1A8OA

Hiv capsid c-terminal domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
MDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV CAPSID
publication title Structure of the carboxyl-terminal dimerization domain of the HIV-1 capsid protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 22
structure length 70
sequence length 70
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1a8oA00
2XV6A 2JYLA 1BAJA 3P05A 4U0BA 2M8NA 3NTEA 3LRYA 5HGLA 1QRJA 5I4TG 4COCA 4U0EA 4COPA 4M0IA 3DS1A 3DS4A 2JO0A 3DS5A 1A8OA 4U0CA 4XFYA 4PH1A 2XXMA 4PH0A 4U0AA 5HGOA 4XROA 2M8LA 1EIAA 3DPHA 2JYGA 2ONTA 2XT1A 3H47A 3G0VA 5DCKA 1E6JP 4XRQA 3G26A 3MGEA 3DTJA 2LF4A 3DS2A 2BUOA 3G1IA 4QNBA 3DS0A 4XFZA 3G21A 4WYMA 4U0DA 5HGNA 2M8PA 3VRLC 1A43A 3G28A 3H4EA 3G1GA 2KODA 2L6EA 2EIAA 3DS3A 3G29A 5JPAA 1D1DA 5HGMA 1EOQA 4IPYA 4U0FA 1AUMA 4XFXA
chains in the Genus database with same CATH superfamily
2PEQA 5CZDB 2M8NA 1HY8A 2ERHA 1VQ8P 4COPA 2XZ1C 3GJNA 3CXCO 3CMAP 5HGOA 4BPHA 2L9FA 5DCKA 4XRQA 1VQKP 4XFZA 2CNRA 2Z46A 1QVGO 2MF4A 3CCLP 3CC2P 1VQPP 1AUMA 2K0DX 1OR5A 4M0IA 3GKLC 4XFYA 2AF8A 2KG9A 5HV8A 2VLQA 4R0MA 3G0VA 2N50A 2FACA 2L4BA 3GZLA 2M5RA 7CEIA 3G21A 4H2WC 4IZ6A 3B5IA 3H4EA 3CC7P 2GZFA 1YITP 2EIAA 2K2QA 2FHSC 2NO8A 4PWVB 2ROQA 2MVVA 2XZ0D 1BAJA 4U0BA 2QA4P 5BS2A 1K8AQ 2KG6A 4XROA 2GDXA 1VQ9P 1RNIA 2X2BA 2GYKA 3NY7B 3VRLC 1VQNP 2AFEA 5BS1A 2EFJA 1JJ2O 2FQ1A 2LMLA 5KP7B 1YJWP 4COCA 1Q82Q 1QVFO 4U0CA 3CD6P 1FR2A 2AFDA 2LIWA 1VKUA 2JYGA 2N6YA 5F2NA 1T8KA 2LF4A 1MZ8A 2LPKA 1VQMP 2KWLA 2VLNA 1VQLP 4GR2A 5F2OA 1EOQA 4IPYA 5EW5E 1Z6MA 2PY8A 2VLPA 1YI2P 3CPWO 3DS0A 2N5IA 5HGNA 1VQ6P 2K93A 4U0FA 2KOQA 1YJ9P 2N98A 2OTJP 1M90Q 3RG6C 3CCMP 3G26A 3G71P 2Z45A 3I56P 4WYMA 1Q81Q 3CCRP 2PEIA 5HVCA 2KODA 2L6EA 3DS3A 1D1DA 1GPJA 1UNKA 4BPGA 1Q7YQ 5KP8B 1Q86Q 2CGQA 3CE7A 1KLPA 2Z44A 2MY5A 3GZMA 1F80D 1AF8A 2KOOA 1RO0A 4DG9A 3CCJP 2QNWA 2VSQA 2KR5A 2FVFA 4H2XC 2XXMA 3H47A 2QEXP 3WBHA 2KG8A 2FQ2A 2KORA 2KOPA 1GXHA 3G4SP 5HGMA 1VHNA 1M1KQ 4PXHB 2JU1A 1ZNVA 2LOLA 