1A8OA

Hiv capsid c-terminal domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
MDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV CAPSID
publication title Structure of the carboxyl-terminal dimerization domain of the HIV-1 capsid protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 22
structure length 70
sequence length 70
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1a8oA00
3P05A 1A8OA 2M8PA 2KODA 3DS3A 4M0IA 3VRLC 1D1DA 1EOQA 1EIAA 3MGEA 2JYLA 4WYMA 3NTEA 3DS4A 3H47A 2XT1A 3DS5A 3G0VA 2JO0A 1A43A 4QNBA 2ONTA 4XFYA 2XXMA 2LF4A 3DS2A 4U0AA 4XROA 2BUOA 3DTJA 3G29A 4U0FA 4COPA 3G1IA 5DCKA 5HGNA 3LRYA 4XFXA 4U0CA 4COCA 2M8NA 1QRJA 3G28A 4U0EA 1E6JP 4U0BA 3DPHA 4IPYA 5JPAA 4XFZA 4XRQA 5I4TG 3G21A 4U0DA 3DS0A 3DS1A 3G26A 3H4EA 5HGLA 5HGMA 4PH1A 4PH0A 5HGOA 2JYGA 2L6EA 1AUMA 2XV6A 2M8LA 1BAJA 3G1GA 2EIAA
chains in the Genus database with same CATH superfamily
1AF8A 3VRLC 3LMOA 1VQLP 1CEIA 1M74A 1ACPA 2LL8A 3GJNA 4CA3A 1NJIQ 1YITP 2XXMA 4DG9A 2CQ8A 3DS2A 3CCSP 1KLPA 3CD6P 2JAZA 3RG6C 2JU1A 2M8NA 1MZ8A 3G6EP 2OTLP 1IMQA 2K0YA 1NQ4A 1UJZA 2N5HA 1D1DA 2MY5A 1QVFO 1K8AQ 3CCJP 3CCUP 1RNIA 2E1MA 3EJEA 2GYKA 3GZMA 3LRYA 2MVUA 2JBGA 1QRJA 2GZEA 3M1MA 4U0EA 1KQSO 4UHPB 2FQ0A 1YJ9P 3G21A 4PH0A 1YI2P 3CCVP 3G1GA 2Z46A 4H2WC 1EOQA 2AFDA 2VLOA 5EW5E 2ROQA 1VQKP 2PEIA 2DNWA 5DCKA 5EJDA 1BXIA 4HKGA 3EJDA 2QEXP 1DNYA 2FVFA 4QKOA 3DS0A 1Z6MA 2MVVA 5BS2A 1W2BO 2P9XA 2EHSA 2XT1A 1ZNVA 1A43A 2LF4A 4U0FA 2L4BA 2KOPA 1M6EX 5JPAA 2OTJP 1VQ8P 2KORA 2AFEA 1AUMA 1IMPA 2EIAA 2GDXA 2FQ2A 3WBHA 2QNWA 3DS4A 4BPGA 5CZDB 5HVCA 4U0CA 7CEIA 2N5IA 4GR2A 2LPKA 4BPHA 1ZMBA 3CMAP 2N98A 4GR6A 2LIUA 2K94A 1VQ6P 1Q81Q 1L0IA 2Z45A 1HY8A 5HGNA 4PXHB 3DPHA 5F2NA 2KOSA 1RO0A 3CCQP 3CCLP 4H2XC 2FVEA 2PEMA 1S72P 1K30A 1A8OA 4M0IA 1EMVA 2KOOA 4QNBA 3Q20A 1VQPP 1GXGA 4U0AA 2KG9A 4XROA 1VQOP 1Q7YQ 1IUQA 2KW2A 4XFXA 4BPFA 2FQ1A 5HV8A 2PY8A 4F37A 2JGPA 3I56P 3P05A 2GZIA 2ERHA 4WYMA 2N50A 2PEJA 2EFJA 3CCMP 3G29A 2CG5B 3G71P 1RO2A 3DS1A 2VLNA 1M6NA 2LMLA 3EJBA 