2CGQA

A putative acyl carrier protein(rv0033) from mycobacterium tuberculosis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
AMEEAINATIQRILRTDRGITANQVLVDDLGFDSLKLFQLITELEDEFDIAISFRDAQNIKTVGDVYTSVAVWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a Putative Acyl Carrier Protein (Rv0033) from Mycobacterium Tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein transport
molecule keywords ACYL CARRIER PROTEIN ACPA
total genus 25
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2cgqA00
2KOPA 3GZMA 2EHTA 2GDXA 1T8KA 1KLPA 1VKUA 2MVVA 2N5HA 3LMOA 2K93A 5EJDA 2CG5B 2L4BA 2K0XA 1AF8A 5KP8B 2CQ8A 2CGQA 3NY7B 2KGEA 3GZLA 3CE7A 2N50A 2XZ0D 1F80D 2MR7A 2M5RA 2MD9A 2N5IA 2LIWA 2N98A 2FVAA 2VSQA 4H2WC 3RG2A 2KGDA 4NEOA 2KOQA 2ROQA 2GDYA 5CZDB 2JQ4A 2MVUA 2AF8A 2LPKA 1HY8A 5HVCA 2K94A 1L0HA 4H2YC 4DG9A 2KR5A 2JU2A 2FQ1A 1DNYA 2L9FA 4PXHB 2FQ0A 1OR5A 1X3OA 1NQ4A 2LTEA 2LKIA 5HV8A 2KOSA 2AFDA 2FVFA 2LOLA 1HQBA 2LL8A 2KG8A 2FQ2A 2KG6A 4BPHA 2X2BA 2FACA 2KORA 2MF4A 2MR8A 4MRTC 5KP7B 1L0IA 4CA3A 4R0MA 2QNWA 2KWLA 2FVEA 2EHSA 2KW2A 2N6ZA 2KGCA 4H2XC 2FHSC 2KOOA 2KGAA 2XZ1C 2KG9A 2K2QA 2AFEA 2K0YA 4BPGA 2PNGA 2L22A 3EJEA 2JU1A 2JGPA 2K92A 4PWVB 2CNRA 2LIUA 2AVAA 2N6YA 2FAEA 2GDWA 2MY5A 5KP6B 2LMLA 3EJBA 2DNWA 1DV5A 2L0QA 4BPFA 4IZ6A 4HKGA 2FADA 1ACPA 3EJDA
chains in the Genus database with same CATH superfamily
2JYGA 2GDXA 3CPWO 5F2KA 1T8KA 1KLPA 1VQ6P 2N5HA 3DTJA 2JAZA 1ZMBA 2N5IA 4WYMA 3I55P 2N98A 2Z44A 2PEJA 1GPJA 4H2WC 5HGOA 1CEIA 4PH0A 4NEOA 2E1MA 2PENA 2K5XA 3DS0A 2LPKA 4U0BA 1HY8A 5BS2A 1L0HA 2XXMA 3NTEA 1A8OA 4H2YC 4DG9A 2OARA 1QRJA 4PXHB 4XROA 1M74A 3G6EP 1NQ4A 2LTEA 2LKIA 5HV8A 1IMQA 2KOSA 5F2OA 2JBGA 2FQ2A 2KG6A 3G21A 1W2BO 2FACA 2KORA 2MF4A 4COCA 1VQ5P 2XV6A 3CCQP 4R0MA 2KWLA 2KOOA 2KGAA 2XZ1C 2PNGA 1YJWP 2CNRA 2AVAA 2N6YA 2NO8A 2DNWA 2GZGA 2L0QA 3VRLC 3DS3A 2KOPA 2MVVA 1K30A 1KC8Q 3GKLC 3LMOA 2GZJA 2GYKA 1ZNVA 1M6EX 2CQ8A 3NY7B 2KGEA 3G1IA 1UNKA 2MR7A 2MD9A 4U0EA 3WBHA 3G4SP 4F37A 1AUMA 3RG2A 2GZFA 1VQMP 1E0HA 2KGDA 2PEQA 3G0VA 4M0IA 1M6NA 4U0AA 