2CGQA

A putative acyl carrier protein(rv0033) from mycobacterium tuberculosis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
AMEEAINATIQRILRTDRGITANQVLVDDLGFDSLKLFQLITELEDEFDIAISFRDAQNIKTVGDVYTSVAVWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a Putative Acyl Carrier Protein (Rv0033) from Mycobacterium Tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein transport
molecule keywords ACYL CARRIER PROTEIN ACPA
total genus 25
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2cgqA00
2K0XA 2MY5A 2MVUA 2KGEA 2LKIA 2MR7A 2K93A 5KP8B 2KGDA 2KORA 2MF4A 2GDXA 4H2XC 2KOOA 2FVEA 2LPKA 4NEOA 1HY8A 2KR5A 2N50A 2N98A 2KOSA 2XZ0D 2K92A 2K0YA 2KOQA 4DG9A 3LMOA 4BPHA 2KOPA 5KP6B 2K2QA 3EJEA 4BPGA 3CE7A 3EJBA 2L4BA 2EHSA 3RG2A 2LL8A 1NQ4A 2ROQA 4H2WC 1DNYA 5KP7B 2KGCA 2PNGA 4H2YC 2JQ4A 2L0QA 2MR8A 2L9FA 2FVAA 1F80D 2GDWA 1VKUA 2MVVA 4BPFA 1DV5A 2N5HA 2FVFA 2CGQA 2QNWA 5EJDA 2KGAA 2AF8A 3GZLA 2FAEA 2FQ1A 1KLPA 2LMLA 4HKGA 1L0IA 2N5IA 2CG5B 2FHSC 2AFDA 4CA3A 2CQ8A 3NY7B 2LOLA 4PXHB 1OR5A 1ACPA 2FQ2A 5CZDB 2X2BA 2LIUA 5HVCA 2KG6A 2DNWA 2XZ1C 2FQ0A 2K94A 2LIWA 2EHTA 3EJDA 5HV8A 2AVAA 2FACA 2CNRA 2VSQA 4IZ6A 3GZMA 4PWVB 2JU2A 2KW2A 2M5RA 2LTEA 1X3OA 2MD9A 1T8KA 2AFEA 2KG8A 4R0MA 2FADA 2JU1A 2KWLA 1L0HA 1AF8A 2N6YA 2GDYA 1HQBA 4MRTC 2L22A 2JGPA 2KG9A 2N6ZA
chains in the Genus database with same CATH superfamily
1VQ8P 3CCLP 4WYMA 2K0XA 2MY5A 5F2NA 2MVUA 2K93A 1A8OA 2EG5A 2KOOA 2LPKA 1M74A 2NO8A 2KR5A 1YITP 3CCMP 2PEIA 3CD6P 2KOPA 2M8LA 2OTLP 3VRLC 4BPGA 3CC4P 2OTJP 3G29A 3GKLC 2LL8A 1VQ9P 4PH0A 1DNYA 2E1MA 2L0QA 2GYKA 1ZNVA 1VHNA 2MVVA 1Q82Q 2FVFA 2WPTA 3CCQP 2QA4P 2KGAA 2AF8A 3GZLA 1S72P 2DGYA 5DCKA 1K8AQ 3CCRP 1KLPA 2LMLA 5BS1A 1RNIA 1MZ8A 1VQNP 1L0IA 2PEMA 2ERHA 4IPYA 3HYBA 2PENA 3NY7B 4PXHB 1KD1Q 2FQ2A 2PEOA 3DPHA 2VLQA 3DS1A 2FQ0A 2LIWA 1VQOP 3EJDA 5HGMA 2AVAA 2FACA 1Z6MA 1ZMBA 3CCUP 3U43A 1X3OA 3G0VA 3LRYA 2AFEA 1VQPP 3GJNA 3H4EA 2N6YA 1HQBA 3CCVP 2KG9A 2N6ZA 3DS3A 2GZFA 1KQSO 4XRQA 2XV6A 5I4TG 5KP8B 2P9XA 3P05A 4F37A 3CC7P 4UHPB 1QRJA 2KOSA 1N8RQ 1QVGO 