1CEIA

Structure determination of the colicin e7 immunity protein (imme7) that binds specifically to the dnase-type colicin e7 and inhibits its bacteriocidal activity
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
LKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN E7 IMMUNITY PROTEIN
publication title The crystal structure of the immunity protein of colicin E7 suggests a possible colicin-interacting surface.
pubmed doi rcsb
molecule tags Antibacterial protein
total genus 28
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1996-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1ceiA00
2GZJA 4F37A 2K0DX 2GZFA 2VLQA 2VLNA 1UNKA 2JBGA 1MZ8A 1E0HA 1EMVA 1ZNVA 2GZEA 2K5XA 2VLPA 3GJNA 2VLOA 1AYIA 2GYKA 1IMQA 1CEIA 2WPTA 7CEIA 1IMPA 1GXGA 1GXHA 4QKOA 4UHPB 2ERHA 1FR2A 2GZIA 2JAZA 5EW5E 2JB0A 2NO8A 1BXIA 3GKLC 1UJZA 3U43A 2GZGA
chains in the Genus database with same CATH superfamily
1YIJP 2KGEA 2LTEA 2MR8A 5I4TG 5F2NA 1YITP 2JBGA 1E0HA 2AFDA 1D1DA 2PEQA 4PXHB 3GJNA 2N6ZA 3H0DA 2GYKA 2KGCA 4U0EA 2L4BA 3NY7B 1VQKP 2M5RA 2JU1A 3DPHA 4BPHA 2KW2A 4U0CA 2KORA 2AVAA 4H2YC 2OARA 3GKLC 2KG6A 1ZMBA 1S72P 5HGOA 1M90Q 1ZNVA 1M1KQ 5JPAA 1T8KA 2K0YA 2WPTA 3G26A 5HVCA 2Z44A 2MVUA 3CCSP 3DS0A 2GZJA 1HQBA 4HKGA 3CD6P 3G4SP 3CCMP 2JQ4A 1N8RQ 4GR6A 2PNGA 4XFXA 7CEIA 1KLPA 1GXHA 1Q81Q 2NO8A 2LIWA 2PENA 4H2XC 1L0IA 4U0AA 3G71P 1M6NA 2EG5A 1IMQA 2EHSA 2GDXA 3VRLC 2PEKA 2KGDA 3DS5A 2JAZA 5CZDB 4CA3A 2CWOA 4R0MA 2N6YA 3HZQA 3DS3A 5HGNA 1UNKA 3CC4P 4U0BA 2VLPA 3CCUP 5DCKA 2Z45A 2FVFA 1VQ9P 2L22A 1L0HA 2LF4A 2LMLA 1KQSO 1QRJA 4QKOA 1A8OA 1X3OA 1VQ4P 2LKIA 1BXIA 3DS4A 4DG9A 3P05A 1K30A 2FQ1A 3CXCO 2KWLA 2BHVA 2CNRA 2KODA 1AF8A 2FAEA 2AF8A 1OR5A 1YJ9P 1VQOP 2JB0A 2KG9A 1VQMP 1RO2A 2LPKA 5HGMA 1YHQP 2OTJP 2XXMA 3CC7P 1A43A 4COPA 1VQ5P 4QNBA 3I56P 4U0DA 2GZIA 5KP7B 2KOQA 3LRYA 3RG2A 2EHTA 2K2QA 1F80D 1K9MQ 1VHNA 2MD9A 4F37A 2EIAA 3DS1A 4IZ6A 2XV6A 1M74A 4IPYA 1MZ8A 3G1IA 5BS2A 1QVFO 2KR5A 3G28A 2Z46A 3CCVP 2L9FA 1CEIA 1GXGA 2QA4P 3CCEP 2DGYA 3E2DA 4XFYA 1M6EX 3CC2P 1Q86Q 2VSQA 2KOSA 2M8LA 2XZ0D 2GZFA 1E6JP 4XROA 2KG8A 1K8AQ 2XZ1C 4BPGA 4PH0A 3GZMA 4PWVB 3G21A 1DNYA 1RO0A 1QVGO 2JGPA 3G6EP 2K92A 2N5IA 3CCQP 2PEMA 1YJNP 3I55P 2PEJA 2ERHA 2CG5B 5BS1A 1KD1Q 3CMAP 2AFEA 2GZGA 3CCLP 2VLNA 3CPWO 4MRTC 5HGLA 4U0FA 3EJDA 1VQ6P 3EJEA 2KOPA 1RNIA 2KGAA 4GR2A 2KOOA 1JJ2O 5F2KA 4M0IA 1VQ8P 2QEXP 5EJDA 2M8NA 3DTJA 1EMVA 2FVEA 2L6EA 2CQ8A 2ROQA 2K93A 2JU2A 1DV5A 3MGEA 2P9XA 1BAJA 2QNWA 2DNWA 2FVAA 2PEIA 2MVVA 3HYBA 1K73Q 3EJBA 2JYGA 2FACA 3G0VA 2VLQA 1EOQA 2OTLP 