3G28A 3OW2O 2JB0A 1E6JP 5CZDB 2JQ4A 1MZ8A 5EW5E 2AF8A 1Z6MA 2Z45A 1BAJA 2GZIA 1AYIA 2BUOA 2KR5A 3LRYA 3CCJP 2CWOA 1OR5A 1GXGA 2EFJA 4COPA 4PH1A 2AFDA 2FVFA 2LOLA 3B5IA 1HQBA 1YIJP 4U0CA 3E2DA 2X2BA 1KD1Q 1YITP 1N8RQ 3CCEP 2PEIA 2PY8A 2KW2A 2KG9A 2AFEA 1A43A 1QVGO 2ERHA 3EJEA 3U43A 2K92A 3CCUP 2FAEA 5KP6B 2LMLA 3EJBA 5HGNA 3RG6C 1DV5A 4IZ6A 4XFXA 1YJ9P 4HKGA 2FADA 3CC4P 2M8PA 2P9XA 4XFZA 3GZMA 2EHTA 3H47A 2VLQA 1VKUA 3B4QA 5EJDA 2CG5B 2K0XA 5KP8B 3G71P 3CCMP 2JO0A 3P05A 1VQPP 3CE7A 2N50A 2XZ0D 4QKOA 3H0DA 1F80D 4U0DA 2OTJP 1IUQA 1K8AQ 3CMAP 3GJNA 2K0DX 2L6EA 3CD6P 5JPAA 2VLOA 4IPYA 2KODA 2ROQA 3H4EA 2EG5A 3G26A 2GDYA 2PEKA 3MGEA 2LF4A 2MVUA 1YI2P 2K94A 7CEIA 1YJNP 2VLNA 2PEOA 2FQ1A 3M1MA 5DCKA 1Q82Q 1DNYA 2L9FA 2Z46A 2VLPA 4UHPB 3I56P 1X3OA 1UJZA 2LL8A 2KG8A 1K9MQ 1VQNP 5BS1A 3DS2A 3G1GA 4MRTC 1Q81Q 5KP7B 1VQ4P 1FR2A 2QNWA 3DS4A 1D1DA 4GR6A 4GR2A 4H2XC 2WPTA 2FHSC 3DS1A 4BPGA 2OTLP 1EOQA 5I4TG 2JGPA 1M1KQ 4PWVB 1VQLP 1BXIA 2GDWA 4U0FA 4BPFA 2JYLA 4XFYA 3CCLP 1K73Q 3CCSP 2XT1A 1VQ9P 2K93A 1KQSO 2L4BA 1M90Q 3G29A 2DGYA 1AF8A 5F2NA 4XRQA 2CGQA 3GZLA 2BHVA 2M5RA 2LIWA 3Q20A 1EIAA 2FVAA 2VSQA 2EIAA 1RNIA 3DS5A 1VQKP 1RO0A 2QEXP 2KOQA 3CCRP 1Q7YQ 2ONTA 3CC7P 5HGMA 3CCVP 1VQ8P 1QVFO 3CXCO 5HVCA 1JJ2O 3CMEP 2JU2A 1RO2A 5HGLA 1EMVA 2FQ0A 2PEMA 3HYBA 3DPHA 2QA4P 4BPHA 2MR8A 1IMPA 1S72P 1L0IA 4CA3A 2GZEA 2M8NA 2FVEA 2EHSA 2M8LA 2N6ZA 2KGCA 1GXHA 2K2QA 1NJIQ 2K0YA 1VHNA 2L22A 2JU1A 1YHQP 2LIUA 2MY5A 1VQ7P 1VQOP 1Q86Q 3CC2P 4QNBA 3HZQA 1ACPA 3EJDA
chains in the Genus database with same CATH topology
2KOPA 3GZMA 2EHTA 2GDXA 1T8KA 1KLPA 1VKUA 2MVVA 2N5HA 3LMOA 2K93A 5EJDA 2CG5B 2L4BA 2K0XA 1AF8A 5KP8B 2CQ8A 2CGQA 3NY7B 2KGEA 3GZLA 3CE7A 2N50A 2XZ0D 1F80D 2MR7A 2M5RA 2MD9A 2N5IA 2LIWA 2N98A 2FVAA 2VSQA 4H2WC 3RG2A 2KGDA 4NEOA 2KOQA 2ROQA 2GDYA 5CZDB 2JQ4A 2MVUA 2AF8A 2LPKA 1HY8A 5HVCA 2K94A 1L0HA 4H2YC 4DG9A 2KR5A 2JU2A 2FQ1A 1DNYA 2L9FA 4PXHB 2FQ0A 1OR5A 1X3OA 1NQ4A 2LTEA 2LKIA 5HV8A 2KOSA 2AFDA 2FVFA 2LOLA 1HQBA 2LL8A 2KG8A 2FQ2A 2KG6A 4BPHA 2X2BA 2FACA 2KORA 2MF4A 2MR8A 