2CGQA

A putative acyl carrier protein(rv0033) from mycobacterium tuberculosis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
AMEEAINATIQRILRTDRGITANQVLVDDLGFDSLKLFQLITELEDEFDIAISFRDAQNIKTVGDVYTSVAVWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords ACYL CARRIER PROTEIN ACPA
publication title The Structure of a Putative Acyl Carrier Protein (Rv0033) from Mycobacterium Tuberculosis
rcsb
source organism Mycobacterium tuberculosis
total genus 25
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2cgqA00
2L0QA 4H2WC 2KOQA 4PWVB 2EHSA 2K94A 2L22A 2N6YA 2N5IA 2KW2A 5CZDB 2X2BA 2KG9A 2N50A 2MR8A 2LTEA 2PNGA 1L0HA 2K93A 2N6ZA 2KG8A 4BPGA 1ACPA 2KGEA 2VSQA 1DNYA 2GDWA 2LIUA 5HVCA 3LMOA 3EJDA 1HY8A 2MF4A 2JU2A 2L9FA 2N98A 2FQ0A 2K0YA 4H2XC 2N5HA 4HKGA 3GZLA 5KP7B 2KG6A 3EJEA 2XZ1C 2KGAA 2KOOA 2MVUA 1T8KA 1X3OA 2K2QA 5KP8B 1VKUA 1F80D 2MD9A 1KLPA 2CQ8A 2K0XA 2FVAA 2EHTA 2JU1A 2KOSA 5EJDA 2AF8A 2LOLA 4CA3A 2LPKA 4PXHB 2MY5A 2DNWA 1L0IA 2GDYA 2GDXA 2QNWA 5HV8A 2LIWA 2AVAA 4DG9A 2KORA 4BPHA 2FVFA 3RG2A 1AF8A 3EJBA 2FHSC 2KGCA 2FQ1A 2K92A 4H2YC 1OR5A 2AFDA 2M5RA 3NY7B 2KGDA 2KWLA 3CE7A 4NEOA 2LMLA 2FADA 4R0MA 5KP6B 2KOPA 2FAEA 2JQ4A 2CNRA 2JGPA 4IZ6A 2MR7A 2CG5B 3GZMA 2LKIA 2L4BA 1NQ4A 2XZ0D 1HQBA 2FVEA 4MRTC 2FACA 1DV5A 2ROQA 2AFEA 4BPFA 2CGQA 2KR5A 2MVVA 2FQ2A 2LL8A
chains in the Genus database with same CATH superfamily
5F2KA 2KOQA 3WBHA 2K94A 2N50A 2LTEA 1Q7YQ 5BS1A 1UNKA 2K93A 2PY8A 3LMOA 3EJDA 4PH1A 2DGYA 2JO0A 5DCKA 3CCUP 3I56P 1EOQA 1NJIQ 5KP7B 1RO0A 2KOOA 2MVUA 1X3OA 2M8NA 4XROA 1YJ9P 2M8PA 3GKLC 2GZEA 2GZJA 1VQNP 2JU1A 2AF8A 2GZGA 1VQ9P 1RO2A 3CCRP 1UJZA 4PXHB 1W2BO 5HV8A 2LIWA 2AVAA 3DS2A 4DG9A 2OTJP 1M6NA 2FVFA 2Z45A 1IUQA 2FQ1A 2K92A 2AFDA 5KP6B 1BAJA 2JYGA 3CC2P 3CCVP 2PEIA 3LRYA 3I55P 4IZ6A 2MR7A 2GZFA 2XZ0D 2JB0A 1KQSO 1DV5A 2ROQA 2XV6A 4U0FA 2AFEA 2KODA 2CGQA 2KR5A 1K9MQ 2BHVA 1MZ8A 2PEJA 4U0EA 2LF4A 2Z46A 1BXIA 3U43A 2L0QA 4H2WC 2JAZA 4XFYA 2EHSA 2N5IA 2L22A 1GXGA 3B5IA 2X2BA 1AUMA 5F2OA 3CCJP 2VLPA 4COPA 3MGEA 2XXMA 4BPGA 2EFJA 2QA4P 2KGEA 