2CGQA

A putative acyl carrier protein(rv0033) from mycobacterium tuberculosis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
AMEEAINATIQRILRTDRGITANQVLVDDLGFDSLKLFQLITELEDEFDIAISFRDAQNIKTVGDVYTSVAVWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL CARRIER PROTEIN ACPA
publication title The Structure of a Putative Acyl Carrier Protein (Rv0033) from Mycobacterium Tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein transport
total genus 25
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2cgqA00
2LMLA 2K0XA 2LIUA 4R0MA 4H2YC 2FVAA 2MR7A 2GDXA 2ROQA 5CZDB 2LL8A 2KGEA 2FHSC 2KGAA 2MD9A 4MRTC 4CA3A 2L9FA 2XZ1C 2L4BA 2MY5A 2AF8A 1T8KA 2GDYA 2JU2A 2N98A 2CQ8A 5KP7B 3GZLA 2KGCA 4PWVB 2FQ1A 2KOPA 2KW2A 1X3OA 2MVUA 3RG2A 1DV5A 2N5IA 2N6ZA 4H2WC 2LIWA 5HV8A 2KWLA 1NQ4A 3GZMA 1HQBA 2PNGA 1L0IA 2KR5A 3EJEA 1HY8A 4HKGA 2LOLA 2FQ0A 2MF4A 3NY7B 2LPKA 2JQ4A 1ACPA 2L0QA 2JGPA 3LMOA 2N6YA 2CNRA 4BPGA 4PXHB 2FADA 2K92A 2K94A 4BPHA 2AFEA 5KP6B 4IZ6A 1AF8A 4BPFA 1F80D 2QNWA 2AVAA 4DG9A 2FVEA 2CG5B 2KGDA 2GDWA 2KOSA 4H2XC 2FAEA 2LTEA 2EHSA 2FVFA 2VSQA 2K93A 2FACA 2KG9A 3EJDA 2LKIA 2AFDA 2EHTA 2MR8A 2K0YA 2XZ0D 2M5RA 1L0HA 2X2BA 3CE7A 5KP8B 2KOOA 2DNWA 5EJDA 5HVCA 4NEOA 1KLPA 1DNYA 1OR5A 2JU1A 2KG6A 2KOQA 2FQ2A 2K2QA 2L22A 2N50A 1VKUA 2CGQA 3EJBA 2MVVA 2N5HA 2KORA 2KG8A
chains in the Genus database with same CATH superfamily
1M1KQ 2LIUA 4R0MA 1RO0A 1YJ9P 1RNIA 2MR7A 1VQ7P 2GDXA 5CZDB 3G28A 2LL8A 3DS2A 2KGEA 2PEKA 1YITP 2FHSC 2KGAA 4MRTC 4CA3A 2L9FA 3I55P 1YJNP 4XFYA 2KGCA 2PEOA 2KW2A 1X3OA 2K0DX 3B4QA 2N5IA 3CD6P 3WBHA 1Q7YQ 2Z45A 2WPTA 2QA4P 3EJEA 4HKGA 2P9XA 3G71P 2L0QA 5EW5E 2N6YA 1KQSO 4BPGA 2K94A 4BPHA 4IZ6A 3H4EA 1AF8A 1F80D 1EMVA 2CWOA 1D1DA 2CG5B 4U0CA 1NJIQ 4H2XC 2LTEA 1M90Q 2EHSA 2M8NA 1Z6MA 4UHPB 2LKIA 3CCMP 3CCVP 4U0DA 1QVFO 3DS3A 5HGOA 1QRJA 2OTJP 3CE7A 1A8OA 5F2NA 5EJDA 1DNYA 1A43A 1BXIA 2OARA 2KOQA 2K2QA 2EFJA 2N50A 2CGQA 1GPJA 2MVVA 3CCUP 2N5HA 4GR6A 3G29A 5F2KA 2FVAA 1MZ8A 2GZGA 3H47A 2XZ1C 3DTJA 1T8KA 3G4SP 2CQ8A 4PH1A 2GZEA 2FQ1A 2MVUA 2ONTA 