4MRTC 5KP7B 1L0IA 4CA3A 4R0MA 2QNWA 2KWLA 2FVEA 2EHSA 2KW2A 2N6ZA 2KGCA 4H2XC 2FHSC 2KOOA 2KGAA 2XZ1C 2KG9A 2K2QA 2AFEA 2K0YA 4BPGA 2PNGA 2L22A 3EJEA 2JU1A 2JGPA 2K92A 4PWVB 2CNRA 2LIUA 2AVAA 2N6YA 2FAEA 2GDWA 2MY5A 5KP6B 2LMLA 3EJBA 2DNWA 1DV5A 2L0QA 4BPFA 4IZ6A 4HKGA 2FADA 1ACPA 3EJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOP A;  3GZM A;  2EHT A;  2GDX A;  1T8K A;  1KLP A;  1VKU A;  2MVV A;  2N5H A;  3LMO A;  2K93 A;  5EJD A;  2CG5 B;  2L4B A;  2K0X A;  1AF8 A;  5KP8 B;  2CQ8 A;  2CGQ A;  3NY7 B;  2KGE A;  3GZL A;  3CE7 A;  2N50 A;  2XZ0 D;  1F80 D;  2MR7 A;  2M5R A;  2MD9 A;  2N5I A;  2LIW A;  2N98 A;  2FVA A;  2VSQ A;  4H2W C;  3RG2 A;  2KGD A;  4NEO A;  2KOQ A;  2ROQ A;  2GDY A;  5CZD B;  2JQ4 A;  2MVU A;  2AF8 A;  2LPK A;  1HY8 A;  5HVC A;  2K94 A;  1L0H A;  4H2Y C;  4DG9 A;  2KR5 A;  2JU2 A;  2FQ1 A;  1DNY A;  2L9F A;  4PXH B;  2FQ0 A;  1OR5 A;  1X3O A;  1NQ4 A;  2LTE A;  2LKI A;  5HV8 A;  2KOS A;  2AFD A;  2FVF A;  2LOL A;  1HQB A;  2LL8 A;  2KG8 A;  2FQ2 A;  2KG6 A;  4BPH A;  2X2B A;  2FAC A;  2KOR A;  2MF4 A;  2MR8 A;  4MRT C;  5KP7 B;  1L0I A;  4CA3 A;  4R0M A;  2QNW A;  2KWL A;  2FVE A;  2EHS A;  2KW2 A;  2N6Z A;  2KGC A;  4H2X C;  2FHS C;  2KOO A;  2KGA A;  2XZ1 C;  2KG9 A;  2K2Q A;  2AFE A;  2K0Y A;  4BPG A;  2PNG A;  2L22 A;  3EJE A;  2JU1 A;  2JGP A;  2K92 A;  4PWV B;  2CNR A;  2LIU A;  2AVA A;  2N6Y A;  2FAE A;  2GDW A;  2MY5 A;  5KP6 B;  2LML A;  3EJB A;  2DNW A;  1DV5 A;  2L0Q A;  4BPF A;  4IZ6 A;  4HKG A;  2FAD A;  1ACP A;  3EJD A; 
#chains in the Genus database with same CATH topology
 2JYG A;  2GDX A;  3CPW O;  5F2K A;  1T8K A;  1KLP A;  1VQ6 P;  2N5H A;  3DTJ A;  2JAZ A;  1ZMB A;  2N5I A;  4WYM A;  3I55 P;  2N98 A;  2Z44 A;  2PEJ A;  1GPJ A;  4H2W C;  5HGO A;  1CEI A;  4PH0 A;  4NEO A;  2E1M A;  2PEN A;  2K5X A;  3DS0 A;  2LPK A;  4U0B A;  1HY8 A;  5BS2 A;  1L0H A;  2XXM A;  3NTE A;  1A8O A;  4H2Y C;  4DG9 A;  2OAR A;  1QRJ A;  4PXH B;  4XRO A;  1M74 A;  3G6E P;  1NQ4 A;  2LTE A;  2LKI A;  5HV8 A;  1IMQ A;  2KOS A;  5F2O A;  