2KOQA 1M90Q 2PEKA 3LMOA 4BPHA 2M8NA 2K2QA 2XXMA 3EJEA 1YJNP 5BS2A 1BXIA 2L4BA 1YHQP 4QNBA 3DS2A 2L6EA 1NQ4A 2ROQA 4H2WC 1JJ2O 2KGCA 2MR8A 2JBGA 1F80D 1E0HA 2GDWA 1VKUA 1DV5A 3RG6C 2N5HA 1D1DA 1VQ4P 1VQLP 2FAEA 3G1IA 3M1MA 2VLNA 1IUQA 3I56P 2FHSC 1RO2A 2AFDA 3MGEA 4U0BA 3CCJP 2LOLA 3G4SP 2JB0A 1NJIQ 4PH1A 2OARA 2DNWA 2XZ1C 4M0IA 3CPWO 3G71P 2K94A 1BAJA 5HV8A 2JYLA 2VSQA 4IZ6A 4U0CA 3GZMA 4PWVB 3DS4A 1GPJA 2LTEA 2VLOA 1T8KA 4R0MA 5HGOA 2Z44A 4MRTC 2L22A 2JGPA 3G6EP 2BUOA 1IMQA 2LKIA 2MR7A 2KGDA 2GDXA 4H2XC 2FVEA 4NEOA 1YI2P 4U0EA 2N50A 2N98A 2XZ0D 2PY8A 2K92A 2K0YA 4DG9A 2GZIA 5KP6B 1VQ6P 2EHSA 1GXHA 3RG2A 1E6JP 3WBHA 3CXCO 1M6EX 2PEJA 7CEIA 2JQ4A 2L9FA 2VLPA 3OW2O 4BPFA 1A43A 2K5XA 2QNWA 3H47A 2PEQA 4HKGA 1EMVA 3Q20A 2N5IA 4CA3A 3G26A 1ACPA 5CZDB 4GR6A 3CMEP 3G21A 2X2BA 5EW5E 2GZEA 1VQKP 2EIAA 2LIUA 1K30A 2KODA 1Q86Q 2EHTA 2QEXP 4COCA 1M6NA 4GR2A 4XFYA 2JU2A 3H0DA 2M5RA 5F2KA 2JO0A 3HZQA 2JAZA 2MD9A 1K73Q 3DS0A 2KG8A 3CCEP 2FADA 4QKOA 2KWLA 1L0HA 2GDYA 1AUMA 2Z45A 3CMAP 4U0DA 2KGEA 2KORA 2K0DX 2MF4A 1HY8A 1FR2A 3G1GA 2M8PA 5HGLA 2CWOA 1UNKA 5JPAA 3DTJA 3CC2P 4XFXA 3CE7A 3EJBA 1VQ5P 1KC8Q 2JYGA 4XFZA 4U0AA 1YJWP 5KP7B 2PNGA 4H2YC 4XROA 5F2OA 1CEIA 2FVAA 1UJZA 1EIAA 1K9MQ 2CGQA 5EJDA 3I55P 2FQ1A 2GZJA 1AYIA 1EOQA 1VQ7P 2GZGA 1GXGA 3E2DA 2ONTA 2CG5B 2CQ8A 3G28A 1OR5A 3CCSP 1RO0A 4COPA 3B5IA 2XT1A 1W2BO 5HVCA 2KG6A 1IMPA 5HGNA 1YIJP 2LF4A 1Q81Q 2Z46A 2CNRA 1M1KQ 1VQMP 2EFJA 4U0FA 2KW2A 2JU1A 2BHVA 1AF8A 1QVFO 1Q7YQ 1YJ9P 3NTEA 3DS5A 3B4QA
chains in the Genus database with same CATH topology
2K0XA 2MY5A 2MVUA 2KGEA 2LKIA 2MR7A 2K93A 5KP8B 2KGDA 2KORA 2MF4A 2GDXA 4H2XC 2KOOA 2FVEA 2LPKA 4NEOA 1HY8A 2KR5A 2N50A 2N98A 2KOSA 2XZ0D 2K92A 2K0YA 2KOQA 4DG9A 3LMOA 4BPHA 2KOPA 5KP6B 2K2QA 3EJEA 4BPGA 3CE7A 3EJBA 2L4BA 2EHSA 3RG2A 2LL8A 1NQ4A 2ROQA 4H2WC 1DNYA 5KP7B 2KGCA 2PNGA 4H2YC 2JQ4A 2L0QA 2MR8A 2L9FA 2FVAA 1F80D 2GDWA 1VKUA 2MVVA 4BPFA 1DV5A 2N5HA 2FVFA 2CGQA 2QNWA 5EJDA 2KGAA 2AF8A 3GZLA 2FAEA 2FQ1A 1KLPA 2LMLA 4HKGA 1L0IA 2N5IA 2CG5B 2FHSC 2AFDA 4CA3A 2CQ8A 3NY7B 