1CEIA

Structure determination of the colicin e7 immunity protein (imme7) that binds specifically to the dnase-type colicin e7 and inhibits its bacteriocidal activity
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
LKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the immunity protein of colicin E7 suggests a possible colicin-interacting surface.
pubmed doi rcsb
molecule keywords COLICIN E7 IMMUNITY PROTEIN
molecule tags Antibacterial protein
total genus 28
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1996-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1ceiA00
3U43A 2VLOA 2ERHA 1GXHA 1BXIA 1GXGA 2GZIA 1FR2A 3GKLC 3GJNA 4QKOA 7CEIA 1IMPA 2GZGA 2GZJA 5EW5E 2VLPA 2VLQA 2GYKA 2WPTA 4F37A 2JAZA 1E0HA 2GZFA 2JBGA 2NO8A 2K5XA 1AYIA 1IMQA 1ZNVA 2GZEA 2JB0A 1MZ8A 1UNKA 1UJZA 1EMVA 4UHPB 1CEIA 2K0DX 2VLNA
chains in the Genus database with same CATH superfamily
2FADA 1M1KQ 2GDYA 3H0DA 3G1GA 1K73Q 5I4TG 2QA4P 2GDWA 1JJ2O 1VHNA 4GR6A 4PXHB 3H4EA 1VQMP 3DS4A 2AF8A 2JU1A 2PEMA 3DS1A 2X2BA 2OARA 3CCMP 1FR2A 1RO0A 4XFXA 3EJEA 1N8RQ 1W2BO 1E0HA 3VRLC 1KQSO 2NO8A 2MD9A 2MY5A 2ROQA 2CG5B 2GZEA 3NTEA 5F2KA 2KWLA 1VQ8P 1QVGO 1E6JP 2N5HA 1VKUA 1BAJA 2LIUA 2LMLA 1S72P 3DS3A 3DTJA 1VQ4P 2CNRA 4IPYA 2GDXA 2K5XA 1VQ6P 2E1MA 5F2OA 2PY8A 3G4SP 3CC7P 3CC2P 2KOSA 4H2XC 2KG9A 2K2QA 1Z6MA 2CWOA 3Q20A 2BUOA 2LTEA 3CCUP 3HYBA 3DS2A 5CZDB 1DV5A 2K0YA 2JBGA 1F80D 5HGOA 2PEJA 4BPGA 1UNKA 2AFDA 2KW2A 2CGQA 3M1MA 2N5IA 2VLNA 2XZ1C 5HGMA 1QRJA 4M0IA 3GKLC 2KR5A 7CEIA 2M8NA 1KD1Q 1QVFO 3LMOA 2KGEA 2EFJA 1KLPA 1Q82Q 1VQOP 2KGDA 3H47A 1YJWP 3CMEP 1AF8A 1YIJP 2LKIA 1YJNP 3G26A 3G21A 1VQLP 5BS2A 4GR2A 1GXHA 2VSQA 2WPTA 3CPWO 3EJBA 1RO2A 2KGCA 2AFEA 2MVVA 2FHSC 4U0CA 4R0MA 3DS0A 2JQ4A 2ONTA 2PEQA 2M8PA 3CCEP 3B4QA 4U0EA 2QEXP 4COCA 2XZ0D 4XFZA 2FACA 2PEKA 4HKGA 1ZMBA 1K30A 4PH1A 3CXCO 3G0VA 1M6NA 2MVUA 2FQ2A 1MZ8A 1M6EX 2N6ZA 2KORA 1ACPA 2N98A 2FVFA 4H2WC 3DS5A 2P9XA 1IMPA 2KODA 2MR7A 3CCSP 2JO0A 3MGEA 4DG9A 3CD6P 1M90Q 2Z45A 2XV6A 3OW2O 2Z46A 1K8AQ 3U43A 2XT1A 2Z44A 3P05A 3G28A 5F2NA 2JU2A 3B5IA 3CCRP 3GJNA 3CCVP 2KG8A 4U0DA 2GZJA 4PH0A 2JAZA 2L0QA 2LF4A 4COPA 2MR8A 3E2DA 2AVAA 2JYGA 4BPFA 2GZGA 2GYKA 4F37A 3NY7B 4U0AA 4NEOA 1AYIA 5DCKA 1EMVA 1D1DA 2L22A 4UHPB 1X3OA 2EHSA 3CE7A 5HVCA 3G6EP 2FVAA 2KOPA 2KOQA 3GZLA 2K92A 2PEIA 5JPAA 4QNBA 4CA3A 1VQ5P 2CQ8A 2EIAA 2L9FA 2N6YA 5KP6B 4IZ6A 1M74A 2FQ1A 5HV8A 3LRYA 1EIAA 3I56P 1NJIQ 1HY8A 1NQ4A 2DGYA 2ERHA 2KOOA 1GXGA 4QKOA 1HQBA 3HZQA 4XRQA 1T8KA 1YJ9P 1VQ7P 1OR5A 5KP8B 3CMAP 1RNIA 1UJZA 2DNWA 2M8LA 