2JBG A;  2FQ2 A;  2KG6 A;  3G21 A;  1W2B O;  2FAC A;  2KOR A;  2MF4 A;  4COC A;  1VQ5 P;  2XV6 A;  3CCQ P;  4R0M A;  2KWL A;  2KOO A;  2KGA A;  2XZ1 C;  2PNG A;  1YJW P;  2CNR A;  2AVA A;  2N6Y A;  2NO8 A;  2DNW A;  2GZG A;  2L0Q A;  3VRL C;  3DS3 A;  2KOP A;  2MVV A;  1K30 A;  1KC8 Q;  3GKL C;  3LMO A;  2GZJ A;  2GYK A;  1ZNV A;  1M6E X;  2CQ8 A;  3NY7 B;  2KGE A;  3G1I A;  1UNK A;  2MR7 A;  2MD9 A;  4U0E A;  3WBH A;  3G4S P;  4F37 A;  1AUM A;  3RG2 A;  2GZF A;  1VQM P;  1E0H A;  2KGD A;  2PEQ A;  3G0V A;  4M0I A;  1M6N A;  4U0A A;  3G28 A;  3OW2 O;  2JB0 A;  1E6J P;  5CZD B;  2JQ4 A;  1MZ8 A;  5EW5 E;  2AF8 A;  1Z6M A;  2Z45 A;  1BAJ A;  2GZI A;  1AYI A;  2BUO A;  2KR5 A;  3LRY A;  3CCJ P;  2CWO A;  1OR5 A;  1GXG A;  2EFJ A;  4COP A;  4PH1 A;  2AFD A;  2FVF A;  2LOL A;  3B5I A;  1HQB A;  1YIJ P;  4U0C A;  3E2D A;  2X2B A;  1KD1 Q;  1YIT P;  1N8R Q;  3CCE P;  2PEI A;  2PY8 A;  2KW2 A;  2KG9 A;  2AFE A;  1A43 A;  1QVG O;  2ERH A;  3EJE A;  3U43 A;  2K92 A;  3CCU P;  2FAE A;  5KP6 B;  2LML A;  3EJB A;  5HGN A;  3RG6 C;  1DV5 A;  4IZ6 A;  4XFX A;  1YJ9 P;  4HKG A;  2FAD A;  3CC4 P;  2M8P A;  2P9X A;  4XFZ A;  3GZM A;  2EHT A;  3H47 A;  2VLQ A;  1VKU A;  3B4Q A;  5EJD A;  2CG5 B;  2K0X A;  5KP8 B;  3G71 P;  3CCM P;  2JO0 A;  3P05 A;  1VQP P;  3CE7 A;  2N50 A;  2XZ0 D;  4QKO A;  3H0D A;  1F80 D;  4U0D A;  2OTJ P;  1IUQ A;  1K8A Q;  3CMA P;  3GJN A;  2K0D X;  2L6E A;  3CD6 P;  5JPA A;  2VLO A;  4IPY A;  2KOD A;  2ROQ A;  3H4E A;  2EG5 A;  3G26 A;  2GDY A;  2PEK A;  3MGE A;  2LF4 A;  2MVU A;  1YI2 P;  2K94 A;  7CEI A;  1YJN P;  2VLN A;  2PEO A;  2FQ1 A;  3M1M A;  5DCK A;  1Q82 Q;  1DNY A;  2L9F A;  2Z46 A;  2VLP A;  4UHP B;  3I56 P;  1X3O A;  1UJZ A;  2LL8 A;  2KG8 A;  1K9M Q;  1VQN P;  5BS1 A;  3DS2 A;  3G1G A;  4MRT C;  1Q81 Q;  5KP7 B;  1VQ4 P;  1FR2 A;  2QNW A;  3DS4 A;  1D1D A;  4GR6 A;  4GR2 A;  4H2X C;  2WPT A;  2FHS C;  3DS1 A;  4BPG A;  2OTL P;  1EOQ A;  5I4T G;  2JGP A;  1M1K Q;  4PWV B;  1VQL P;  1BXI A;  2GDW A;  4U0F A;  4BPF A;  2JYL A;  4XFY A;  3CCL