1A8OA

Hiv capsid c-terminal domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
MDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords HIV CAPSID
publication title Structure of the carboxyl-terminal dimerization domain of the HIV-1 capsid protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 22
structure length 70
sequence length 70
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1a8oA00
3H4EA 2EIAA 4U0AA 5HGMA 2KODA 3MGEA 4XFYA 4COPA 2L6EA 3DS4A 4XROA 3DS0A 5HGLA 3G29A 2XT1A 4QNBA 3G21A 4U0BA 5I4TG 4XFXA 2JYGA 2ONTA 3H47A 3G1IA 2M8LA 4PH0A 1D1DA 3VRLC 4U0EA 3G26A 5HGNA 3DS2A 3G1GA 3DPHA 2M8NA 1EIAA 4M0IA 2BUOA 1EOQA 4WYMA 3G28A 2M8PA 2JYLA 4COCA 3DTJA 1QRJA 4PH1A 4U0CA 4IPYA 1E6JP 3DS5A 3G0VA 3P05A 5DCKA 3DS1A 2XXMA 1A43A 3DS3A 1A8OA 4U0FA 4U0DA 1AUMA 3LRYA 4XRQA 2JO0A 5HGOA 5JPAA 2LF4A 3NTEA 4XFZA 2XV6A 1BAJA
chains in the Genus database with same CATH superfamily
2LTEA 3OW2O 4U0BA 2N98A 2MF4A 2FADA 1D1DA 3CC4P 4PH1A 4R0MA 2VSQA 2GDXA 2KR5A 5JPAA 3NTEA 3G6EP 2MVUA 2KOPA 1VQ6P 1ZMBA 5BS2A 2L6EA 1VQ5P 3EJDA 2GDWA 2FVFA 2CNRA 1KC8Q 2AVAA 2M8LA 4U0EA 4M0IA 2KOOA 4GR2A 2AFDA 2QEXP 1RO2A 1QRJA 5HV8A 3G0VA 4U0FA 4U0DA 3Q20A 2PENA 2JU2A 2GZFA 2XZ1C 2K5XA 2K93A 4GR6A 3VRLC 1DV5A 5BS1A 2KGAA 4WYMA 2GZEA 1T8KA 1E6JP 2KG8A 2L9FA 2XZ0D 2VLQA 2WPTA 2N6YA 2NO8A 1M6EX 1RNIA 2L4BA 5HVCA 2GYKA 2N5IA 3I56P 5HGNA 2OTLP 1VQMP 5F2KA 3G71P 4H2XC 2KWLA 2PEKA 3CCMP 3CMAP 2X2BA 3CPWO 5HGLA 1Q82Q 3H47A 3G1IA 4PH0A 1IUQA 4COCA 1BXIA 2KGEA 2JB0A 1VQ9P 3H4EA 2PEIA 2LKIA 1YIJP 1M74A 3DS2A 1F80D 2K0DX 2KGDA 2L0QA 1K9MQ 3DS5A 1HY8A 4H2WC 4DG9A 1Z6MA 3EJEA 1OR5A 2P9XA 2FVEA 3CCQP 2FQ1A 5HGMA 1KQSO 4BPGA 2CGQA 2VLNA 5I4TG 4IZ6A 1Q86Q 2FACA 2PEOA 2ROQA 4UHPB 4IPYA 5DCKA 2XXMA 2PEQA 3CXCO 4PWVB 1K30A 2K92A 3MGEA 2OTJP 1YHQP 1AF8A 2MD9A 1DNYA 3CCEP 2DNWA 2E1MA 2EHSA 2JYLA 2GZJA 4PXHB 5F2OA 2LIWA 5F2NA 2JO0A 1M90Q 2DGYA 3CCLP 1BAJA 2EIAA 4U0AA 1FR2A 2N50A 1QVFO 1K73Q 2K94A 4HKGA 3B5IA 2VLPA 4H2YC 3HZQA 1VQKP 2M8PA 2JGPA 2ERHA 1VHNA 3CCVP 3DS1A 