3OW2O 2LKIA 1KD1Q 5F2KA 3DPHA 3CCEP 1N8RQ 2MR7A 3U43A 2BHVA 1VQ5P 1VQ4P 2MVUA 4U0EA 2JBGA 2KW2A 2CQ8A 4U0AA 2OTLP 2M8LA 1KC8Q 4UHPB 2KGEA 5EJDA 2GZJA 1L0HA 2P9XA 2FVEA 2EG5A 2K94A 3G29A 2GZEA 2L22A 2JYLA 3RG2A 1ACPA 1L0IA 1M74A 2PEOA 2FQ0A 3DS5A 1A8OA 1IMPA 4MRTC 2KOSA 2XT1A 1YHQP 1E6JP 2JB0A 3MGEA 1M6EX 2BUOA 2N6ZA 2M8PA 1ZMBA 2WPTA 2KGDA 3Q20A 1QRJA 5I4TG 2MR8A 2GZGA 2K0XA 1E0HA 2DNWA 3CCVP 1DV5A 2K92A 4CA3A 3HZQA 1NQ4A 2FAEA 2VLOA 2XV6A 4HKGA 3LRYA 1YIJP 2LIUA 1NJIQ 2K0YA 3DS4A 1CEIA 2MD9A 4GR6A 3CCUP 1EMVA 4PH1A 1RO2A 1IUQA 1BXIA 1KQSO 5KP6B 2GDYA 3G1IA 2CWOA 1K30A 2FVAA 1K9MQ 1VQ7P 4H2YC 4QKOA 1HQBA 1S72P 3P05A 1UJZA 1X3OA 4BPFA 1EIAA 2AVAA 2JQ4A 3HYBA 2GZIA 3G6EP 3CCQP 3DTJA 2LTEA 1VQOP 3DS2A 2OARA 4NEOA 2L0QA 4QNBA 4U0DA 1A43A 4F37A 3I55P 2CG5B 2E1MA 2JU2A 3NTEA 3B4QA 2PEKA 4PH0A 2ONTA 2K5XA 3CMEP 2PEMA 2PNGA 1K73Q 1M6NA 3EJDA 1AYIA 1GXGA 3G1GA 3LMOA 3M1MA 5JPAA 2JGPA 3DS1A 4XFXA 2KGAA 2EHSA 5HGLA 1W2BO 3CC4P 1IMQA 2DGYA 2JAZA 2FADA 2JO0A 3H0DA 2N5HA 3EJEA 2KGCA 2LL8A 3EJBA 2PEJA 3E2DA 2PENA 2EHTA 3CCSP 3G28A 1DNYA 1YJNP 2GDWA
chains in the Genus database with same CATH topology
2XV6A 2PEQA 2M8NA 3OW2O 3LRYA 1YIJP 1NJIQ 1VQ8P 4COPA 2PY8A 3DS4A 4GR6A 3CCUP 1KD1Q 5F2KA 3CXCO 4PH1A 5HGOA 3CMAP 1RO2A 3DPHA 3CCEP 1IUQA 5DCKA 4XRQA 1YI2P 1VQKP 1KQSO 3CPWO 3G1IA 4XFZA 1N8RQ 2CWOA 3DS0A 1K30A 2Z46A 1QVGO 1K9MQ 5HGNA 3CCLP 3CC2P 1VQ6P 1VQ7P 1VQPP 2BHVA 1VQ5P 1VQ4P 4U0FA 1AUMA 1S72P 3P05A 4U0EA 4M0IA 1YJ9P 4XFYA 4U0AA 2OTLP 1M90Q 2M8LA 1EIAA 2OTJP 3RG6C 1KC8Q 3G0VA 3HYBA 3G6EP 3CCMP 3G26A 3CCQP 3DTJA 1VQOP 3DS2A 2OARA 4QNBA 3G71P 2Z45A 2P9XA 3G21A 3I56P 4WYMA 1Q81Q 4U0DA 1A43A 2EG5A 3B5IA 3H4EA 3CCRP 3CC7P 2PEIA 2KODA 1YITP 2L6EA 2EIAA 3DS3A 3G29A 3I55P 1D1DA 2E1MA 2JYLA 1BAJA 4U0BA 3NTEA 2QA4P 1Q7YQ 1M74A 5BS2A 2PEOA 2PEKA 1K8AQ 3DS5A 1A8OA 1Q86Q 4PH0A 4XROA 2XT1A 2ONTA 1YHQP 3CMEP 1E6JP 1VQ9P 2Z44A 2PEMA 3MGEA 1RNIA 1M6EX 2BUOA 1K73Q 1M6NA 2M8PA 3VRLC 1VQNP 1RO0A 1ZMBA 3G1GA 3M1MA 5JPAA 5BS1A 2EFJA 1JJ2O 3DS1A 3CCJP 4XFXA 3Q20A 5HGLA 