3DS1A 1JJ2O 2LIUA 1HY8A 2MF4A 3G1IA 1VQOP 1IMPA 2OARA 2N98A 2PEMA 2FQ0A 3G6EP 3GZLA 2KG6A 4IPYA 2OTLP 2KGAA 2VLQA 3H0DA 1YIJP 1T8KA 2K2QA 5KP8B 1VKUA 1N8RQ 2CQ8A 2EHTA 2KOSA 5EJDA 1M90Q 3B4QA 3DS5A 1D1DA 2EG5A 2LPKA 2MY5A 2PENA 1KD1Q 1AYIA 2L6EA 3CC7P 1M1KQ 3G21A 3CCMP 1AF8A 2VLNA 3G0VA 4H2YC 1GXHA 1OR5A 1A43A 3Q20A 1YHQP 3HZQA 2M5RA 2KGDA 3CE7A 3G28A 4NEOA 1EMVA 2FADA 1YITP 2JQ4A 4F37A 2GZIA 1VQLP 1NQ4A 1QRJA 2FACA 3CCEP 3H4EA 3E2DA 3CCQP 2MVVA 4U0DA 2BUOA 3NTEA 5CZDB 2N6YA 2KW2A 3G29A 3CMAP 4XRQA 2KG9A 3CCLP 3G4SP 2P9XA 2XT1A 2PNGA 2N6ZA 2KG8A 1ACPA 3G1GA 1YJWP 1DNYA 2GDWA 5HVCA 1VQ5P 2JU2A 2L9FA 1VQ8P 2GYKA 2K0YA 1YI2P 1M74A 4H2XC 2N5HA 1Q82Q 4HKGA 1KC8Q 4U0BA 2XZ1C 3VRLC 2MD9A 1M6EX 3DS0A 1RNIA 2FVAA 4XFZA 1YJNP 4QKOA 3DS4A 1VHNA 5HGMA 2GDYA 2QNWA 4QNBA 3HYBA 2KORA 4BPHA 1VQPP 2EIAA 3EJBA 2KGCA 1GPJA 4UHPB 2KWLA 1ZMBA 4R0MA 2K5XA 2FAEA 3P05A 4GR6A 1QVGO 2NO8A 2PEOA 2LKIA 1VQKP 1HQBA 5EW5E 2ERHA 2FVEA 4MRTC 1S72P 4BPFA 7CEIA 1CEIA 1VQ7P 1VQMP 3CD6P 2LL8A 4PWVB 4PH0A 3M1MA 2QEXP 3CXCO 2MR8A 4U0CA 2ONTA 2E1MA 2PEKA 1E0HA 1L0HA 3DTJA 2VLOA 5HGOA 2JYLA 5I4TG 2VSQA 4U0AA 4WYMA 1ZNVA 3DS3A 1FR2A 1IMQA 1VQ6P 3G26A 3EJEA 2Z44A 5HGLA 3OW2O 1F80D 3G71P 1K8AQ 1KLPA 2K0XA 3H47A 1A8OA 2CWOA 2JBGA 5F2NA 3RG6C 2LOLA 3CMEP 3DPHA 4CA3A 3CC4P 2DNWA 1L0IA 2GDXA 1Q86Q 5HGNA 1Q81Q 3RG2A 1Z6MA 1K30A 5JPAA 2FHSC 1QVFO 3NY7B 5BS2A 2LMLA 2KOPA 4COCA 3CCSP 2CNRA 2JGPA 2M8LA 2CG5B 3GZMA 2L4BA 3GJNA 4XFXA 2K0DX 2PEQA 1E6JP 4GR2A 1K73Q 3CPWO 1VQ4P 2WPTA 4M0IA 2FQ2A 1EIAA
chains in the Genus database with same CATH topology
2L0QA 4H2WC 2KOQA 4PWVB 2EHSA 2K94A 2L22A 2N6YA 2N5IA 2KW2A 5CZDB 2X2BA 2KG9A 2N50A 2MR8A 2LTEA 2PNGA 1L0HA 2K93A 2N6ZA 2KG8A 4BPGA 1ACPA 2KGEA 2VSQA 1DNYA 2GDWA 2LIUA 5HVCA 3LMOA 3EJDA 1HY8A 2MF4A 2JU2A 2L9FA 2N98A 2FQ0A 2K0YA 4H2XC 2N5HA 4HKGA 3GZLA 5KP7B 2KG6A 3EJEA 2XZ1C 2KGAA 2KOOA 2MVUA 1T8KA 1X3OA 2K2QA 5KP8B 1VKUA 1F80D 2MD9A 1KLPA 2CQ8A 2K0XA 2FVAA 2EHTA 2JU1A 2KOSA 5EJDA 2AF8A 2LOLA 4CA3A 2LPKA 4PXHB 2MY5A 2DNWA 1L0IA 2GDYA 2GDXA 2QNWA 5HV8A 2LIWA 2AVAA 4DG9A 