1CEIA

Structure determination of the colicin e7 immunity protein (imme7) that binds specifically to the dnase-type colicin e7 and inhibits its bacteriocidal activity
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
LKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN E7 IMMUNITY PROTEIN
publication title The crystal structure of the immunity protein of colicin E7 suggests a possible colicin-interacting surface.
pubmed doi rcsb
molecule tags Antibacterial protein
total genus 28
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1996-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1ceiA00
1ZNVA 2GZIA 4F37A 2ERHA 4UHPB 1GXHA 1EMVA 2K0DX 3GJNA 2NO8A 2GZJA 2JAZA 1CEIA 2VLOA 3GKLC 7CEIA 4QKOA 5EW5E 1IMPA 1IMQA 1UJZA 3U43A 2GZGA 2K5XA 2GZFA 2VLQA 2JB0A 1BXIA 2JBGA 1MZ8A 2VLNA 2GZEA 1UNKA 2GYKA 1GXGA 1AYIA 1FR2A 2WPTA 1E0HA 2VLPA
chains in the Genus database with same CATH superfamily
2K2QA 4BPHA 1F80D 2NO8A 4PH1A 2LIWA 1ACPA 5JPAA 3E2DA 5EW5E 1GPJA 3H47A 1UJZA 2CQ8A 1VQKP 3NTEA 2FQ0A 4H2YC 4XFZA 4HKGA 1Q82Q 4PXHB 2N5IA 1A43A 1X3OA 4IPYA 2ONTA 5HGNA 4UHPB 1K9MQ 2KWLA 2K0YA 5CZDB 1K8AQ 2GDWA 1Q7YQ 2PEMA 5HV8A 2M5RA 2AF8A 2FAEA 2XZ0D 2XV6A 1AUMA 1VQPP 3RG6C 3EJDA 1E0HA 4BPGA 1HQBA 1ZNVA 2MY5A 3RG2A 2FVAA 2CG5B 2ROQA 3G1GA 3CCMP 3CXCO 2KGDA 2L4BA 3HYBA 7CEIA 5HGOA 1YITP 2KW2A 2GZGA 2XZ1C 3CCRP 1JJ2O 2PNGA 2AVAA 3DS5A 3G4SP 3CCEP 2KG9A 1YJ9P 2FHSC 2N98A 3DS3A 4DG9A 3G6EP 1M6EX 5BS1A 2K92A 4GR6A 2KR5A 3I55P 3M1MA 2GZFA 2K94A 3G21A 1GXGA 1FR2A 3G29A 2MR7A 1N8RQ 1D1DA 5HVCA 2KOSA 3CMAP 4GR2A 2AFEA 3CD6P 1L0HA 2KOPA 2MR8A 2LL8A 3GZLA 3VRLC 4H2WC 3B5IA 3CCSP 2EG5A 4F37A 2N5HA 3HZQA 2M8LA 1VQ7P 3G0VA 2LTEA 2DGYA 2KGEA 1VQNP 4PWVB 2KG6A 2N50A 2JO0A 2FQ1A 1DV5A 4U0FA 1VHNA 1AF8A 2FADA 2JYLA 2GZIA 1VQ9P 1Q86Q 3DS0A 2BUOA 3GJNA 2VLOA 3GKLC 2KOQA 5F2OA 3G28A 2M8NA 2QNWA 3CC2P 1W2BO 1VQOP 3DS1A 4XFXA 1MZ8A 1DNYA 1M6NA 4QNBA 2VLPA 3CCVP 3CC4P 2JGPA 1T8KA 2FACA 1VQ5P 1CEIA 4QKOA 4R0MA 2MD9A 2EHSA 2L9FA 3H4EA 2DNWA 1Z6MA 2LOLA 4PH0A 3NY7B 1S72P 1VQMP 2JAZA 2CWOA 2PEOA 4COCA 3DS4A 2EFJA 2KODA 2JBGA 2CGQA 1VQ6P 2KOOA 1RO0A 3H0DA 3G1IA 4XROA 5KP8B 2XXMA 2KORA 1GXHA 1EMVA 1M1KQ 2GZJA 1E6JP 2MVUA 2X2BA 2Z44A 3LMOA 4WYMA 3GZMA 2MVVA 2L22A 2KG8A 3CE7A 3CCUP 5DCKA 2Z46A 2LF4A 1RO2A 1ZMBA 2N6YA 3OW2O 1OR5A 2BHVA 5EJDA 4CA3A 2E1MA 3DS2A 2K0DX 3CCQP 2PEIA 2LIUA 1IMPA 1M74A 4IZ6A 2N6ZA 2VLQA 2JB0A 2EHTA 1NJIQ 2PEJA 5F2NA 3CC7P 1YHQP 2MF4A 2WPTA 5F2KA 2VSQA 2P9XA 2GDYA 2PEQA 5KP6B 3WBHA 1YJWP 3CMEP 3DPHA 4XFYA 1VQ8P 3Q20A 1IMQA 2JU1A 1M90Q 3CPWO 4XRQA 