2KGAA 2QA4P 2JO0A 3GKLC 2FHSC 2ONTA 5KP8B 1X3OA 2GDWA 2N6YA 4COPA 2KGEA 2DGYA 2XZ1C 2GZGA 1OR5A 2K0XA 3U43A 5F2OA 2L9FA 5I4TG 3G4SP 3H0DA 5HGLA 1T8KA 1Q82Q 2KODA 1VQMP 1EIAA 1K73Q 3CC4P 2PEKA 3G0VA 1K9MQ 1KD1Q 4XFYA 2EHTA 3NY7B 4NEOA 5KP6B 1VQ7P 2JB0A 3HYBA 2JQ4A 3HZQA 2K92A 2GZFA 1M90Q 1VQ4P 5KP7B 2K2QA 2GZJA 2CNRA 1DV5A 1Q86Q 2KG6A 2GDYA 2L22A 2LKIA 2K0DX 1GXHA 1VQ5P 2MF4A 3G1IA 2LIWA 4XRQA 2KGCA 2Z44A 3CCRP 1M1KQ 4PH1A 2OARA 2KWLA 2LOLA 2PNGA 2PEQA 2N6ZA 3RG2A 2AVAA 3CPWO 4U0BA 2BHVA 2AF8A 1E0HA 2MR8A 3CMEP 3GZLA 3CXCO 3G26A 4H2YC 3B5IA 2M8LA 2XV6A 1BAJA 2M8PA 3DS3A 1VKUA 2KGDA 1GPJA 3NTEA 3DS5A 2M5RA 1UNKA 2PENA 1YJWP 2FAEA 4R0MA 2BUOA 2KR5A 2VSQA 4U0DA 3CCEP 3CC2P 2NO8A 2CGQA 2JYGA 2KOQA 2X2BA 2LTEA 1HQBA 3MGEA 4IZ6A 1JJ2O 1YJNP 2VLPA 5BS1A 3OW2O 3CE7A 4MRTC 1E6JP 1VQ9P 2MD9A 1VQNP 1VHNA 5HGMA 1YIJP 2L6EA 2L0QA 2K5XA 4PWVB 3I55P 1F80D 2CWOA 3CC7P 2K93A 2VLQA 2PEOA 1N8RQ 2XZ0D 5F2KA 1AYIA 3H4EA 5HGOA 1YHQP 2JU2A 2WPTA 2JYLA 1FR2A 3H47A 2EG5A 1L0HA 3DTJA 2KG8A 3E2DA 2MR7A 1KC8Q 4COCA 3G28A 4IPYA 3B4QA 4XFZA 2FACA 2FADA 1QVGO 2FVAA
chains in the Genus database with same CATH topology
2M8PA 3DS3A 3VRLC 1VQLP 3WBHA 1M74A 3NTEA 3DS4A 3DS5A 2QA4P 2JO0A 2ONTA 2PENA 1NJIQ 1YJWP 1YITP 2XXMA 3CCSP 3DS2A 2BUOA 4COPA 3CD6P 2DGYA 4U0CA 2M8NA 3RG6C 3G6EP 5F2OA 5I4TG 3G4SP 4GR2A 4U0DA 3CCEP 2OTLP 3H0DA 3CC2P 5HGLA 1Q82Q 2JYGA 1ZMBA 3CMAP 2KODA 4GR6A 1VQMP 1D1DA 1EIAA 1K73Q 3MGEA 1QVFO 1VQ6P 1K8AQ 3CC4P 2PEKA 1JJ2O 1Q81Q 3G0VA 1YJNP 1K9MQ 3CCJP 1KD1Q 4XFYA 1RNIA 3CCUP 2Z45A 5BS1A 3OW2O 1VQ7P 2E1MA 5HGNA 3LRYA 3HYBA 1QRJA 3M1MA 1E6JP 4U0EA 3DPHA 5F2NA 1KQSO 1VQ9P 3HZQA 1VQNP 1RO0A 1YJ9P 3CCQP 3G21A 3CCLP 5HGMA 1M90Q 4PH0A 1YI2P 1YIJP 2PEMA 2L6EA 1S72P 1VQ4P 1K30A 3G1GA 2Z46A 3CCVP 1A8OA 4M0IA 1Q86Q 1EOQA 3I55P 2CWOA 3CC7P 4QNBA 3Q20A 1VQPP 4U0AA 1VQKP 4XROA 2PEIA 2PEOA 1VQOP 1VQ5P 1N8RQ 1Q7YQ 3G1IA 1IUQA 5DCKA 4XFXA 5F2KA 2QEXP 2PY8A 4XRQA 2Z44A 3DS0A 3H4EA 3CCRP 1M1KQ 4PH1A 5BS2A 5HGOA 1YHQP 3I56P 1W2BO 2OARA 2P9XA 3P05A 2JYLA 4WYMA 2PEQA 3H47A 