2KORA 4BPHA 2FVFA 3RG2A 1AF8A 3EJBA 2FHSC 2KGCA 2FQ1A 2K92A 4H2YC 1OR5A 2AFDA 2M5RA 3NY7B 2KGDA 2KWLA 3CE7A 4NEOA 2LMLA 2FADA 4R0MA 5KP6B 2KOPA 2FAEA 2JQ4A 2CNRA 2JGPA 4IZ6A 2MR7A 2CG5B 3GZMA 2LKIA 2L4BA 1NQ4A 2XZ0D 1HQBA 2FVEA 4MRTC 2FACA 1DV5A 2ROQA 2AFEA 4BPFA 2CGQA 2KR5A 2MVVA 2FQ2A 2LL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0Q A;  4H2W C;  2KOQ A;  4PWV B;  2EHS A;  2K94 A;  2L22 A;  2N6Y A;  2N5I A;  2KW2 A;  5CZD B;  2X2B A;  2KG9 A;  2N50 A;  2MR8 A;  2LTE A;  2PNG A;  1L0H A;  2K93 A;  2N6Z A;  2KG8 A;  4BPG A;  1ACP A;  2KGE A;  2VSQ A;  1DNY A;  2GDW A;  2LIU A;  5HVC A;  3LMO A;  3EJD A;  1HY8 A;  2MF4 A;  2JU2 A;  2L9F A;  2N98 A;  2FQ0 A;  2K0Y A;  4H2X C;  2N5H A;  4HKG A;  3GZL A;  5KP7 B;  2KG6 A;  3EJE A;  2XZ1 C;  2KGA A;  2KOO A;  2MVU A;  1T8K A;  1X3O A;  2K2Q A;  5KP8 B;  1VKU A;  1F80 D;  2MD9 A;  1KLP A;  2CQ8 A;  2K0X A;  2FVA A;  2EHT A;  2JU1 A;  2KOS A;  5EJD A;  2AF8 A;  2LOL A;  4CA3 A;  2LPK A;  4PXH B;  2MY5 A;  2DNW A;  1L0I A;  2GDY A;  2GDX A;  2QNW A;  5HV8 A;  2LIW A;  2AVA A;  4DG9 A;  2KOR A;  4BPH A;  2FVF A;  3RG2 A;  1AF8 A;  3EJB A;  2FHS C;  2KGC A;  2FQ1 A;  2K92 A;  4H2Y C;  1OR5 A;  2AFD A;  2M5R A;  3NY7 B;  2KGD A;  2KWL A;  3CE7 A;  4NEO A;  2LML A;  2FAD A;  4R0M A;  5KP6 B;  2KOP A;  2FAE A;  2JQ4 A;  2CNR A;  2JGP A;  4IZ6 A;  2MR7 A;  2CG5 B;  3GZM A;  2LKI A;  2L4B A;  1NQ4 A;  2XZ0 D;  1HQB A;  2FVE A;  4MRT C;  2FAC A;  1DV5 A;  2ROQ A;  2AFE A;  4BPF A;  2CGQ A;  2KR5 A;  2MVV A;  2FQ2 A;  2LL8 A; 
#chains in the Genus database with same CATH topology
 5F2K A;  2KOQ A;  3WBH A;  2K94 A;  2N50 A;  2LTE A;  1Q7Y Q;  5BS1 A;  1UNK A;  2K93 A;  2PY8 A;  3LMO A;  3EJD A;  4PH1 A;  2DGY A;  2JO0 A;  5DCK A;  3CCU P;  3I56 P;  1EOQ A;  1NJI Q;  5KP7 B;  1RO0 A;  2KOO A;  2MVU A;  1X3O A;  2M8N A;  4XRO A;  1YJ9 P;  2M8P A;  3GKL C;  2GZE A;  2GZJ A;  1VQN P;  2JU1 A;  2AF8 A;  2GZG A;  1VQ9 P;  1RO2 A;  3CCR P;  1UJZ A;  4PXH B;  1W2B O;  5HV8 A;  2LIW A;  2AVA A;  3DS2 A;  4DG9 A;  2OTJ P;  1M6N