1JJ2O 2KG9A 5HGOA 1L0IA 2XV6A 2EG5A 2QNWA 2EFJA 2AFEA 3H0DA 3CCSP 1EIAA 1HQBA 1VQ7P 1NQ4A 7CEIA 2PEJA 2JQ4A 2KORA 2KG6A 1S72P 2CQ8A 1A8OA 1L0HA 4F37A 1YJ9P 2GDYA 2EHTA 4BPHA 3DS0A 3I55P 4CA3A 2MR8A 3LMOA 3NY7B 3G4SP 1YJWP 2MVVA 1VKUA 1KLPA 2MR7A 3CE7A 3G26A 3RG2A 2M8NA 2N5HA 4U0CA 3CCUP 2FHSC 2FQ0A 2LMLA 2VLOA 3CCJP 5KP8B 1EMVA 3DS4A 2L22A 4QKOA 3G1GA 2K0XA 2KGCA 2KOQA 2JAZA 3DTJA 2FQ2A 3DS3A 1YJNP 1X3OA 1VQ4P 5CZDB 2FAEA 2LF4A 1ACPA 1GXGA 1VQLP 1YI2P 2KOSA 2FVAA 4COPA 4XROA 2LOLA 1M6NA 1KD1Q 3G21A 1VQPP 3GJNA 3CCRP 1W2BO 1YITP 1EOQA 3G28A 1GXHA 2CWOA 2Z44A 2JU1A 3HYBA 1VQOP 3M1MA 2AF8A 2KW2A 4XFZA 1Q81Q 2MY5A 3EJBA 2XT1A 4XFXA 3E2DA 1IMPA 3GZLA 2M5RA 2K0YA 1UJZA 5KP7B 1AYIA 2QA4P 2PNGA 3B4QA 3P05A 1AUMA 1CEIA 3LRYA 2GZIA 5EJDA 3CMEP 2K2QA 2Z45A 3GZMA 2KODA 4XFYA 1GPJA 1VQNP 2BHVA 3G29A 2JYGA 4NEOA 3CD6P 2LPKA 1ZNVA 3GKLC 2Z46A 3DPHA 2BUOA 3U43A 1N8RQ 3CC7P 1E0HA 1A43A 1VQ8P 1M1KQ 1RO0A 3CC2P 3WBHA 1K8AQ 5KP6B 4QNBA 1Q7YQ 2ONTA 1NJIQ 1UNKA 4MRTC 3RG6C 2PEMA 4BPFA 2JBGA 2N6ZA 2PY8A 2CG5B 1QVGO 4XRQA 5EW5E 2LL8A 2LIUA 1MZ8A 2OARA 1IMQA 2GZGA
chains in the Genus database with same CATH topology
1VQLP 2EIAA 4U0AA 1YI2P 3CPWO 4COPA 4XROA 3OW2O 1M6NA 5HGLA 1KD1Q 4U0BA 1Q82Q 3G21A 1QVFO 1VQPP 3H47A 3G1IA 3CCRP 1K73Q 4PH0A 1IUQA 1D1DA 1W2BO 3B5IA 1YITP 3HZQA 1EOQA 1VQKP 3G28A 2M8PA 4COCA 3CC4P 4PH1A 2CWOA 2Z44A 3HYBA 3DS1A 3M1MA 3CCVP 1VQOP 1JJ2O 5HGOA 5JPAA 3NTEA 4XFZA 1Q81Q 3G6EP 2XV6A 2EG5A 1VQ9P 1VQ6P 3H4EA 1ZMBA 2EFJA 5BS2A 2L6EA 2PEIA 1VQ5P 2XT1A 1YIJP 1KC8Q 4XFXA 3H0DA 1M74A 3E2DA 2M8LA 3CCSP 4U0EA 3DS2A 4M0IA 1EIAA 2QA4P 1VQ7P 4GR2A 2PEJA 1K9MQ 2QEXP 1RO2A 1QRJA 3DS5A 3G0VA 3P05A 1S72P 4U0FA 4U0DA 1A8OA 3Q20A 1AUMA 2PENA 3LRYA 2P9XA 1YJ9P 3CCQP 3CMEP 2Z45A 5HGMA 2KODA 1KQSO 4XFYA 1VQNP 2BHVA 3DS0A 3G29A 3I55P 5I4TG 3G4SP 2JYGA 1YJWP 3CD6P 1Q86Q 4GR6A 3VRLC 3G26A 5BS1A 2Z46A 2M8NA 3DPHA 2BUOA 2PEOA 4WYMA 1N8RQ 4U0CA 4IPYA 1E6JP 3CCUP 5DCKA 3CC7P 2XXMA 1A43A 2PEQA 1VQ8P 1M1KQ 1RO0A 3CXCO 3CCJP 3CC2P 1K30A 3WBHA 1K8AQ 3MGEA 3DS4A 1M6EX 