2LOLA 4PXHB 1OR5A 1ACPA 2FQ2A 5CZDB 2X2BA 2LIUA 5HVCA 2KG6A 2DNWA 2XZ1C 2FQ0A 2K94A 2LIWA 2EHTA 3EJDA 5HV8A 2AVAA 2FACA 2CNRA 2VSQA 4IZ6A 3GZMA 4PWVB 2JU2A 2KW2A 2M5RA 2LTEA 1X3OA 2MD9A 1T8KA 2AFEA 2KG8A 4R0MA 2FADA 2JU1A 2KWLA 1L0HA 1AF8A 2N6YA 2GDYA 1HQBA 4MRTC 2L22A 2JGPA 2KG9A 2N6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K0X A;  2MY5 A;  2MVU A;  2KGE A;  2LKI A;  2MR7 A;  2K93 A;  5KP8 B;  2KGD A;  2KOR A;  2MF4 A;  2GDX A;  4H2X C;  2KOO A;  2FVE A;  2LPK A;  4NEO A;  1HY8 A;  2KR5 A;  2N50 A;  2N98 A;  2KOS A;  2XZ0 D;  2K92 A;  2K0Y A;  2KOQ A;  4DG9 A;  3LMO A;  4BPH A;  2KOP A;  5KP6 B;  2K2Q A;  3EJE A;  4BPG A;  3CE7 A;  3EJB A;  2L4B A;  2EHS A;  3RG2 A;  2LL8 A;  1NQ4 A;  2ROQ A;  4H2W C;  1DNY A;  5KP7 B;  2KGC A;  2PNG A;  4H2Y C;  2JQ4 A;  2L0Q A;  2MR8 A;  2L9F A;  2FVA A;  1F80 D;  2GDW A;  1VKU A;  2MVV A;  4BPF A;  1DV5 A;  2N5H A;  2FVF A;  2CGQ A;  2QNW A;  5EJD A;  2KGA A;  2AF8 A;  3GZL A;  2FAE A;  2FQ1 A;  1KLP A;  2LML A;  4HKG A;  1L0I A;  2N5I A;  2CG5 B;  2FHS C;  2AFD A;  4CA3 A;  2CQ8 A;  3NY7 B;  2LOL A;  4PXH B;  1OR5 A;  1ACP A;  2FQ2 A;  5CZD B;  2X2B A;  2LIU A;  5HVC A;  2KG6 A;  2DNW A;  2XZ1 C;  2FQ0 A;  2K94 A;  2LIW A;  2EHT A;  3EJD A;  5HV8 A;  2AVA A;  2FAC A;  2CNR A;  2VSQ A;  4IZ6 A;  3GZM A;  4PWV B;  2JU2 A;  2KW2 A;  2M5R A;  2LTE A;  1X3O A;  2MD9 A;  1T8K A;  2AFE A;  2KG8 A;  4R0M A;  2FAD A;  2JU1 A;  2KWL A;  1L0H A;  1AF8 A;  2N6Y A;  2GDY A;  1HQB A;  4MRT C;  2L22 A;  2JGP A;  2KG9 A;  2N6Z A; 
#chains in the Genus database with same CATH topology
 1VQ8 P;  3CCL P;  4WYM A;  2K0X A;  2MY5 A;  5F2N A;  2MVU A;  2K93 A;  1A8O A;  2EG5 A;  2KOO A;  2LPK A;  1M74 A;  2NO8 A;  2KR5 A;  1YIT P;  3CCM P;  2PEI A;  3CD6 P;  2KOP A;  2M8L A;  2OTL P;  3VRL C;  4BPG A;  3CC4 P;  2OTJ P;  3G29 A;  3GKL C;  2LL8 A;  1VQ9 P;  4PH0 A;  1DNY A;  2E1M A;  2L0Q A;  2GYK A;  1ZNV A;  1VHN A;  2MVV A;  1Q82 Q;  2FVF A;  2WPT A;  3CCQ P;  2QA4 P;  2KGA A;  2AF8 A;  3GZL A;  1S72 P;  2DGY A;  5DCK A;  1K8A Q;  