3G1IA 1L0HA 1IUQA 1CEIA 2K0DX 3G71P 3DPHA 1YHQP 1EOQA 1Q7YQ 5KP7B 1VQNP 2VLQA 2JYLA 2PENA 5BS1A 2FQ0A 1A8OA 1DNYA 1KC8Q 1YITP 2BHVA 2FVEA 3GZMA 1ZNVA 3I55P 2L6EA 4U0BA 4XROA 2FAEA 1VQPP 1L0IA 4H2YC 2K94A 1A43A 3CCQP 3EJDA 5EW5E 2KGAA 1K9MQ 2OTLP 4MRTC 2N50A 2LPKA 5HGLA 3CCJP 2JB0A 2K93A 5EJDA 1VQ9P 3WBHA 4PWVB 4U0FA 2VLOA 2L4BA 2GZIA 3RG2A 3CCLP 2GZFA 2LL8A 2OTJP 2QNWA 1Q86Q 1IMQA 2M5RA 1AUMA 2MF4A 2PEOA 1YI2P 2PNGA 2EHTA 1Q81Q 1GPJA 2JGPA 4XFYA 4BPHA 2K0XA 4WYMA 3RG6C 2KG6A 1BXIA 3G29A 2VLPA 2LOLA 2XXMA 2EG5A 2LIWA 3CC4P 5HGNA 1VQKP
chains in the Genus database with same CATH topology
3U43A 2VLOA 2ERHA 1GXHA 1BXIA 1GXGA 2GZIA 1FR2A 3GKLC 3GJNA 4QKOA 7CEIA 1IMPA 2GZGA 2GZJA 5EW5E 2VLPA 2VLQA 2GYKA 2WPTA 4F37A 2JAZA 1E0HA 2GZFA 2JBGA 2NO8A 2K5XA 1AYIA 1IMQA 1ZNVA 2GZEA 2JB0A 1MZ8A 1UNKA 1UJZA 1EMVA 4UHPB 1CEIA 2K0DX 2VLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U43 A;  2VLO A;  2ERH A;  1GXH A;  1BXI A;  1GXG A;  2GZI A;  1FR2 A;  3GKL C;  3GJN A;  4QKO A;  7CEI A;  1IMP A;  2GZG A;  2GZJ A;  5EW5 E;  2VLP A;  2VLQ A;  2GYK A;  2WPT A;  4F37 A;  2JAZ A;  1E0H A;  2GZF A;  2JBG A;  2NO8 A;  2K5X A;  1AYI A;  1IMQ A;  1ZNV A;  2GZE A;  2JB0 A;  1MZ8 A;  1UNK A;  1UJZ A;  1EMV A;  4UHP B;  1CEI A;  2K0D X;  2VLN A; 
#chains in the Genus database with same CATH topology
 2FAD A;  1M1K Q;  2GDY A;  3H0D A;  3G1G A;  1K73 Q;  5I4T G;  2QA4 P;  2GDW A;  1JJ2 O;  1VHN A;  4GR6 A;  4PXH B;  3H4E A;  1VQM P;  3DS4 A;  2AF8 A;  2JU1 A;  2PEM A;  3DS1 A;  2X2B A;  2OAR A;  3CCM P;  1FR2 A;  1RO0 A;  4XFX A;  3EJE A;  1N8R Q;  1W2B O;  1E0H A;  3VRL C;  1KQS O;  2NO8 A;  2MD9 A;  2MY5 A;  2ROQ A;  2CG5 B;  2GZE A;  3NTE A;  5F2K A;  2KWL A;  1VQ8 P;  1QVG O;  1E6J P;  2N5H A;  1VKU A;  1BAJ A;  2LIU A;  2LML A;  1S72 P;  3DS3 A;  3DTJ A;  1VQ4 P;  2CNR A;  4IPY A;  2GDX A;  2K5X A;  1VQ6 P;  2E1M A;  5F2O A;  2PY8 A;  3G4S P;  3CC7 P;  3CC2 P;  2KOS A;  4H2X C;  2KG9 A;  2K2Q A;  1Z6M A;  2CWO A;  3Q20 A;  2BUO A;  2LTE A;  3CCU P;  3HYB A;  3DS2 A;  5CZD B;  1DV5 A;  2K0Y A;  2JBG A;  1F80 D;  5HGO A;  2PEJ A;  4BPG A;  1UNK A;  2AFD A;  2KW2 A;  2CGQ A;  3M1M A;  2N5I A;  2VLN A;  2XZ1 C;  5HGM A;  1QRJ A;  4M0I A;  3GKL C;  2KR5 A;  7CEI A;  2M8N A;  1KD1 Q;  1QVF O;  3LMO A;  2KGE A;  2EFJ A;  1KLP A;  1Q82 Q;  1VQO P;  2KGD A;  3H47 A;  1YJW P;  3CME P;  1AF8 A;  1YIJ P;  2LKI A;  1YJN P;  3G26 A;  3G21 A;  1VQL P;  5BS2 A;  4GR2 A;  1GXH A;  2VSQ A;  2WPT A;  3CPW O;  3EJB A;  1RO2 A;  2KGC A;  2AFE A;  2MVV A;  2FHS C;  4U0C