3U43A 3G26A 3CC2P 1IMPA 3E2DA 1NQ4A 4PH0A 4XROA 1VQ8P 4U0AA 1HQBA 7CEIA 3I56P 2PEQA 2LOLA 3NY7B 3CCRP 2VLPA 4PXHB 3CCSP 2FADA 1KD1Q 3CMEP 1YJWP 2LF4A 4F37A 1IMQA 4BPFA 1K9MQ 2QNWA 1Q81Q 2PENA 2KGDA 2VLQA 1EIAA 4COPA 3CC4P 3HZQA 2OTLP 2FACA 1Q86Q 2AFDA 2EHTA 1JJ2O 3GJNA 2M5RA 1L0HA 2X2BA 1K30A 1K73Q 3G1GA 2KOOA 5HVCA 4NEOA 1VQOP 1UNKA 2GZIA 2JYGA 1VQKP 2FQ2A 2L22A 2KORA 3DS5A 3RG6C 2GZFA 2KG8A 2LMLA 1ZNVA 2K0XA 1FR2A 1GXGA 1IUQA 2EIAA 4H2YC 3CCJP 2ROQA 3P05A 2KODA 3M1MA 4XFXA 2XXMA 2MY5A 2AF8A 2JU2A 4COCA 5KP7B 4PWVB 3CCQP 1YHQP 1VQNP 4XFZA 1VQMP 2N6ZA 4H2WC 1M74A 2LIWA 1VQ9P 4IPYA 3G0VA 4QKOA 5F2OA 3OW2O 3CCEP 2PNGA 2EG5A 1L0IA 2KR5A 1HY8A 1VHNA 2FQ0A 3CPWO 2MF4A 1Q82Q 1EOQA 2LPKA 2JQ4A 1ACPA 1UJZA 2XV6A 3VRLC 2JGPA 3LMOA 2CNRA 2K92A 3DS1A 2M8PA 5KP6B 3DS4A 2VLOA 4DG9A 2BHVA 4U0EA 4U0FA 2GDWA 2XT1A 2FAEA 1S72P 1BAJA 2K93A 2KG9A 3CMAP 4U0BA 2K0YA 2NO8A 1AUMA 5BS1A 5HGMA 1VQ5P 1GXHA 2DGYA 1VQ4P 2QEXP 2ERHA 3G6EP 4QNBA 1YIJP 3Q20A 1ZMBA 2KG6A 4WYMA 3NTEA 1VKUA 5BS2A 2Z44A 2M8LA 3G21A 3HYBA 1VQPP 2GYKA 2PEJA 4M0IA 2MD9A 5JPAA 2L4BA 3GKLC 2GDYA 3B5IA 2N98A 3GZLA 2KOPA 1W2BO 2JBGA 1KC8Q 3RG2A 1DV5A 2L6EA 2E1MA 5HV8A 2KWLA 1M6NA 1YI2P 2JO0A 3DPHA 2JB0A 1M6EX 3GZMA 3CXCO 2GZJA 5HGNA 3H0DA 1N8RQ 1VQLP 2PEMA 4XRQA 1RO2A 3G1IA 2AFEA 3MGEA 4GR2A 2AVAA 3DS0A 1E6JP 2FVEA 2KOSA 3CCLP 2FVFA 2VSQA 3EJDA 2JYLA 2MR8A 1QVGO 5I4TG 2XZ0D 2K5XA 5KP8B 2BUOA 2DNWA 2PEIA 1VQ6P 1K8AQ 2PY8A 1KLPA 3LRYA 1OR5A 2Z46A 2JU1A 3CC7P 1CEIA 1E0HA 3EJBA 5HGLA 2VLNA 2JAZA 5DCKA 1AYIA
chains in the Genus database with same CATH topology
2LMLA 2K0XA 2LIUA 4R0MA 4H2YC 2FVAA 2MR7A 2GDXA 2ROQA 5CZDB 2LL8A 2KGEA 2FHSC 2KGAA 2MD9A 4MRTC 4CA3A 2L9FA 2XZ1C 2L4BA 2MY5A 2AF8A 1T8KA 2GDYA 2JU2A 2N98A 2CQ8A 5KP7B 3GZLA 2KGCA 4PWVB 2FQ1A 2KOPA 2KW2A 1X3OA 2MVUA 3RG2A 1DV5A 2N5IA 2N6ZA 4H2WC 2LIWA 5HV8A 2KWLA 1NQ4A 3GZMA 1HQBA 2PNGA 1L0IA 2KR5A 3EJEA 1HY8A 4HKGA 2LOLA 2FQ0A 2MF4A 3NY7B 2LPKA 2JQ4A 1ACPA 2L0QA 2JGPA 3LMOA 2N6YA 2CNRA 4BPGA 4PXHB 2FADA 2K92A 2K94A 4BPHA 2AFEA 5KP6B 4IZ6A 1AF8A 4BPFA 1F80D 2QNWA 2AVAA 