2OTJP 1RNIA 1YHQP 4QNBA 1Q7YQ 2ONTA 1NJIQ 3CCEP 3RG6C 3I56P 2PEMA 2E1MA 5HGNA 3G1GA 2JYLA 1VQMP 3DTJA 5F2OA 2OTLP 5F2KA 5F2NA 3G71P 2PY8A 3DS3A 1YJNP 1QVGO 4XRQA 1VQ4P 2JO0A 1M90Q 2DGYA 2OARA 2LF4A 2PEKA 3CCMP 3CMAP 3CCLP 1BAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H4E A;  2EIA A;  4U0A A;  5HGM A;  2KOD A;  3MGE A;  4XFY A;  4COP A;  2L6E A;  3DS4 A;  4XRO A;  3DS0 A;  5HGL A;  3G29 A;  2XT1 A;  4QNB A;  3G21 A;  4U0B A;  5I4T G;  4XFX A;  2JYG A;  2ONT A;  3H47 A;  3G1I A;  2M8L A;  4PH0 A;  1D1D A;  3VRL C;  4U0E A;  3G26 A;  5HGN A;  3DS2 A;  3G1G A;  3DPH A;  2M8N A;  1EIA A;  4M0I A;  2BUO A;  1EOQ A;  4WYM A;  3G28 A;  2M8P A;  2JYL A;  4COC A;  3DTJ A;  1QRJ A;  4PH1 A;  4U0C A;  4IPY A;  1E6J P;  3DS5 A;  3G0V A;  3P05 A;  5DCK A;  3DS1 A;  2XXM A;  1A43 A;  3DS3 A;  1A8O A;  4U0F A;  4U0D A;  1AUM A;  3LRY A;  4XRQ A;  2JO0 A;  5HGO A;  5JPA A;  2LF4 A;  3NTE A;  4XFZ A;  2XV6 A;  1BAJ A; 
#chains in the Genus database with same CATH topology
 2LTE A;  3OW2 O;  4U0B A;  2N98 A;  2MF4 A;  2FAD A;  1D1D A;  3CC4 P;  4PH1 A;  4R0M A;  2VSQ A;  2GDX A;  2KR5 A;  5JPA A;  3NTE A;  3G6E P;  2MVU A;  2KOP A;  1VQ6 P;  1ZMB A;  5BS2 A;  2L6E A;  1VQ5 P;  3EJD A;  2GDW A;  2FVF A;  2CNR A;  1KC8 Q;  2AVA A;  2M8L A;  4U0E A;  4M0I A;  2KOO A;  4GR2 A;  2AFD A;  2QEX P;  1RO2 A;  1QRJ A;  5HV8 A;  3G0V A;  4U0F A;  4U0D A;  3Q20 A;  2PEN A;  2JU2 A;  2GZF A;  2XZ1 C;  2K5X A;  2K93 A;  4GR6 A;  3VRL C;  1DV5 A;  5BS1 A;  2KGA A;  4WYM A;  2GZE A;  1T8K A;  1E6J P;  2KG8 A;  2L9F A;  2XZ0 D;  2VLQ A;  2WPT A;  2N6Y A;  2NO8 A;  1M6E X;  1RNI A;  2L4B A;  5HVC A;  2GYK A;  2N5I A;  3I56 P;  5HGN A;  2OTL P;  1VQM P;  5F2K A;  3G71 P;  4H2X C;  2KWL A;  2PEK A;  3CCM P;  3CMA P;  2X2B A;  3CPW O;  5HGL A;  1Q82 Q;  3H47 A;  3G1I A;  4PH0 A;  1IUQ A;  4COC A;  1BXI A;  2KGE A;  2JB0 A;  1VQ9 P;  3H4E A;  2PEI A;  2LKI A;  1YIJ P;  1M74 A;  3DS2 A;  1F80 D;  2K0D X;  2KGD A;  2L0Q A;  1K9M Q;  3DS5 A;  1HY8 A;  4H2W C;  