P;  1K73 Q;  3CCS P;  2XT1 A;  1VQ9 P;  2K93 A;  1KQS O;  2L4B A;  1M90 Q;  3G29 A;  2DGY A;  1AF8 A;  5F2N A;  4XRQ A;  2CGQ A;  3GZL A;  2BHV A;  2M5R A;  2LIW A;  3Q20 A;  1EIA A;  2FVA A;  2VSQ A;  2EIA A;  1RNI A;  3DS5 A;  1VQK P;  1RO0 A;  2QEX P;  2KOQ A;  3CCR P;  1Q7Y Q;  2ONT A;  3CC7 P;  5HGM A;  3CCV P;  1VQ8 P;  1QVF O;  3CXC O;  5HVC A;  1JJ2 O;  3CME P;  2JU2 A;  1RO2 A;  5HGL A;  1EMV A;  2FQ0 A;  2PEM A;  3HYB A;  3DPH A;  2QA4 P;  4BPH A;  2MR8 A;  1IMP A;  1S72 P;  1L0I A;  4CA3 A;  2GZE A;  2M8N A;  2FVE A;  2EHS A;  2M8L A;  2N6Z A;  2KGC A;  1GXH A;  2K2Q A;  1NJI Q;  2K0Y A;  1VHN A;  2L22 A;  2JU1 A;  1YHQ P;  2LIU A;  2MY5 A;  1VQ7 P;  1VQO P;  1Q86 Q;  3CC2 P;  4QNB A;  3HZQ A;  1ACP A;  3EJD A; 
#chains in the Genus database with same CATH homology
 2KOP A;  3GZM A;  2EHT A;  2GDX A;  1T8K A;  1KLP A;  1VKU A;  2MVV A;  2N5H A;  3LMO A;  2K93 A;  5EJD A;  2CG5 B;  2L4B A;  2K0X A;  1AF8 A;  5KP8 B;  2CQ8 A;  2CGQ A;  3NY7 B;  2KGE A;  3GZL A;  3CE7 A;  2N50 A;  2XZ0 D;  1F80 D;  2MR7 A;  2M5R A;  2MD9 A;  2N5I A;  2LIW A;  2N98 A;  2FVA A;  2VSQ A;  4H2W C;  3RG2 A;  2KGD A;  4NEO A;  2KOQ A;  2ROQ A;  2GDY A;  5CZD B;  2JQ4 A;  2MVU A;  2AF8 A;  2LPK A;  1HY8 A;  5HVC A;  2K94 A;  1L0H A;  4H2Y C;  4DG9 A;  2KR5 A;  2JU2 A;  2FQ1 A;  1DNY A;  2L9F A;  4PXH B;  2FQ0 A;  1OR5 A;  1X3O A;  1NQ4 A;  2LTE A;  2LKI A;  5HV8 A;  2KOS A;  2AFD A;  2FVF A;  2LOL A;  1HQB A;  2LL8 A;  2KG8 A;  2FQ2 A;  2KG6 A;  4BPH A;  2X2B A;  2FAC A;  2KOR A;  2MF4 A;  2MR8 A;  4MRT C;  5KP7 B;  1L0I A;  4CA3 A;  4R0M A;  2QNW A;  2KWL A;  2FVE A;  2EHS A;  2KW2 A;  2N6Z A;  2KGC A;  4H2X C;  2FHS C;  2KOO A;  2KGA A;  2XZ1 C;  2KG9 A;  2K2Q A;  2AFE A;  2K0Y A;  4BPG A;  2PNG A;  2L22 A;  3EJE A;  2JU1 A;  2JGP A;  2K92 A;  4PWV B;  2CNR A;  2LIU A;  2AVA A;  2N6Y A;  2FAE A;  2GDW A;  2MY5 A;  5KP6 B;  2LML A;  3EJB A;  2DNW A;  1DV5 A;  2L0Q A;  4BPF A;  4IZ6 A;  4HKG A;  2FAD A;  1ACP A;  3EJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...