A;  2FVF A;  2Z45 A;  1IUQ A;  2FQ1 A;  2K92 A;  2AFD A;  5KP6 B;  1BAJ A;  2JYG A;  3CC2 P;  3CCV P;  2PEI A;  3LRY A;  3I55 P;  4IZ6 A;  2MR7 A;  2GZF A;  2XZ0 D;  2JB0 A;  1KQS O;  1DV5 A;  2ROQ A;  2XV6 A;  4U0F A;  2AFE A;  2KOD A;  2CGQ A;  2KR5 A;  1K9M Q;  2BHV A;  1MZ8 A;  2PEJ A;  4U0E A;  2LF4 A;  2Z46 A;  1BXI A;  3U43 A;  2L0Q A;  4H2W C;  2JAZ A;  4XFY A;  2EHS A;  2N5I A;  2L22 A;  1GXG A;  3B5I A;  2X2B A;  1AUM A;  5F2O A;  3CCJ P;  2VLP A;  4COP A;  3MGE A;  2XXM A;  4BPG A;  2EFJ A;  2QA4 P;  2KGE A;  3DS1 A;  1JJ2 O;  2LIU A;  1HY8 A;  2MF4 A;  3G1I A;  1VQO P;  1IMP A;  2OAR A;  2N98 A;  2PEM A;  2FQ0 A;  3G6E P;  3GZL A;  2KG6 A;  4IPY A;  2OTL P;  2KGA A;  2VLQ A;  3H0D A;  1YIJ P;  1T8K A;  2K2Q A;  5KP8 B;  1VKU A;  1N8R Q;  2CQ8 A;  2EHT A;  2KOS A;  5EJD A;  1M90 Q;  3B4Q A;  3DS5 A;  1D1D A;  2EG5 A;  2LPK A;  2MY5 A;  2PEN A;  1KD1 Q;  1AYI A;  2L6E A;  3CC7 P;  1M1K Q;  3G21 A;  3CCM P;  1AF8 A;  2VLN A;  3G0V A;  4H2Y C;  1GXH A;  1OR5 A;  1A43 A;  3Q20 A;  1YHQ P;  3HZQ A;  2M5R A;  2KGD A;  3CE7 A;  3G28 A;  4NEO A;  1EMV A;  2FAD A;  1YIT P;  2JQ4 A;  4F37 A;  2GZI A;  1VQL P;  1NQ4 A;  1QRJ A;  2FAC A;  3CCE P;  3H4E A;  3E2D A;  3CCQ P;  2MVV A;  4U0D A;  2BUO A;  3NTE A;  5CZD B;  2N6Y A;  2KW2 A;  3G29 A;  3CMA P;  4XRQ A;  2KG9 A;  3CCL P;  3G4S P;  2P9X A;  2XT1 A;  2PNG A;  2N6Z A;  2KG8 A;  1ACP A;  3G1G A;  1YJW P;  1DNY A;  2GDW A;  5HVC A;  1VQ5 P;  2JU2 A;  2L9F A;  1VQ8 P;  2GYK A;  2K0Y A;  1YI2 P;  1M74 A;  4H2X C;  2N5H A;  1Q82 Q;  4HKG A;  1KC8 Q;  4U0B A;  2XZ1 C;  3VRL C;  2MD9 A;  1M6E X;  3DS0 A;  1RNI A;  2FVA A;  4XFZ A;  1YJN P;  4QKO A;  3DS4 A;  1VHN A;  5HGM A;  2GDY A;  2QNW A;  4QNB A;  3HYB A;  2KOR A;  4BPH A;  1VQP P;  2EIA A;  3EJB A;  2KGC A;  1GPJ A;  4UHP B;  2KWL A;  1ZMB A;  4R0M A;  2K5X A;  2FAE A;  3P05 A;  4GR6 A;  1QVG O;  2NO8 A;  2PEO A;  2LKI A;  1VQK P;  1HQB A;  5EW5 E;  2ERH A;  2FVE A;  4MRT C;  1S72 P;  4BPF A;  7CEI A;  1CEI A;  1VQ7 P;  1VQM P;  3CD6 P;  2LL8 A;  4PWV B;  