2LPKA 2M8PA 3G71P 2LMLA 4U0CA 1KC8Q 2ERHA 3CCJP 3DTJA 5KP7B 2K93A 3EJBA 4U0EA 1YI2P 1IUQA 2KGAA 1BAJA 2FQ2A 5HGLA 3MGEA 1VQ4P 3CCLP 1VQLP 3U43A 3B4QA 3I56P 2GZEA 4MRTC 2QA4P 2FVFA 1NQ4A 1QVFO 1HY8A 4U0DA 2K0XA 2OARA 4U0BA 2QEXP 2PENA 1K73Q 4H2XC 1L0IA 3LRYA 4BPFA 2CNRA 3EJEA 2JYGA 1EOQA 4NEOA 1UNKA 2GYKA 4COPA 5BS2A 2PY8A 4M0IA 2JQ4A 1Q81Q 1KD1Q 1YIJP 3P05A 2Z45A 1RNIA 2FVEA 3G26A 2KGCA 2LKIA 1K30A 2L0QA 1VKUA 1BXIA 2VLNA 5HGMA 2XT1A 2EIAA 2L6EA 1KLPA 1KQSO 2OTLP 1QRJA 4U0AA 5I4TG 2OTJP 2GDXA 2JU2A 2K5XA 1A8OA 2PEKA 1QVGO 2AFDA 1YJNP 1AYIA 1EIAA
chains in the Genus database with same CATH topology
1ZNVA 2GZIA 4F37A 2ERHA 4UHPB 1GXHA 1EMVA 2K0DX 3GJNA 2NO8A 2GZJA 2JAZA 1CEIA 2VLOA 3GKLC 7CEIA 4QKOA 5EW5E 1IMPA 1IMQA 1UJZA 3U43A 2GZGA 2K5XA 2GZFA 2VLQA 2JB0A 1BXIA 2JBGA 1MZ8A 2VLNA 2GZEA 1UNKA 2GYKA 1GXGA 1AYIA 1FR2A 2WPTA 1E0HA 2VLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZNV A;  2GZI A;  4F37 A;  2ERH A;  4UHP B;  1GXH A;  1EMV A;  2K0D X;  3GJN A;  2NO8 A;  2GZJ A;  2JAZ A;  1CEI A;  2VLO A;  3GKL C;  7CEI A;  4QKO A;  5EW5 E;  1IMP A;  1IMQ A;  1UJZ A;  3U43 A;  2GZG A;  2K5X A;  2GZF A;  2VLQ A;  2JB0 A;  1BXI A;  2JBG A;  1MZ8 A;  2VLN A;  2GZE A;  1UNK A;  2GYK A;  1GXG A;  1AYI A;  1FR2 A;  2WPT A;  1E0H A;  2VLP A; 
#chains in the Genus database with same CATH topology
 2K2Q A;  4BPH A;  1F80 D;  2NO8 A;  4PH1 A;  2LIW A;  1ACP A;  5JPA A;  3E2D A;  5EW5 E;  1GPJ A;  3H47 A;  1UJZ A;  2CQ8 A;  1VQK P;  3NTE A;  2FQ0 A;  4H2Y C;  4XFZ A;  4HKG A;  1Q82 Q;  4PXH B;  2N5I A;  1A43 A;  1X3O A;  4IPY A;  2ONT A;  5HGN A;  4UHP B;  1K9M Q;  2KWL A;  2K0Y A;  5CZD B;  1K8A Q;  2GDW A;  1Q7Y Q;  2PEM A;  5HV8 A;  2M5R A;  2AF8 A;  2FAE A;  2XZ0 D;  2XV6 A;  1AUM A;  1VQP P;  3RG6 C;  3EJD A;  1E0H A;  4BPG A;  1HQB A;  1ZNV A;  2MY5 A;  3RG2 A;  2FVA A;  2CG5 B;  2ROQ A;  3G1G A;  3CCM P;  3CXC O;  2KGD A;  2L4B A;  3HYB A;  7CEI A;  5HGO A;  1YIT P;  2KW2 A;  2GZG A;  2XZ1 C;  3CCR P;  1JJ2 O;  2PNG A;  2AVA A;  3DS5 A;  3G4S P;  3CCE P;  2KG9 A;  1YJ9 P;  2FHS C;  2N98 A;  3DS3 A;  4DG9 A;  3G6E P;  1M6E X;  5BS1 A;  2K92 A;  4GR6 A;  2KR5 A;  3I55 P;  3M1M A;  2GZF A;  2K94 A;  3G21 A;  1GXG A;  1FR2 A;  3G29 A;  2MR7 A;  1N8R Q;  1D1D A;  5HVC A;  2KOS A;  3CMA P;  4GR2 A;  2AFE A;  3CD6 P;  1L0H A;  2KOP A;  2MR8 A;  2LL8 A;  3GZL A;  3VRL C;  4H2W C;  3B5I A;  3CCS P;  2EG5 A;  4F37 A;  2N5H A;  3HZQ A;  2M8L A;  1VQ7 P;  3G0V A;  2LTE A;  2DGY A;  2KGE A;  1VQN P;  4PWV B;  2KG6 A;  2N50 A;  2JO0 A;  2FQ1 A;  1DV5 