  2OTL P;  2KOD A;  1M74 A;  5HGN A;  3RG6 C;  3CME P;  3OW2 O;  3H4E A;  5F2O A;  4PH0 A;  5BS2 A;  1W2B O;  3G1G A;  5DCK A;  3I56 P;  1VQL P;  3G29 A;  2CWO A;  2EFJ A;  1VQ7 P;  1Q7Y Q;  1N8R Q;  5BS1 A;  1M90 Q;  1EOQ A;  2JYL A;  1JJ2 O;  3G28 A;  1EIA A;  1QVF O;  3DS1 A;  3CC2 P;  1RO2 A;  3G4S P;  3DS4 A;  1YJW P;  2LF4 A;  1VQO P;  1VQ4 P;  2PEM A;  3DS2 A;  2XT1 A;  3CCU P;  2PEQ A;  2P9X A;  3M1M A;  2BUO A;  5I4T G;  1ZMB A;  3I55 P;  1VQM P;  2M8L A;  1VQ5 P;  1K8A Q;  3CD6 P;  4U0C A;  2PEJ A;  2ONT A;  1M1K Q;  1Q81 Q;  3B5I A;  2M8P A;  3G6E P;  4U0A A;  3CCS P;  1YIT P;  3CCV P;  1VQP P;  1YJ9 P;  3DPH A;  3P05 A;  1VQK P;  3CMA P;  2PY8 A;  2PEI A;  1RO0 A;  3E2D A;  1Q86 Q;  1K73 Q;  3CCM P;  2OTJ P;  1IUQ A;  3CPW O;  3CCR P;  5JPA A;  4M0I A;  2QEX P;  3DTJ A;  1KD1 Q;  1K9M Q;  1VQN P;  2PEN A;  2JYG A;  2M8N A;  1NJI Q;  3MGE A;  1S72 P;  3G71 P;  5HGL A;  2OAR A;  1D1D A;  2XXM A;  3H0D A;  4COP A;  5F2N A;  2BHV A;  1A43 A;  4COC A;  3CCJ P;  3G26 A;  4U0E A;  2PEK A;  1KQS O;  2QA4 P;  2Z46 A;  1VQ9 P;  3NTE A;  3DS0 A;  3G1I A;  4QNB A;  1YJN P;  3HZQ A;  3CCL P;  3H47 A;  1YHQ P;  3Q20 A;  1BAJ A;  2PEO A;  2EIA A;  4GR6 A;  1A8O A;  4GR2 A;  2XV6 A;  4XFX A;  4XFY A;  3G0V A;  3VRL C;  2EG5 A;  2L6E A;  4XFZ A;  5HGM A;  3WBH A;  1M6E X;  1VQ6 P;  3DS5 A;  3CXC O;  3LRY A;  1AUM A;  1M6N A;  2Z45 A;  1RNI A;  2DGY A;  4XRO A;  1QRJ A;  4U0B A;  1VQ8 P;  1KC8 Q;  2Z44 A;  3G21 A;  4PH1 A;  3CC7 P;  5F2K A;  1K30 A;  3HYB A;  1YIJ P;  1Q82 Q;  3DS3 A;  4U0F A;  3CCQ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...