4DG9A 2FVEA 2CG5B 2KGDA 2GDWA 2KOSA 4H2XC 2FAEA 2LTEA 2EHSA 2FVFA 2VSQA 2K93A 2FACA 2KG9A 3EJDA 2LKIA 2AFDA 2EHTA 2MR8A 2K0YA 2XZ0D 2M5RA 1L0HA 2X2BA 3CE7A 5KP8B 2KOOA 2DNWA 5EJDA 5HVCA 4NEOA 1KLPA 1DNYA 1OR5A 2JU1A 2KG6A 2KOQA 2FQ2A 2K2QA 2L22A 2N50A 1VKUA 2CGQA 3EJBA 2MVVA 2N5HA 2KORA 2KG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LML A;  2K0X A;  2LIU A;  4R0M A;  4H2Y C;  2FVA A;  2MR7 A;  2GDX A;  2ROQ A;  5CZD B;  2LL8 A;  2KGE A;  2FHS C;  2KGA A;  2MD9 A;  4MRT C;  4CA3 A;  2L9F A;  2XZ1 C;  2L4B A;  2MY5 A;  2AF8 A;  1T8K A;  2GDY A;  2JU2 A;  2N98 A;  2CQ8 A;  5KP7 B;  3GZL A;  2KGC A;  4PWV B;  2FQ1 A;  2KOP A;  2KW2 A;  1X3O A;  2MVU A;  3RG2 A;  1DV5 A;  2N5I A;  2N6Z A;  4H2W C;  2LIW A;  5HV8 A;  2KWL A;  1NQ4 A;  3GZM A;  1HQB A;  2PNG A;  1L0I A;  2KR5 A;  3EJE A;  1HY8 A;  4HKG A;  2LOL A;  2FQ0 A;  2MF4 A;  3NY7 B;  2LPK A;  2JQ4 A;  1ACP A;  2L0Q A;  2JGP A;  3LMO A;  2N6Y A;  2CNR A;  4BPG A;  4PXH B;  2FAD A;  2K92 A;  2K94 A;  4BPH A;  2AFE A;  5KP6 B;  4IZ6 A;  1AF8 A;  4BPF A;  1F80 D;  2QNW A;  2AVA A;  4DG9 A;  2FVE A;  2CG5 B;  2KGD A;  2GDW A;  2KOS A;  4H2X C;  2FAE A;  2LTE A;  2EHS A;  2FVF A;  2VSQ A;  2K93 A;  2FAC A;  2KG9 A;  3EJD A;  2LKI A;  2AFD A;  2EHT A;  2MR8 A;  2K0Y A;  2XZ0 D;  2M5R A;  1L0H A;  2X2B A;  3CE7 A;  5KP8 B;  2KOO A;  2DNW A;  5EJD A;  5HVC A;  4NEO A;  1KLP A;  1DNY A;  1OR5 A;  2JU1 A;  2KG6 A;  2KOQ A;  2FQ2 A;  2K2Q A;  2L22 A;  2N50 A;  1VKU A;  2CGQ A;  3EJB A;  2MVV A;  2N5H A;  2KOR A;  2KG8 A; 
#chains in the Genus database with same CATH topology
 1M1K Q;  2LIU A;  4R0M A;  1RO0 A;  1YJ9 P;  1RNI A;  2MR7 A;  1VQ7 P;  2GDX A;  5CZD B;  3G28 A;  2LL8 A;  3DS2 A;  2KGE A;  2PEK A;  1YIT P;  2FHS C;  2KGA A;  4MRT C;  4CA3 A;  2L9F A;  3I55 P;  1YJN P;  4XFY A;  2KGC A;  2PEO A;  2KW2 A;  1X3O A;  2K0D X;  3B4Q A;  2N5I A;  3CD6 P;  3WBH A;  1Q7Y Q;  2Z45 A;  2WPT A;  2QA4 P;  3EJE A;  4HKG A;  2P9X A;  3G71 P;  2L0Q A;  5EW5 E;  2N6Y A;  1KQS O;  4BPG A;  2K94 A;  4BPH A;  4IZ6 A;  3H4E