4DG9 A;  1Z6M A;  3EJE A;  1OR5 A;  2P9X A;  2FVE A;  3CCQ P;  2FQ1 A;  5HGM A;  1KQS O;  4BPG A;  2CGQ A;  2VLN A;  5I4T G;  4IZ6 A;  1Q86 Q;  2FAC A;  2PEO A;  2ROQ A;  4UHP B;  4IPY A;  5DCK A;  2XXM A;  2PEQ A;  3CXC O;  4PWV B;  1K30 A;  2K92 A;  3MGE A;  2OTJ P;  1YHQ P;  1AF8 A;  2MD9 A;  1DNY A;  3CCE P;  2DNW A;  2E1M A;  2EHS A;  2JYL A;  2GZJ A;  4PXH B;  5F2O A;  2LIW A;  5F2N A;  2JO0 A;  1M90 Q;  2DGY A;  3CCL P;  1BAJ A;  2EIA A;  4U0A A;  1FR2 A;  2N50 A;  1QVF O;  1K73 Q;  2K94 A;  4HKG A;  3B5I A;  2VLP A;  4H2Y C;  3HZQ A;  1VQK P;  2M8P A;  2JGP A;  2ERH A;  1VHN A;  3CCV P;  3DS1 A;  1JJ2 O;  2KG9 A;  5HGO A;  1L0I A;  2XV6 A;  2EG5 A;  2QNW A;  2EFJ A;  2AFE A;  3H0D A;  3CCS P;  1EIA A;  1HQB A;  1VQ7 P;  1NQ4 A;  7CEI A;  2PEJ A;  2JQ4 A;  2KOR A;  2KG6 A;  1S72 P;  2CQ8 A;  1A8O A;  1L0H A;  4F37 A;  1YJ9 P;  2GDY A;  2EHT A;  4BPH A;  3DS0 A;  3I55 P;  4CA3 A;  2MR8 A;  3LMO A;  3NY7 B;  3G4S P;  1YJW P;  2MVV A;  1VKU A;  1KLP A;  2MR7 A;  3CE7 A;  3G26 A;  3RG2 A;  2M8N A;  2N5H A;  4U0C A;  3CCU P;  2FHS C;  2FQ0 A;  2LML A;  2VLO A;  3CCJ P;  5KP8 B;  1EMV A;  3DS4 A;  2L22 A;  4QKO A;  3G1G A;  2K0X A;  2KGC A;  2KOQ A;  2JAZ A;  3DTJ A;  2FQ2 A;  3DS3 A;  1YJN P;  1X3O A;  1VQ4 P;  5CZD B;  2FAE A;  2LF4 A;  1ACP A;  1GXG A;  1VQL P;  1YI2 P;  2KOS A;  2FVA A;  4COP A;  4XRO A;  2LOL A;  1M6N A;  1KD1 Q;  3G21 A;  1VQP P;  3GJN A;  3CCR P;  1W2B O;  1YIT P;  1EOQ A;  3G28 A;  1GXH A;  2CWO A;  2Z44 A;  2JU1 A;  3HYB A;  1VQO P;  3M1M A;  2AF8 A;  2KW2 A;  4XFZ A;  1Q81 Q;  2MY5 A;  3EJB A;  2XT1 A;  4XFX A;  3E2D A;  1IMP A;  3GZL A;  2M5R A;  2K0Y A;  1UJZ A;  5KP7 B;  1AYI A;  2QA4 P;  2PNG A;  3B4Q A;  3P05 A;  1AUM A;  1CEI A;  3LRY A;  2GZI A;  5EJD A;  3CME P;  2K2Q A;  2Z45 A;  3GZM A;  2KOD A;  4XFY A;  1GPJ A;  1VQN P;  2BHV A;  3G29 A;  2JYG A;  4NEO A;  3CD6 P;  2LPK A;  1ZNV A;  3GKL C;  2Z46 A;  3DPH A;  2BUO A;  3U43 A;  1N8R Q;  3CC7 P;  1E0H A;  1A43 A;  1VQ8 P;  1M1K Q;  1RO0 A;  3CC2 P;  3WBH A;  1K8A Q;  5KP6 B;  4QNB A;  1Q7Y Q;  2ONT A;  1NJI Q;  1UNK A;  4MRT C;  3RG6 C;  2PEM A;  4BPF A;  2JBG A;  2N6Z A;  2PY8 A;  2CG5 B;  1QVG O;  4XRQ A;  5EW5 E;  2LL8 A;  2LIU A;  1MZ8 A;  2OAR A;  1IMQ A;  2GZG A; 