3CCR P;  1KLP A;  2LML A;  5BS1 A;  1RNI A;  1MZ8 A;  1VQN P;  1L0I A;  2PEM A;  2ERH A;  4IPY A;  3HYB A;  2PEN A;  3NY7 B;  4PXH B;  1KD1 Q;  2FQ2 A;  2PEO A;  3DPH A;  2VLQ A;  3DS1 A;  2FQ0 A;  2LIW A;  1VQO P;  3EJD A;  5HGM A;  2AVA A;  2FAC A;  1Z6M A;  1ZMB A;  3CCU P;  3U43 A;  1X3O A;  3G0V A;  3LRY A;  2AFE A;  1VQP P;  3GJN A;  3H4E A;  2N6Y A;  1HQB A;  3CCV P;  2KG9 A;  2N6Z A;  3DS3 A;  2GZF A;  1KQS O;  4XRQ A;  2XV6 A;  5I4T G;  5KP8 B;  2P9X A;  3P05 A;  4F37 A;  3CC7 P;  4UHP B;  1QRJ A;  2KOS A;  1N8R Q;  1QVG O;  2KOQ A;  1M90 Q;  2PEK A;  3LMO A;  4BPH A;  2M8N A;  2K2Q A;  2XXM A;  3EJE A;  1YJN P;  5BS2 A;  1BXI A;  2L4B A;  1YHQ P;  4QNB A;  3DS2 A;  2L6E A;  1NQ4 A;  2ROQ A;  4H2W C;  1JJ2 O;  2KGC A;  2MR8 A;  2JBG A;  1F80 D;  1E0H A;  2GDW A;  1VKU A;  1DV5 A;  3RG6 C;  2N5H A;  1D1D A;  1VQ4 P;  1VQL P;  2FAE A;  3G1I A;  3M1M A;  2VLN A;  1IUQ A;  3I56 P;  2FHS C;  1RO2 A;  2AFD A;  3MGE A;  4U0B A;  3CCJ P;  2LOL A;  3G4S P;  2JB0 A;  1NJI Q;  4PH1 A;  2OAR A;  2DNW A;  2XZ1 C;  4M0I A;  3CPW O;  3G71 P;  2K94 A;  1BAJ A;  5HV8 A;  2JYL A;  2VSQ A;  4IZ6 A;  4U0C A;  3GZM A;  4PWV B;  3DS4 A;  1GPJ A;  2LTE A;  2VLO A;  1T8K A;  4R0M A;  5HGO A;  2Z44 A;  4MRT C;  2L22 A;  2JGP A;  3G6E P;  2BUO A;  1IMQ A;  2LKI A;  2MR7 A;  2KGD A;  2GDX A;  4H2X C;  2FVE A;  4NEO A;  1YI2 P;  4U0E A;  2N50 A;  2N98 A;  2XZ0 D;  2PY8 A;  2K92 A;  2K0Y A;  4DG9 A;  2GZI A;  5KP6 B;  1VQ6 P;  2EHS A;  1GXH A;  3RG2 A;  1E6J P;  3WBH A;  3CXC O;  1M6E X;  2PEJ A;  7CEI A;  2JQ4 A;  2L9F A;  2VLP A;  3OW2 O;  4BPF A;  1A43 A;  2K5X A;  2QNW A;  3H47 A;  2PEQ A;  4HKG A;  1EMV A;  3Q20 A;  2N5I A;  4CA3 A;  3G26 A;  1ACP A;  5CZD B;  4GR6 A;  3CME P;  3G21 A;  2X2B A;  5EW5 E;  2GZE A;  1VQK P;  2EIA A;  2LIU A;  1K30 A;  2KOD A;  1Q86 Q;  2EHT A;  2QEX P;  4COC A;  1M6N A;  4GR2 A;  4XFY A;  2JU2 A;  3H0D A;  2M5R A;  5F2K A;  2JO0 A;  3HZQ A;  2JAZ A;  2MD9 A;  1K73 Q;  3DS0 A;  2KG8 A;  3CCE P;  2FAD A;  4QKO A;  2KWL A;  1L0H A;  2GDY A;  1AUM