A;  1AF8 A;  1F80 D;  1EMV A;  2CWO A;  1D1D A;  2CG5 B;  4U0C A;  1NJI Q;  4H2X C;  2LTE A;  1M90 Q;  2EHS A;  2M8N A;  1Z6M A;  4UHP B;  2LKI A;  3CCM P;  3CCV P;  4U0D A;  1QVF O;  3DS3 A;  5HGO A;  1QRJ A;  2OTJ P;  3CE7 A;  1A8O A;  5F2N A;  5EJD A;  1DNY A;  1A43 A;  1BXI A;  2OAR A;  2KOQ A;  2K2Q A;  2EFJ A;  2N50 A;  2CGQ A;  1GPJ A;  2MVV A;  3CCU P;  2N5H A;  4GR6 A;  3G29 A;  5F2K A;  2FVA A;  1MZ8 A;  2GZG A;  3H47 A;  2XZ1 C;  3DTJ A;  1T8K A;  3G4S P;  2CQ8 A;  4PH1 A;  2GZE A;  2FQ1 A;  2MVU A;  2ONT A;  3U43 A;  3G26 A;  3CC2 P;  1IMP A;  3E2D A;  1NQ4 A;  4PH0 A;  4XRO A;  1VQ8 P;  4U0A A;  1HQB A;  7CEI A;  3I56 P;  2PEQ A;  2LOL A;  3NY7 B;  3CCR P;  2VLP A;  4PXH B;  3CCS P;  2FAD A;  1KD1 Q;  3CME P;  1YJW P;  2LF4 A;  4F37 A;  1IMQ A;  4BPF A;  1K9M Q;  2QNW A;  1Q81 Q;  2PEN A;  2KGD A;  2VLQ A;  1EIA A;  4COP A;  3CC4 P;  3HZQ A;  2OTL P;  2FAC A;  1Q86 Q;  2AFD A;  2EHT A;  1JJ2 O;  3GJN A;  2M5R A;  1L0H A;  2X2B A;  1K30 A;  1K73 Q;  3G1G A;  2KOO A;  5HVC A;  4NEO A;  1VQO P;  1UNK A;  2GZI A;  2JYG A;  1VQK P;  2FQ2 A;  2L22 A;  2KOR A;  3DS5 A;  3RG6 C;  2GZF A;  2KG8 A;  2LML A;  1ZNV A;  2K0X A;  1FR2 A;  1GXG A;  1IUQ A;  2EIA A;  4H2Y C;  3CCJ P;  2ROQ A;  3P05 A;  2KOD A;  3M1M A;  4XFX A;  2XXM A;  2MY5 A;  2AF8 A;  2JU2 A;  4COC A;  5KP7 B;  4PWV B;  3CCQ P;  1YHQ P;  1VQN P;  4XFZ A;  1VQM P;  2N6Z A;  4H2W C;  1M74 A;  2LIW A;  1VQ9 P;  4IPY A;  3G0V A;  4QKO A;  5F2O A;  3OW2 O;  3CCE P;  2PNG A;  2EG5 A;  1L0I A;  2KR5 A;  1HY8 A;  1VHN A;  2FQ0 A;  3CPW O;  2MF4 A;  1Q82 Q;  1EOQ A;  2LPK A;  2JQ4 A;  1ACP A;  1UJZ A;  2XV6 A;  3VRL C;  2JGP A;  3LMO A;  2CNR A;  2K92 A;  3DS1 A;  2M8P A;  5KP6 B;  3DS4 A;  2VLO A;  4DG9 A;  2BHV A;  4U0E A;  4U0F A;  2GDW A;  2XT1 A;  2FAE A;  1S72 P;  1BAJ A;  2K93 A;  2KG9 A;  3CMA P;  4U0B A;  2K0Y A;  2NO8 A;  1AUM A;  5BS1 A;  5HGM A;  1VQ5 P;  1GXH A;  2DGY A;  1VQ4 P;  2QEX P;  2ERH A;  3G6E P;  4QNB A;  1YIJ P;  3Q20 A;  1ZMB A;  2KG6 A;  4WYM A;  3NTE A;  1VKU A;  5BS2 A;  