1YJWP 1QRJA 5I4TG 1W2BO 3CC4P 4COCA 1Q82Q 1QVFO 2DGYA 2JO0A 4U0CA 3CD6P 2XXMA 3H0DA 3H47A 2JYGA 2QEXP 5F2NA 3WBHA 2LF4A 3CCVP 2PEJA 3E2DA 2PENA 1VQMP 3CCSP 3HZQA 3G4SP 3G28A 1VQLP 4GR2A 1YJNP 5F2OA 1EOQA 4IPYA 5HGMA 1M1KQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XV6 A;  2JYL A;  1BAJ A;  3P05 A;  4U0B A;  2M8N A;  3NTE A;  3LRY A;  5HGL A;  1QRJ A;  5I4T G;  4COC A;  4U0E A;  4COP A;  4M0I A;  3DS1 A;  3DS4 A;  2JO0 A;  3DS5 A;  1A8O A;  4U0C A;  4XFY A;  4PH1 A;  2XXM A;  4PH0 A;  4U0A A;  5HGO A;  4XRO A;  2M8L A;  1EIA A;  3DPH A;  2JYG A;  2ONT A;  2XT1 A;  3H47 A;  3G0V A;  5DCK A;  1E6J P;  4XRQ A;  3G26 A;  3MGE A;  3DTJ A;  2LF4 A;  3DS2 A;  2BUO A;  3G1I A;  4QNB A;  3DS0 A;  4XFZ A;  3G21 A;  4WYM A;  4U0D A;  5HGN A;  2M8P A;  3VRL C;  1A43 A;  3G28 A;  3H4E A;  3G1G A;  2KOD A;  2L6E A;  2EIA A;  3DS3 A;  3G29 A;  5JPA A;  1D1D A;  5HGM A;  1EOQ A;  4IPY A;  4U0F A;  1AUM A;  4XFX A; 
#chains in the Genus database with same CATH topology
 2PEQ A;  5CZD B;  2M8N A;  1HY8 A;  2ERH A;  1VQ8 P;  4COP A;  2XZ1 C;  3GJN A;  3CXC O;  3CMA P;  5HGO A;  4BPH A;  2L9F A;  5DCK A;  4XRQ A;  1VQK P;  4XFZ A;  2CNR A;  2Z46 A;  1QVG O;  2MF4 A;  3CCL P;  3CC2 P;  1VQP P;  1AUM A;  2K0D X;  1OR5 A;  4M0I A;  3GKL C;  4XFY A;  2AF8 A;  2KG9 A;  5HV8 A;  2VLQ A;  4R0M A;  3G0V A;  2N50 A;  2FAC A;  2L4B A;  3GZL A;  2M5R A;  7CEI A;  3G21 A;  4H2W C;  4IZ6 A;  3B5I A;  3H4E A;  3CC7 P;  2GZF A;  1YIT P;  2EIA A;  2K2Q A;  2FHS C;  2NO8 A;  4PWV B;  2ROQ A;  2MVV A;  2XZ0 D;  1BAJ A;  4U0B A;  2QA4 P;  5BS2 A;  1K8A Q;  2KG6 A;  4XRO A;  2GDX A;  1VQ9 P;  1RNI A;  2X2B A;  2GYK A;  3NY7 B;  3VRL C;  1VQN P;  2AFE A;  5BS1 A;  2EFJ A;  1JJ2 O;  2FQ1 A;  2LML A;  5KP7 B;  1YJW P;  4COC A;  1Q82 Q;  1QVF O;  4U0C A;  3CD6 P;  1FR2 A;  2AFD A;  2LIW A;  1VKU A;  2JYG A;  2N6Y A;  5F2N A;  1T8K A;  2LF4 A;  1MZ8 A;  2LPK A;  1VQM P;  2KWL A;  2VLN A;  1VQL P;  4GR2 A;  5F2O A;  1EOQ A;  4IPY A;  5EW5 E;  1Z6M A;  2PY8 A;  2VLP