#chains in the Genus database with same CATH homology
 1VQL P;  2EIA A;  4U0A A;  1YI2 P;  3CPW O;  4COP A;  4XRO A;  3OW2 O;  1M6N A;  5HGL A;  1KD1 Q;  4U0B A;  1Q82 Q;  3G21 A;  1QVF O;  1VQP P;  3H47 A;  3G1I A;  3CCR P;  1K73 Q;  4PH0 A;  1IUQ A;  1D1D A;  1W2B O;  3B5I A;  1YIT P;  3HZQ A;  1EOQ A;  1VQK P;  3G28 A;  2M8P A;  4COC A;  3CC4 P;  4PH1 A;  2CWO A;  2Z44 A;  3HYB A;  3DS1 A;  3M1M A;  3CCV P;  1VQO P;  1JJ2 O;  5HGO A;  5JPA A;  3NTE A;  4XFZ A;  1Q81 Q;  3G6E P;  2XV6 A;  2EG5 A;  1VQ9 P;  1VQ6 P;  3H4E A;  1ZMB A;  2EFJ A;  5BS2 A;  2L6E A;  2PEI A;  1VQ5 P;  2XT1 A;  1YIJ P;  1KC8 Q;  4XFX A;  3H0D A;  1M74 A;  3E2D A;  2M8L A;  3CCS P;  4U0E A;  3DS2 A;  4M0I A;  1EIA A;  2QA4 P;  1VQ7 P;  4GR2 A;  2PEJ A;  1K9M Q;  2QEX P;  1RO2 A;  1QRJ A;  3DS5 A;  3G0V A;  3P05 A;  1S72 P;  4U0F A;  4U0D A;  1A8O A;  3Q20 A;  1AUM A;  2PEN A;  3LRY A;  2P9X A;  1YJ9 P;  3CCQ P;  3CME P;  2Z45 A;  5HGM A;  2KOD A;  1KQS O;  4XFY A;  1VQN P;  2BHV A;  3DS0 A;  3G29 A;  3I55 P;  5I4T G;  3G4S P;  2JYG A;  1YJW P;  3CD6 P;  1Q86 Q;  4GR6 A;  3VRL C;  3G26 A;  5BS1 A;  2Z46 A;  2M8N A;  3DPH A;  2BUO A;  2PEO A;  4WYM A;  1N8R Q;  4U0C A;  4IPY A;  1E6J P;  3CCU P;  5DCK A;  3CC7 P;  2XXM A;  1A43 A;  2PEQ A;  1VQ8 P;  1M1K Q;  1RO0 A;  3CXC O;  3CCJ P;  3CC2 P;  1K30 A;  3WBH A;  1K8A Q;  3MGE A;  3DS4 A;  1M6E X;  2OTJ P;  1RNI A;  1YHQ P;  4QNB A;  1Q7Y Q;  2ONT A;  1NJI Q;  3CCE P;  3RG6 C;  3I56 P;  2PEM A;  2E1M A;  5HGN A;  3G1G A;  2JYL A;  1VQM P;  3DTJ A;  5F2O A;  2OTL P;  5F2K A;  5F2N A;  3G71 P;  2PY8 A;  3DS3 A;  1YJN P;  1QVG O;  4XRQ A;  1VQ4 P;  2JO0 A;  1M90 Q;  2DGY A;  2OAR A;  2LF4 A;  2PEK A;  3CCM P;  3CMA P;  3CCL P;  1BAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...