A;  2Z45 A;  3CMA P;  4U0D A;  2KGE A;  2KOR A;  2K0D X;  2MF4 A;  1HY8 A;  1FR2 A;  3G1G A;  2M8P A;  5HGL A;  2CWO A;  1UNK A;  5JPA A;  3DTJ A;  3CC2 P;  4XFX A;  3CE7 A;  3EJB A;  1VQ5 P;  1KC8 Q;  2JYG A;  4XFZ A;  4U0A A;  1YJW P;  5KP7 B;  2PNG A;  4H2Y C;  4XRO A;  5F2O A;  1CEI A;  2FVA A;  1UJZ A;  1EIA A;  1K9M Q;  2CGQ A;  5EJD A;  3I55 P;  2FQ1 A;  2GZJ A;  1AYI A;  1EOQ A;  1VQ7 P;  2GZG A;  1GXG A;  3E2D A;  2ONT A;  2CG5 B;  2CQ8 A;  3G28 A;  1OR5 A;  3CCS P;  1RO0 A;  4COP A;  3B5I A;  2XT1 A;  1W2B O;  5HVC A;  2KG6 A;  1IMP A;  5HGN A;  1YIJ P;  2LF4 A;  1Q81 Q;  2Z46 A;  2CNR A;  1M1K Q;  1VQM P;  2EFJ A;  4U0F A;  2KW2 A;  2JU1 A;  2BHV A;  1AF8 A;  1QVF O;  1Q7Y Q;  1YJ9 P;  3NTE A;  3DS5 A;  3B4Q A; 
#chains in the Genus database with same CATH homology
 2K0X A;  2MY5 A;  2MVU A;  2KGE A;  2LKI A;  2MR7 A;  2K93 A;  5KP8 B;  2KGD A;  2KOR A;  2MF4 A;  2GDX A;  4H2X C;  2KOO A;  2FVE A;  2LPK A;  4NEO A;  1HY8 A;  2KR5 A;  2N50 A;  2N98 A;  2KOS A;  2XZ0 D;  2K92 A;  2K0Y A;  2KOQ A;  4DG9 A;  3LMO A;  4BPH A;  2KOP A;  5KP6 B;  2K2Q A;  3EJE A;  4BPG A;  3CE7 A;  3EJB A;  2L4B A;  2EHS A;  3RG2 A;  2LL8 A;  1NQ4 A;  2ROQ A;  4H2W C;  1DNY A;  5KP7 B;  2KGC A;  2PNG A;  4H2Y C;  2JQ4 A;  2L0Q A;  2MR8 A;  2L9F A;  2FVA A;  1F80 D;  2GDW A;  1VKU A;  2MVV A;  4BPF A;  1DV5 A;  2N5H A;  2FVF A;  2CGQ A;  2QNW A;  5EJD A;  2KGA A;  2AF8 A;  3GZL A;  2FAE A;  2FQ1 A;  1KLP A;  2LML A;  4HKG A;  1L0I A;  2N5I A;  2CG5 B;  2FHS C;  2AFD A;  4CA3 A;  2CQ8 A;  3NY7 B;  2LOL A;  4PXH B;  1OR5 A;  1ACP A;  2FQ2 A;  5CZD B;  2X2B A;  2LIU A;  5HVC A;  2KG6 A;  2DNW A;  2XZ1 C;  2FQ0 A;  2K94 A;  2LIW A;  2EHT A;  3EJD A;  5HV8 A;  2AVA A;  2FAC A;  2CNR A;  2VSQ A;  4IZ6 A;  3GZM A;  4PWV B;  2JU2 A;  2KW2 A;  2M5R A;  2LTE A;  1X3O A;  2MD9 A;  1T8K A;  2AFE A;  2KG8 A;  4R0M A;  2FAD A;  2JU1 A;  2KWL A;  1L0H A;  1AF8 A;  2N6Y A;  2GDY A;  1HQB A;  4MRT C;  2L22 A;  2JGP A;  2KG9 A;  2N6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...