2Z44 A;  2M8L A;  3G21 A;  3HYB A;  1VQP P;  2GYK A;  2PEJ A;  4M0I A;  2MD9 A;  5JPA A;  2L4B A;  3GKL C;  2GDY A;  3B5I A;  2N98 A;  3GZL A;  2KOP A;  1W2B O;  2JBG A;  1KC8 Q;  3RG2 A;  1DV5 A;  2L6E A;  2E1M A;  5HV8 A;  2KWL A;  1M6N A;  1YI2 P;  2JO0 A;  3DPH A;  2JB0 A;  1M6E X;  3GZM A;  3CXC O;  2GZJ A;  5HGN A;  3H0D A;  1N8R Q;  1VQL P;  2PEM A;  4XRQ A;  1RO2 A;  3G1I A;  2AFE A;  3MGE A;  4GR2 A;  2AVA A;  3DS0 A;  1E6J P;  2FVE A;  2KOS A;  3CCL P;  2FVF A;  2VSQ A;  3EJD A;  2JYL A;  2MR8 A;  1QVG O;  5I4T G;  2XZ0 D;  2K5X A;  5KP8 B;  2BUO A;  2DNW A;  2PEI A;  1VQ6 P;  1K8A Q;  2PY8 A;  1KLP A;  3LRY A;  1OR5 A;  2Z46 A;  2JU1 A;  3CC7 P;  1CEI A;  1E0H A;  3EJB A;  5HGL A;  2VLN A;  2JAZ A;  5DCK A;  1AYI A; 
#chains in the Genus database with same CATH homology
 2LML A;  2K0X A;  2LIU A;  4R0M A;  4H2Y C;  2FVA A;  2MR7 A;  2GDX A;  2ROQ A;  5CZD B;  2LL8 A;  2KGE A;  2FHS C;  2KGA A;  2MD9 A;  4MRT C;  4CA3 A;  2L9F A;  2XZ1 C;  2L4B A;  2MY5 A;  2AF8 A;  1T8K A;  2GDY A;  2JU2 A;  2N98 A;  2CQ8 A;  5KP7 B;  3GZL A;  2KGC A;  4PWV B;  2FQ1 A;  2KOP A;  2KW2 A;  1X3O A;  2MVU A;  3RG2 A;  1DV5 A;  2N5I A;  2N6Z A;  4H2W C;  2LIW A;  5HV8 A;  2KWL A;  1NQ4 A;  3GZM A;  1HQB A;  2PNG A;  1L0I A;  2KR5 A;  3EJE A;  1HY8 A;  4HKG A;  2LOL A;  2FQ0 A;  2MF4 A;  3NY7 B;  2LPK A;  2JQ4 A;  1ACP A;  2L0Q A;  2JGP A;  3LMO A;  2N6Y A;  2CNR A;  4BPG A;  4PXH B;  2FAD A;  2K92 A;  2K94 A;  4BPH A;  2AFE A;  5KP6 B;  4IZ6 A;  1AF8 A;  4BPF A;  1F80 D;  2QNW A;  2AVA A;  4DG9 A;  2FVE A;  2CG5 B;  2KGD A;  2GDW A;  2KOS A;  4H2X C;  2FAE A;  2LTE A;  2EHS A;  2FVF A;  2VSQ A;  2K93 A;  2FAC A;  2KG9 A;  3EJD A;  2LKI A;  2AFD A;  2EHT A;  2MR8 A;  2K0Y A;  2XZ0 D;  2M5R A;  1L0H A;  2X2B A;  3CE7 A;  5KP8 B;  2KOO A;  2DNW A;  5EJD A;  5HVC A;  4NEO A;  1KLP A;  1DNY A;  1OR5 A;  2JU1 A;  2KG6 A;  2KOQ A;  2FQ2 A;  2K2Q A;  2L22 A;  2N50 A;  1VKU A;  2CGQ A;  3EJB A;  2MVV A;  2N5H A;  2KOR A;  2KG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...