4PH0 A;  3M1M A;  2QEX P;  3CXC O;  2MR8 A;  4U0C A;  2ONT A;  2E1M A;  2PEK A;  1E0H A;  1L0H A;  3DTJ A;  2VLO A;  5HGO A;  2JYL A;  5I4T G;  2VSQ A;  4U0A A;  4WYM A;  1ZNV A;  3DS3 A;  1FR2 A;  1IMQ A;  1VQ6 P;  3G26 A;  3EJE A;  2Z44 A;  5HGL A;  3OW2 O;  1F80 D;  3G71 P;  1K8A Q;  1KLP A;  2K0X A;  3H47 A;  1A8O A;  2CWO A;  2JBG A;  5F2N A;  3RG6 C;  2LOL A;  3CME P;  3DPH A;  4CA3 A;  3CC4 P;  2DNW A;  1L0I A;  2GDX A;  1Q86 Q;  5HGN A;  1Q81 Q;  3RG2 A;  1Z6M A;  1K30 A;  5JPA A;  2FHS C;  1QVF O;  3NY7 B;  5BS2 A;  2LML A;  2KOP A;  4COC A;  3CCS P;  2CNR A;  2JGP A;  2M8L A;  2CG5 B;  3GZM A;  2L4B A;  3GJN A;  4XFX A;  2K0D X;  2PEQ A;  1E6J P;  4GR2 A;  1K73 Q;  3CPW O;  1VQ4 P;  2WPT A;  4M0I A;  2FQ2 A;  1EIA A; 
#chains in the Genus database with same CATH homology
 2L0Q A;  4H2W C;  2KOQ A;  4PWV B;  2EHS A;  2K94 A;  2L22 A;  2N6Y A;  2N5I A;  2KW2 A;  5CZD B;  2X2B A;  2KG9 A;  2N50 A;  2MR8 A;  2LTE A;  2PNG A;  1L0H A;  2K93 A;  2N6Z A;  2KG8 A;  4BPG A;  1ACP A;  2KGE A;  2VSQ A;  1DNY A;  2GDW A;  2LIU A;  5HVC A;  3LMO A;  3EJD A;  1HY8 A;  2MF4 A;  2JU2 A;  2L9F A;  2N98 A;  2FQ0 A;  2K0Y A;  4H2X C;  2N5H A;  4HKG A;  3GZL A;  5KP7 B;  2KG6 A;  3EJE A;  2XZ1 C;  2KGA A;  2KOO A;  2MVU A;  1T8K A;  1X3O A;  2K2Q A;  5KP8 B;  1VKU A;  1F80 D;  2MD9 A;  1KLP A;  2CQ8 A;  2K0X A;  2FVA A;  2EHT A;  2JU1 A;  2KOS A;  5EJD A;  2AF8 A;  2LOL A;  4CA3 A;  2LPK A;  4PXH B;  2MY5 A;  2DNW A;  1L0I A;  2GDY A;  2GDX A;  2QNW A;  5HV8 A;  2LIW A;  2AVA A;  4DG9 A;  2KOR A;  4BPH A;  2FVF A;  3RG2 A;  1AF8 A;  3EJB A;  2FHS C;  2KGC A;  2FQ1 A;  2K92 A;  4H2Y C;  1OR5 A;  2AFD A;  2M5R A;  3NY7 B;  2KGD A;  2KWL A;  3CE7 A;  4NEO A;  2LML A;  2FAD A;  4R0M A;  5KP6 B;  2KOP A;  2FAE A;  2JQ4 A;  2CNR A;  2JGP A;  4IZ6 A;  2MR7 A;  2CG5 B;  3GZM A;  2LKI A;  2L4B A;  1NQ4 A;  2XZ0 D;  1HQB A;  2FVE A;  4MRT C;  2FAC A;  1DV5 A;  2ROQ A;  2AFE A;  4BPF A;  2CGQ A;  2KR5 A;  2MVV A;  2FQ2 A;  2LL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...