A;  1YI2 P;  3CPW O;  3DS0 A;  2N5I A;  5HGN A;  1VQ6 P;  2K93 A;  4U0F A;  2KOQ A;  1YJ9 P;  2N98 A;  2OTJ P;  1M90 Q;  3RG6 C;  3CCM P;  3G26 A;  3G71 P;  2Z45 A;  3I56 P;  4WYM A;  1Q81 Q;  3CCR P;  2PEI A;  5HVC A;  2KOD A;  2L6E A;  3DS3 A;  1D1D A;  1GPJ A;  1UNK A;  4BPG A;  1Q7Y Q;  5KP8 B;  1Q86 Q;  2CGQ A;  3CE7 A;  1KLP A;  2Z44 A;  2MY5 A;  3GZM A;  1F80 D;  1AF8 A;  2KOO A;  1RO0 A;  4DG9 A;  3CCJ P;  2QNW A;  2VSQ A;  2KR5 A;  2FVF A;  4H2X C;  2XXM A;  3H47 A;  2QEX P;  3WBH A;  2KG8 A;  2FQ2 A;  2KOR A;  2KOP A;  1GXH A;  3G4S P;  5HGM A;  1VHN A;  1M1K Q;  4PXH B;  2JU1 A;  1ZNV A;  2LOL A;  3OW2 O;  2LKI A;  1KD1 Q;  5F2K A;  3DPH A;  3CCE P;  1N8R Q;  2MR7 A;  3U43 A;  2BHV A;  1VQ5 P;  1VQ4 P;  2MVU A;  4U0E A;  2JBG A;  2KW2 A;  2CQ8 A;  4U0A A;  2OTL P;  2M8L A;  1KC8 Q;  4UHP B;  2KGE A;  5EJD A;  2GZJ A;  1L0H A;  2P9X A;  2FVE A;  2EG5 A;  2K94 A;  3G29 A;  2GZE A;  2L22 A;  2JYL A;  3RG2 A;  1ACP A;  1L0I A;  1M74 A;  2PEO A;  2FQ0 A;  3DS5 A;  1A8O A;  1IMP A;  4MRT C;  2KOS A;  2XT1 A;  1YHQ P;  1E6J P;  2JB0 A;  3MGE A;  1M6E X;  2BUO A;  2N6Z A;  2M8P A;  1ZMB A;  2WPT A;  2KGD A;  3Q20 A;  1QRJ A;  5I4T G;  2MR8 A;  2GZG A;  2K0X A;  1E0H A;  2DNW A;  3CCV P;  1DV5 A;  2K92 A;  4CA3 A;  3HZQ A;  1NQ4 A;  2FAE A;  2VLO A;  2XV6 A;  4HKG A;  3LRY A;  1YIJ P;  2LIU A;  1NJI Q;  2K0Y A;  3DS4 A;  1CEI A;  2MD9 A;  4GR6 A;  3CCU P;  1EMV A;  4PH1 A;  1RO2 A;  1IUQ A;  1BXI A;  1KQS O;  5KP6 B;  2GDY A;  3G1I A;  2CWO A;  1K30 A;  2FVA A;  1K9M Q;  1VQ7 P;  4H2Y C;  4QKO A;  1HQB A;  1S72 P;  3P05 A;  1UJZ A;  1X3O A;  4BPF A;  1EIA A;  2AVA A;  2JQ4 A;  3HYB A;  2GZI A;  3G6E P;  3CCQ P;  3DTJ A;  2LTE A;  1VQO P;  3DS2 A;  2OAR A;  4NEO A;  2L0Q A;  4QNB A;  4U0D A;  1A43 A;  4F37 A;  3I55 P;  2CG5 B;  2E1M A;  2JU2 A;  3NTE A;  3B4Q A;  2PEK A;  4PH0 A;  2ONT A;  2K5X A;  3CME P;  2PEM A;  2PNG A;  1K73 Q;  1M6N A;  3EJD A;  1AYI A;  1GXG A;  3G1G A;  3LMO A;  3M1M A;  5JPA A;  2JGP A;  3DS1 A;  4XFX A;  2KGA A;  2EHS A;  5HGL A;  1W2B O;  3CC4 P;  1IMQ A;  2DGY A;  2JAZ A;  2FAD A;  2JO0 A;  3H0D A;  2N5H A;  3EJE A;  2KGC A;  2LL8 A;  3EJB A;  2PEJ A;  3E2D A;  2PEN A;  2EHT A;  3CCS P;  3G28 A;  1DNY A;  1YJN P;  2GDW A; 