4H2WC 2L0QA 2XT1A 1YJWP 2LIUA 1VKUA 2LOLA 1AYIA 1EIAA 1IUQA 3WBHA 2FQ2A 2CGQA 3RG6C 5EW5E 5F2OA 3G1GA 2ONTA 1UJZA 2FHSC 1VQPP 5KP6B 1VQLP 3OW2O 2JO0A 1AUMA 1Q7YQ 2K5XA 2MF4A 4COCA 2FQ0A 3B4QA 4XRQA 4UHPB 5HV8A 2MR7A 3CMEP 3CCRP 2K0DX 1VQ7P 2X2BA 1VQNP 2JYLA 3NTEA 3Q20A 4PH1A 3LMOA 2N50A 1FR2A 1GPJA 2M8PA 4WYMA 3GZLA 3G29A 3U43A 2N5HA 1ACPA 2GZEA 2VLOA 2GDWA 2N98A 1IMPA 3CCJP 1Z6MA 2MY5A 1YI2P 2LL8A 5KP8B 1HY8A 2EFJA 2K0XA 3H4EA 3CE7A 3DS2A 2E1MA 1W2BO 1Q82Q 3H47A 1NJIQ 2PEOA 3B5IA 2GDYA 1KC8Q 4NEOA 2PY8A 2FADA 4XFZA 1NQ4A 3M1MA 4BPFA 2K94A 2BUOA
chains in the Genus database with same CATH topology
2GZJA 4F37A 2K0DX 2GZFA 2VLQA 2VLNA 1UNKA 2JBGA 1MZ8A 1E0HA 1EMVA 1ZNVA 2GZEA 2K5XA 2VLPA 3GJNA 2VLOA 1AYIA 2GYKA 1IMQA 1CEIA 2WPTA 7CEIA 1IMPA 1GXGA 1GXHA 4QKOA 4UHPB 2ERHA 1FR2A 2GZIA 2JAZA 5EW5E 2JB0A 2NO8A 1BXIA 3GKLC 1UJZA 3U43A 2GZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZJ A;  4F37 A;  2K0D X;  2GZF A;  2VLQ A;  2VLN A;  1UNK A;  2JBG A;  1MZ8 A;  1E0H A;  1EMV A;  1ZNV A;  2GZE A;  2K5X A;  2VLP A;  3GJN A;  2VLO A;  1AYI A;  2GYK A;  1IMQ A;  1CEI A;  2WPT A;  7CEI A;  1IMP A;  1GXG A;  1GXH A;  4QKO A;  4UHP B;  2ERH A;  1FR2 A;  2GZI A;  2JAZ A;  5EW5 E;  2JB0 A;  2NO8 A;  1BXI A;  3GKL C;  1UJZ A;  3U43 A;  2GZG A; 
#chains in the Genus database with same CATH topology
 1YIJ P;  2KGE A;  2LTE A;  2MR8 A;  5I4T G;  5F2N A;  1YIT P;  2JBG A;  1E0H A;  2AFD A;  1D1D A;  2PEQ A;  4PXH B;  3GJN A;  2N6Z A;  3H0D A;  2GYK A;  2KGC A;  4U0E A;  2L4B A;  3NY7 B;  1VQK P;  2M5R A;  2JU1 A;  3DPH A;  4BPH A;  2KW2 A;  4U0C A;  2KOR A;  2AVA A;  4H2Y C;  2OAR A;  3GKL C;  2KG6 A;  1ZMB A;  1S72 P;  5HGO A;  1M90 Q;  1ZNV A;  1M1K Q;  5JPA A;  1T8K A;  2K0Y A;  2WPT A;  3G26 A;  5HVC A;  2Z44 A;  2MVU A;  3CCS P;  3DS0 A;  2GZJ A;  1HQB A;  4HKG A;  3CD6 P;  3G4S P;  3CCM P;  2JQ4 A;  1N8R Q;  4GR6 A;  2PNG A;  4XFX A;  7CEI A;  1KLP A;  1GXH A;  1Q81 Q;  2NO8 A;  2LIW A;  2PEN A;  4H2X C;  1L0I A;  4U0A A;  3G71 P;  1M6N A;  2EG5 A;  1IMQ A;  2EHS A;  2GDX A;  3VRL C;  2PEK A;  2KGD A;  3DS5 A;  2JAZ A;  5CZD B;  4CA3 A;  2CWO A;  4R0M A;  2N6Y A;  3HZQ A;  3DS3 A;  5HGN A;  1UNK A;  3CC4 P;  4U0B A;  2VLP A;  3CCU P;  5DCK A;  2Z45 A;  2FVF A;  1VQ9 P;  2L22 A;  1L0H A;  2LF4 A;  2LML A;  1KQS O;  1QRJ A;  4QKO A;  1A8O A;  1X3O A;  1VQ4 P;  2LKI A;  1BXI A;  3DS4 A;  4DG9 A;  3P05 A;  1K30 A;  2FQ1 A;  3CXC O;  2KWL A;  2BHV A;  2CNR A;  2KOD A;  1AF8 A;  2FAE A;  2AF8 A;  1OR5 A;  1YJ9 P;  1VQO P;  2JB0 A;  2KG9 A;  1VQM