2PEJA 2XT1A 2EG5A 2EFJA 1A43A 2LF4A 3CCMP 3DTJA 3G29A 4U0FA 3CPWO 3E2DA 1KC8Q 4COCA 1M6EX 3G28A 2BHVA 4U0BA 5JPAA 3G71P 4IPYA 2OTJP 4XFZA 1RO2A 1VQ8P 3CMEP 3CXCO 3DS1A 3G26A 3B5IA 1QVGO 1M6NA 1AUMA 2XV6A 2M8LA 1BAJA 2EIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P05 A;  1A8O A;  2M8P A;  2KOD A;  3DS3 A;  4M0I A;  3VRL C;  1D1D A;  1EOQ A;  1EIA A;  3MGE A;  2JYL A;  4WYM A;  3NTE A;  3DS4 A;  3H47 A;  2XT1 A;  3DS5 A;  3G0V A;  2JO0 A;  1A43 A;  4QNB A;  2ONT A;  4XFY A;  2XXM A;  2LF4 A;  3DS2 A;  4U0A A;  4XRO A;  2BUO A;  3DTJ A;  3G29 A;  4U0F A;  4COP A;  3G1I A;  5DCK A;  5HGN A;  3LRY A;  4XFX A;  4U0C A;  4COC A;  2M8N A;  1QRJ A;  3G28 A;  4U0E A;  1E6J P;  4U0B A;  3DPH A;  4IPY A;  5JPA A;  4XFZ A;  4XRQ A;  5I4T G;  3G21 A;  4U0D A;  3DS0 A;  3DS1 A;  3G26 A;  3H4E A;  5HGL A;  5HGM A;  4PH1 A;  4PH0 A;  5HGO A;  2JYG A;  2L6E A;  1AUM A;  2XV6 A;  2M8L A;  1BAJ A;  3G1G A;  2EIA A; 
#chains in the Genus database with same CATH topology
 1AF8 A;  3VRL C;  3LMO A;  1VQL P;  1CEI A;  1M74 A;  1ACP A;  2LL8 A;  3GJN A;  4CA3 A;  1NJI Q;  1YIT P;  2XXM A;  4DG9 A;  2CQ8 A;  3DS2 A;  3CCS P;  1KLP A;  3CD6 P;  2JAZ A;  3RG6 C;  2JU1 A;  2M8N A;  1MZ8 A;  3G6E P;  2OTL P;  1IMQ A;  2K0Y A;  1NQ4 A;  1UJZ A;  2N5H A;  1D1D A;  2MY5 A;  1QVF O;  1K8A Q;  3CCJ P;  3CCU P;  1RNI A;  2E1M A;  3EJE A;  2GYK A;  3GZM A;  3LRY A;  2MVU A;  2JBG A;  1QRJ A;  2GZE A;  3M1M A;  4U0E A;  1KQS O;  4UHP B;  2FQ0 A;  1YJ9 P;  3G21 A;  4PH0 A;  1YI2 P;  3CCV P;  3G1G A;  2Z46 A;  4H2W C;  1EOQ A;  2AFD A;  2VLO A;  5EW5 E;  2ROQ A;  1VQK P;  2PEI A;  2DNW A;  5DCK A;  5EJD A;  1BXI A;  4HKG A;  3EJD A;  2QEX P;  1DNY A;  2FVF A;  4QKO A;  3DS0 A;  1Z6M A;  2MVV A;  5BS2 A;  1W2B O;  2P9X A;  2EHS A;  2XT1 A;  1ZNV A;  1A43 A;  2LF4 A;  4U0F A;  2L4B A;  2KOP A;  1M6E X;  5JPA A;  2OTJ P;  1VQ8 P;  2KOR A;  2AFE A;  1AUM A;  1IMP A;  2EIA A;  2GDX A;  2FQ2 A;  3WBH A;  2QNW A;  3DS4 A;  4BPG A;  5CZD B;  5HVC A;  4U0C A;  7CEI