#chains in the Genus database with same CATH homology
 2XV6 A;  2PEQ A;  2M8N A;  3OW2 O;  3LRY A;  1YIJ P;  1NJI Q;  1VQ8 P;  4COP A;  2PY8 A;  3DS4 A;  4GR6 A;  3CCU P;  1KD1 Q;  5F2K A;  3CXC O;  4PH1 A;  5HGO A;  3CMA P;  1RO2 A;  3DPH A;  3CCE P;  1IUQ A;  5DCK A;  4XRQ A;  1YI2 P;  1VQK P;  1KQS O;  3CPW O;  3G1I A;  4XFZ A;  1N8R Q;  2CWO A;  3DS0 A;  1K30 A;  2Z46 A;  1QVG O;  1K9M Q;  5HGN A;  3CCL P;  3CC2 P;  1VQ6 P;  1VQ7 P;  1VQP P;  2BHV A;  1VQ5 P;  1VQ4 P;  4U0F A;  1AUM A;  1S72 P;  3P05 A;  4U0E A;  4M0I A;  1YJ9 P;  4XFY A;  4U0A A;  2OTL P;  1M90 Q;  2M8L A;  1EIA A;  2OTJ P;  3RG6 C;  1KC8 Q;  3G0V A;  3HYB A;  3G6E P;  3CCM P;  3G26 A;  3CCQ P;  3DTJ A;  1VQO P;  3DS2 A;  2OAR A;  4QNB A;  3G71 P;  2Z45 A;  2P9X A;  3G21 A;  3I56 P;  4WYM A;  1Q81 Q;  4U0D A;  1A43 A;  2EG5 A;  3B5I A;  3H4E A;  3CCR P;  3CC7 P;  2PEI A;  2KOD A;  1YIT P;  2L6E A;  2EIA A;  3DS3 A;  3G29 A;  3I55 P;  1D1D A;  2E1M A;  2JYL A;  1BAJ A;  4U0B A;  3NTE A;  2QA4 P;  1Q7Y Q;  1M74 A;  5BS2 A;  2PEO A;  2PEK A;  1K8A Q;  3DS5 A;  1A8O A;  1Q86 Q;  4PH0 A;  4XRO A;  2XT1 A;  2ONT A;  1YHQ P;  3CME P;  1E6J P;  1VQ9 P;  2Z44 A;  2PEM A;  3MGE A;  1RNI A;  1M6E X;  2BUO A;  1K73 Q;  1M6N A;  2M8P A;  3VRL C;  1VQN P;  1RO0 A;  1ZMB A;  3G1G A;  3M1M A;  5JPA A;  5BS1 A;  2EFJ A;  1JJ2 O;  3DS1 A;  3CCJ P;  4XFX A;  3Q20 A;  5HGL A;  1YJW P;  1QRJ A;  5I4T G;  1W2B O;  3CC4 P;  4COC A;  1Q82 Q;  1QVF O;  2DGY A;  2JO0 A;  4U0C A;  3CD6 P;  2XXM A;  3H0D A;  3H47 A;  2JYG A;  2QEX P;  5F2N A;  3WBH A;  2LF4 A;  3CCV P;  2PEJ A;  3E2D A;  2PEN A;  1VQM P;  3CCS P;  3HZQ A;  3G4S P;  3G28 A;  1VQL P;  4GR2 A;  1YJN P;  5F2O A;  1EOQ A;  4IPY A;  5HGM A;  1M1K Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...