P;  1RO2 A;  2LPK A;  5HGM A;  1YHQ P;  2OTJ P;  2XXM A;  3CC7 P;  1A43 A;  4COP A;  1VQ5 P;  4QNB A;  3I56 P;  4U0D A;  2GZI A;  5KP7 B;  2KOQ A;  3LRY A;  3RG2 A;  2EHT A;  2K2Q A;  1F80 D;  1K9M Q;  1VHN A;  2MD9 A;  4F37 A;  2EIA A;  3DS1 A;  4IZ6 A;  2XV6 A;  1M74 A;  4IPY A;  1MZ8 A;  3G1I A;  5BS2 A;  1QVF O;  2KR5 A;  3G28 A;  2Z46 A;  3CCV P;  2L9F A;  1CEI A;  1GXG A;  2QA4 P;  3CCE P;  2DGY A;  3E2D A;  4XFY A;  1M6E X;  3CC2 P;  1Q86 Q;  2VSQ A;  2KOS A;  2M8L A;  2XZ0 D;  2GZF A;  1E6J P;  4XRO A;  2KG8 A;  1K8A Q;  2XZ1 C;  4BPG A;  4PH0 A;  3GZM A;  4PWV B;  3G21 A;  1DNY A;  1RO0 A;  1QVG O;  2JGP A;  3G6E P;  2K92 A;  2N5I A;  3CCQ P;  2PEM A;  1YJN P;  3I55 P;  2PEJ A;  2ERH A;  2CG5 B;  5BS1 A;  1KD1 Q;  3CMA P;  2AFE A;  2GZG A;  3CCL P;  2VLN A;  3CPW O;  4MRT C;  5HGL A;  4U0F A;  3EJD A;  1VQ6 P;  3EJE A;  2KOP A;  1RNI A;  2KGA A;  4GR2 A;  2KOO A;  1JJ2 O;  5F2K A;  4M0I A;  1VQ8 P;  2QEX P;  5EJD A;  2M8N A;  3DTJ A;  1EMV A;  2FVE A;  2L6E A;  2CQ8 A;  2ROQ A;  2K93 A;  2JU2 A;  1DV5 A;  3MGE A;  2P9X A;  1BAJ A;  2QNW A;  2DNW A;  2FVA A;  2PEI A;  2MVV A;  3HYB A;  1K73 Q;  3EJB A;  2JYG A;  2FAC A;  3G0V A;  2VLQ A;  1EOQ A;  2OTL P;  4H2W C;  2L0Q A;  2XT1 A;  1YJW P;  2LIU A;  1VKU A;  2LOL A;  1AYI A;  1EIA A;  1IUQ A;  3WBH A;  2FQ2 A;  2CGQ A;  3RG6 C;  5EW5 E;  5F2O A;  3G1G A;  2ONT A;  1UJZ A;  2FHS C;  1VQP P;  5KP6 B;  1VQL P;  3OW2 O;  2JO0 A;  1AUM A;  1Q7Y Q;  2K5X A;  2MF4 A;  4COC A;  2FQ0 A;  3B4Q A;  4XRQ A;  4UHP B;  5HV8 A;  2MR7 A;  3CME P;  3CCR P;  2K0D X;  1VQ7 P;  2X2B A;  1VQN P;  2JYL A;  3NTE A;  3Q20 A;  4PH1 A;  3LMO A;  2N50 A;  1FR2 A;  1GPJ A;  2M8P A;  4WYM A;  3GZL A;  3G29 A;  3U43 A;  2N5H A;  1ACP A;  2GZE A;  2VLO A;  2GDW A;  2N98 A;  1IMP A;  3CCJ P;  1Z6M A;  2MY5 A;  1YI2 P;  2LL8 A;  5KP8 B;  1HY8 A;  2EFJ A;  2K0X A;  3H4E A;  3CE7 A;  3DS2 A;  2E1M A;  1W2B O;  1Q82 Q;  3H47 A;  1NJI Q;  2PEO A;  3B5I A;  2GDY A;  1KC8 Q;  4NEO A;  2PY8 A;  2FAD A;  4XFZ A;  1NQ4 A;  3M1M A;  4BPF A;  2K94 A;  2BUO A; 
#chains in the Genus database with same CATH homology
 2GZJ A;  4F37 A;  2K0D X;  2GZF A;  2VLQ A;  2VLN A;  1UNK A;  2JBG A;  1MZ8 A;  1E0H A;  1EMV A;  1ZNV A;  2GZE A;  2K5X A;  2VLP A;  3GJN A;  2VLO A;  1AYI A;  2GYK A;  1IMQ A;  1CEI A;  2WPT A;  7CEI A;  1IMP A;  1GXG A;  1GXH A;  4QKO A;  4UHP B;  2ERH A;  1FR2 A;  2GZI A;  2JAZ A;  5EW5 E;  2JB0 A;  2NO8 A;  1BXI A;  3GKL C;  1UJZ A;  3U43 A;  2GZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...