A;  4R0M A;  3DS0 A;  2JQ4 A;  2ONT A;  2PEQ A;  2M8P A;  3CCE P;  3B4Q A;  4U0E A;  2QEX P;  4COC A;  2XZ0 D;  4XFZ A;  2FAC A;  2PEK A;  4HKG A;  1ZMB A;  1K30 A;  4PH1 A;  3CXC O;  3G0V A;  1M6N A;  2MVU A;  2FQ2 A;  1MZ8 A;  1M6E X;  2N6Z A;  2KOR A;  1ACP A;  2N98 A;  2FVF A;  4H2W C;  3DS5 A;  2P9X A;  1IMP A;  2KOD A;  2MR7 A;  3CCS P;  2JO0 A;  3MGE A;  4DG9 A;  3CD6 P;  1M90 Q;  2Z45 A;  2XV6 A;  3OW2 O;  2Z46 A;  1K8A Q;  3U43 A;  2XT1 A;  2Z44 A;  3P05 A;  3G28 A;  5F2N A;  2JU2 A;  3B5I A;  3CCR P;  3GJN A;  3CCV P;  2KG8 A;  4U0D A;  2GZJ A;  4PH0 A;  2JAZ A;  2L0Q A;  2LF4 A;  4COP A;  2MR8 A;  3E2D A;  2AVA A;  2JYG A;  4BPF A;  2GZG A;  2GYK A;  4F37 A;  3NY7 B;  4U0A A;  4NEO A;  1AYI A;  5DCK A;  1EMV A;  1D1D A;  2L22 A;  4UHP B;  1X3O A;  2EHS A;  3CE7 A;  5HVC A;  3G6E P;  2FVA A;  2KOP A;  2KOQ A;  3GZL A;  2K92 A;  2PEI A;  5JPA A;  4QNB A;  4CA3 A;  1VQ5 P;  2CQ8 A;  2EIA A;  2L9F A;  2N6Y A;  5KP6 B;  4IZ6 A;  1M74 A;  2FQ1 A;  5HV8 A;  3LRY A;  1EIA A;  3I56 P;  1NJI Q;  1HY8 A;  1NQ4 A;  2DGY A;  2ERH A;  2KOO A;  1GXG A;  4QKO A;  1HQB A;  3HZQ A;  4XRQ A;  1T8K A;  1YJ9 P;  1VQ7 P;  1OR5 A;  5KP8 B;  3CMA P;  1RNI A;  1UJZ A;  2DNW A;  2M8L A;  3G1I A;  1L0H A;  1IUQ A;  1CEI A;  2K0D X;  3G71 P;  3DPH A;  1YHQ P;  1EOQ A;  1Q7Y Q;  5KP7 B;  1VQN P;  2VLQ A;  2JYL A;  2PEN A;  5BS1 A;  2FQ0 A;  1A8O A;  1DNY A;  1KC8 Q;  1YIT P;  2BHV A;  2FVE A;  3GZM A;  1ZNV A;  3I55 P;  2L6E A;  4U0B A;  4XRO A;  2FAE A;  1VQP P;  1L0I A;  4H2Y C;  2K94 A;  1A43 A;  3CCQ P;  3EJD A;  5EW5 E;  2KGA A;  1K9M Q;  2OTL P;  4MRT C;  2N50 A;  2LPK A;  5HGL A;  3CCJ P;  2JB0 A;  2K93 A;  5EJD A;  1VQ9 P;  3WBH A;  4PWV B;  4U0F A;  2VLO A;  2L4B A;  2GZI A;  3RG2 A;  3CCL P;  2GZF A;  2LL8 A;  2OTJ P;  2QNW A;  1Q86 Q;  1IMQ A;  2M5R A;  1AUM A;  2MF4 A;  2PEO A;  1YI2 P;  2PNG A;  2EHT A;  1Q81 Q;  1GPJ A;  2JGP A;  4XFY A;  4BPH A;  2K0X A;  4WYM A;  3RG6 C;  2KG6 A;  1BXI A;  3G29 A;  2VLP A;  2LOL A;  2XXM A;  2EG5 A;  2LIW A;  3CC4 P;  5HGN A;  1VQK P; 
#chains in the Genus database with same CATH homology
 3U43 A;  2VLO A;  2ERH A;  1GXH A;  1BXI A;  1GXG A;  2GZI A;  1FR2 A;  3GKL C;  3GJN A;  4QKO A;  7CEI A;  1IMP A;  2GZG A;  2GZJ A;  5EW5 E;  2VLP A;  2VLQ A;  2GYK A;  2WPT A;  4F37 A;  2JAZ A;  1E0H A;  2GZF A;  2JBG A;  2NO8 A;  2K5X A;  1AYI A;  1IMQ A;  1ZNV A;  2GZE A;  2JB0 A;  1MZ8 A;  1UNK A;  1UJZ A;  1EMV A;  4UHP B;  1CEI A;  2K0D X;  2VLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...