A;  4U0F A;  1VHN A;  1AF8 A;  2FAD A;  2JYL A;  2GZI A;  1VQ9 P;  1Q86 Q;  3DS0 A;  2BUO A;  3GJN A;  2VLO A;  3GKL C;  2KOQ A;  5F2O A;  3G28 A;  2M8N A;  2QNW A;  3CC2 P;  1W2B O;  1VQO P;  3DS1 A;  4XFX A;  1MZ8 A;  1DNY A;  1M6N A;  4QNB A;  2VLP A;  3CCV P;  3CC4 P;  2JGP A;  1T8K A;  2FAC A;  1VQ5 P;  1CEI A;  4QKO A;  4R0M A;  2MD9 A;  2EHS A;  2L9F A;  3H4E A;  2DNW A;  1Z6M A;  2LOL A;  4PH0 A;  3NY7 B;  1S72 P;  1VQM P;  2JAZ A;  2CWO A;  2PEO A;  4COC A;  3DS4 A;  2EFJ A;  2KOD A;  2JBG A;  2CGQ A;  1VQ6 P;  2KOO A;  1RO0 A;  3H0D A;  3G1I A;  4XRO A;  5KP8 B;  2XXM A;  2KOR A;  1GXH A;  1EMV A;  1M1K Q;  2GZJ A;  1E6J P;  2MVU A;  2X2B A;  2Z44 A;  3LMO A;  4WYM A;  3GZM A;  2MVV A;  2L22 A;  2KG8 A;  3CE7 A;  3CCU P;  5DCK A;  2Z46 A;  2LF4 A;  1RO2 A;  1ZMB A;  2N6Y A;  3OW2 O;  1OR5 A;  2BHV A;  5EJD A;  4CA3 A;  2E1M A;  3DS2 A;  2K0D X;  3CCQ P;  2PEI A;  2LIU A;  1IMP A;  1M74 A;  4IZ6 A;  2N6Z A;  2VLQ A;  2JB0 A;  2EHT A;  1NJI Q;  2PEJ A;  5F2N A;  3CC7 P;  1YHQ P;  2MF4 A;  2WPT A;  5F2K A;  2VSQ A;  2P9X A;  2GDY A;  2PEQ A;  5KP6 B;  3WBH A;  1YJW P;  3CME P;  3DPH A;  4XFY A;  1VQ8 P;  3Q20 A;  1IMQ A;  2JU1 A;  1M90 Q;  3CPW O;  4XRQ A;  2LPK A;  2M8P A;  3G71 P;  2LML A;  4U0C A;  1KC8 Q;  2ERH A;  3CCJ P;  3DTJ A;  5KP7 B;  2K93 A;  3EJB A;  4U0E A;  1YI2 P;  1IUQ A;  2KGA A;  1BAJ A;  2FQ2 A;  5HGL A;  3MGE A;  1VQ4 P;  3CCL P;  1VQL P;  3U43 A;  3B4Q A;  3I56 P;  2GZE A;  4MRT C;  2QA4 P;  2FVF A;  1NQ4 A;  1QVF O;  1HY8 A;  4U0D A;  2K0X A;  2OAR A;  4U0B A;  2QEX P;  2PEN A;  1K73 Q;  4H2X C;  1L0I A;  3LRY A;  4BPF A;  2CNR A;  3EJE A;  2JYG A;  1EOQ A;  4NEO A;  1UNK A;  2GYK A;  4COP A;  5BS2 A;  2PY8 A;  4M0I A;  2JQ4 A;  1Q81 Q;  1KD1 Q;  1YIJ P;  3P05 A;  2Z45 A;  1RNI A;  2FVE A;  3G26 A;  2KGC A;  2LKI A;  1K30 A;  2L0Q A;  1VKU A;  1BXI A;  2VLN A;  5HGM A;  2XT1 A;  2EIA A;  2L6E A;  1KLP A;  1KQS O;  2OTL P;  1QRJ A;  4U0A A;  5I4T G;  2OTJ P;  2GDX A;  2JU2 A;  2K5X A;  1A8O A;  2PEK A;  1QVG O;  2AFD A;  1YJN P;  1AYI A;  1EIA A; 
#chains in the Genus database with same CATH homology
 1ZNV A;  2GZI A;  4F37 A;  2ERH A;  4UHP B;  1GXH A;  1EMV A;  2K0D X;  3GJN A;  2NO8 A;  2GZJ A;  2JAZ A;  1CEI A;  2VLO A;  3GKL C;  7CEI A;  4QKO A;  5EW5 E;  1IMP A;  1IMQ A;  1UJZ A;  3U43 A;  2GZG A;  2K5X A;  2GZF A;  2VLQ A;  2JB0 A;  1BXI A;  2JBG A;  1MZ8 A;  2VLN A;  2GZE A;  1UNK A;  2GYK A;  1GXG A;  1AYI A;  1FR2 A;  2WPT A;  1E0H A;  2VLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...