A;  2N5I A;  4GR2 A;  2LPK A;  4BPH A;  1ZMB A;  3CMA P;  2N98 A;  4GR6 A;  2LIU A;  2K94 A;  1VQ6 P;  1Q81 Q;  1L0I A;  2Z45 A;  1HY8 A;  5HGN A;  4PXH B;  3DPH A;  5F2N A;  2KOS A;  1RO0 A;  3CCQ P;  3CCL P;  4H2X C;  2FVE A;  2PEM A;  1S72 P;  1K30 A;  1A8O A;  4M0I A;  1EMV A;  2KOO A;  4QNB A;  3Q20 A;  1VQP P;  1GXG A;  4U0A A;  2KG9 A;  4XRO A;  1VQO P;  1Q7Y Q;  1IUQ A;  2KW2 A;  4XFX A;  4BPF A;  2FQ1 A;  5HV8 A;  2PY8 A;  4F37 A;  2JGP A;  3I56 P;  3P05 A;  2GZI A;  2ERH A;  4WYM A;  2N50 A;  2PEJ A;  2EFJ A;  3CCM P;  3G29 A;  2CG5 B;  3G71 P;  1RO2 A;  3DS1 A;  2VLN A;  1M6N A;  2LML A;  3EJB A;  2KGA A;  2QA4 P;  2JO0 A;  3GKL C;  2FHS C;  2ONT A;  5KP8 B;  1X3O A;  2GDW A;  2N6Y A;  4COP A;  2KGE A;  2DGY A;  2XZ1 C;  2GZG A;  1OR5 A;  2K0X A;  3U43 A;  5F2O A;  2L9F A;  5I4T G;  3G4S P;  3H0D A;  5HGL A;  1T8K A;  1Q82 Q;  2KOD A;  1VQM P;  1EIA A;  1K73 Q;  3CC4 P;  2PEK A;  3G0V A;  1K9M Q;  1KD1 Q;  4XFY A;  2EHT A;  3NY7 B;  4NEO A;  5KP6 B;  1VQ7 P;  2JB0 A;  3HYB A;  2JQ4 A;  3HZQ A;  2K92 A;  2GZF A;  1M90 Q;  1VQ4 P;  5KP7 B;  2K2Q A;  2GZJ A;  2CNR A;  1DV5 A;  1Q86 Q;  2KG6 A;  2GDY A;  2L22 A;  2LKI A;  2K0D X;  1GXH A;  1VQ5 P;  2MF4 A;  3G1I A;  2LIW A;  4XRQ A;  2KGC A;  2Z44 A;  3CCR P;  1M1K Q;  4PH1 A;  2OAR A;  2KWL A;  2LOL A;  2PNG A;  2PEQ A;  2N6Z A;  3RG2 A;  2AVA A;  3CPW O;  4U0B A;  2BHV A;  2AF8 A;  1E0H A;  2MR8 A;  3CME P;  3GZL A;  3CXC O;  3G26 A;  4H2Y C;  3B5I A;  2M8L A;  2XV6 A;  1BAJ A;  2M8P A;  3DS3 A;  1VKU A;  2KGD A;  1GPJ A;  3NTE A;  3DS5 A;  2M5R A;  1UNK A;  2PEN A;  1YJW P;  2FAE A;  4R0M A;  2BUO A;  2KR5 A;  2VSQ A;  4U0D A;  3CCE P;  3CC2 P;  2NO8 A;  2CGQ A;  2JYG A;  2KOQ A;  2X2B A;  2LTE A;  1HQB A;  3MGE A;  4IZ6 A;  1JJ2 O;  1YJN P;  2VLP A;  5BS1 A;  3OW2 O;  3CE7 A;  4MRT C;  1E6J P;  1VQ9 P;  2MD9 A;  1VQN P;  1VHN A;  5HGM A;  1YIJ P;  2L6E A;  2L0Q A;  2K5X A;  4PWV B;  3I55 P;  1F80 D;  2CWO A;  3CC7 P;  2K93 A;  2VLQ A;  2PEO A;  1N8R Q;  2XZ0 D;  5F2K A;  1AYI A;  3H4E A;  5HGO A;  1YHQ P;  2JU2 A;  2WPT A;  2JYL A;  1FR2 A;  3H47 A;  2EG5 A;  1L0H A;  3DTJ A;  2KG8 A;  3E2D A;  2MR7 A;  1KC8 Q;  4COC A;  3G28 A;  4IPY A;  3B4Q A;  4XFZ A;  2FAC A;  2FAD A;  1QVG O;  2FVA A; 
#chains in the Genus database with same CATH homology
 2M8P A;  3DS3 A;  3VRL C;  1VQL P;  3WBH A;  1M74 A;  3NTE A;  3DS4 A;  3DS5 A;  2QA4 P;  2JO0 A;  2ONT A;  2PEN A;  1NJI Q;  1YJW P;  1YIT P;  2XXM A;  3CCS P;  3DS2 A;  2BUO A;  4COP A;  3CD6 P;  2DGY A;  4U0C A;  2M8N A;  3RG6 C;  3G6E P;  5F2O A;  5I4T G;  3G4S P;  4GR2 A;  4U0D A;  3CCE P;  2OTL P;  3H0D A;  3CC2 P;  5HGL A;  1Q82 Q;  2JYG A;  1ZMB A;  3CMA P;  2KOD A;  4GR6 A;  1VQM P;  1D1D A;  1EIA A;  1K73 Q;  3MGE A;  1QVF O;  1VQ6 P;  1K8A Q;  3CC4 P;  2PEK A;  1JJ2 O;  1Q81 Q;  3G0V A;  1YJN P;  1K9M Q;  3CCJ P;  1KD1 Q;  4XFY A;  1RNI A;  3CCU P;  2Z45 A;  5BS1 A;  3OW2 O;  1VQ7 P;  2E1M A;  5HGN A;  3LRY A;  3HYB A;  1QRJ A;  3M1M A;  1E6J P;  4U0E A;  3DPH A;  5F2N A;  1KQS O;  1VQ9 P;  3HZQ A;  1VQN P;  1RO0 A;  1YJ9 P;  3CCQ P;  3G21 A;  3CCL P;  5HGM A;  1M90 Q;  4PH0 A;  1YI2 P;  1YIJ P;  2PEM A;  2L6E A;  1S72 P;  1VQ4 P;  1K30 A;  3G1G A;  2Z46 A;  3CCV P;  1A8O A;  4M0I A;  1Q86 Q;  1EOQ A;  3I55 P;  2CWO A;  3CC7 P;  4QNB A;  3Q20 A;  1VQP P;  4U0A A;  1VQK P;  4XRO A;  2PEI A;  2PEO A;  1VQO P;  1VQ5 P;  1N8R Q;  1Q7Y Q;  3G1I A;  1IUQ A;  5DCK A;  4XFX A;  5F2K A;  2QEX P;  2PY8 A;  4XRQ A;  2Z44 A;  3DS0 A;  3H4E A;  3CCR P;  1M1K Q;  4PH1 A;  5BS2 A;  5HGO A;  1YHQ P;  3I56 P;  1W2B O;  2OAR A;  2P9X A;  3P05 A;  2JYL A;  4WYM A;  2PEQ A;  3H47 A;  2PEJ A;  2XT1 A;  2EG5 A;  2EFJ A;  1A43 A;  2LF4 A;  3CCM P;  3DTJ A;  3G29 A;  4U0F A;  3CPW O;  3E2D A;  1KC8 Q;  4COC A;  1M6E X;  3G28 A;  2BHV A;  4U0B A;  5JPA A;  3G71 P;  4IPY A;  2OTJ P;  4XFZ A;  1RO2 A;  1VQ8 P;  3CME P;  3CXC O;  3DS1 A;  3G26 A;  3B5I A;  1QVG O;  1M6N A;  1AUM A;  2XV6 A;  2M8L A;  1BAJ A;  2EIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...