1RNIA

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
210
Chain Sequence
SSERIRYAKWFLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGLVILDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords ORF904
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
total genus 68
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1rniA01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1rniA03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1rniA02
1RO2A 1RO0A 3M1MA 1RNIA
chains in the Genus database with same CATH superfamily
3FQMA 3I55P 2X2BA 1W2BZ 3S15I 1YITZ 5IT9b 1UNKA 1BXIA 3CME1 4NBEA 2FQ0A 3CC4Z 4NH1C 4E32A 2K0XA 3G1IA 3NY7B 1M1KQ 2JBGA 2K5RA 5BS1A 3VMHA 3HOXI 2K93A 3VTNA 3I4NI 3LRYA 2O53A 1VQPZ 2N5IA 5IT9f 2PEIA 1K8AQ 2E9HA 2GDWA 1YI2P 1JJ2Z 1VQ6Z 4HGZA 4AYBA 1KRLA 4HKGA 1YIT1 1IUQA 3CC4P 3H47A 1Q7Y1 3I561 2Z45A 1K731 2P28A 3CCV1 3VB9A 2K0YA 2QNWA 2KGCA 1YIJZ 4MRTC 2ZAEB 2OZKA 1VQ4Z 1Z01A 3CCSZ 4HH4A 1YJWZ 3HOWI 4A3CI 2LIUA 1QVFY 5C44I 5DCKA 1QVFZ 1VQPP 4U0EA 4MONA 1YJNZ 4QTUA 4E33A 3RG6C 1VQ6P 2JB0A 3S1MI 3CCM1 3CC71 1E6JP 4PH0A 3DS1A 2L6EA 2PK7A 1JWHC 3QWUA 3K7AI 3IX0A 2EIAA 4QKOA 1YIJP 1K30A 2JIRA 3CCSP 1QF8A 1KQSO 2DGYA 5JPAA 5F2NA 1Z03A 2PNGA 2XZ0D 2JGPA 3WBHA 3CCEZ 1ZMBA 4E2YA 3CCRZ 2LEXA 3HOUI 2KGDA 3MZKB 1VQ91 1YJ9Z 3GTGI 2B63I 1Z02A 4RVDA 2K92A 4GR6A 1TWAI 1N8R1 1SFOI 1VQMZ 3DS4A 4A3EI 2JO0A 1ML8A 5T67A 4DK1A 1KC81 2YU9I 1M74A 3B5IA 3EJEA 2L0QA 3VRLC 3PO2I 2Z46A 2NAPA 2AKLA 2KOSA 3GTJI 1Q862 2VLNA 4XFYA 1KD1Q 3EERA 1EIAA 1KQSY 1LQLA 1YJ9P 2M48A 3G4S1 3Q20A 1ZH1A 2KI7B 2E2HI 2KOOA 2KR5A 1ACPA 2VF1A 3CCJZ 1VQMP 4NEOA 1QXFA 2JIOA 4NOZA 3CE7A 1VQ7P 2GTHA 2OTJZ 4U0BA 1Y1VI 2CQ8A 2LTEA 3ESWA 3F3PC 2R6MA 2R92I 2QRDB 1BAJA 2KGEA 2GZEA 5HGLA 3GZMA 1Q86Q 4H2YC 3CMA1 2PEJA 5EW5E 1NJI2 2BHVA 4XROA 3DPHA 3OW2Y 2GZFA 3OW2Z 3NH4A 1RNIA 1GPJA 1VQO1 1Z6MA 1WJ2A 2Y0SA 3CXCO 3CCJP 2QKDA 2VPYA 2XXMA 2FACA 2IV2X 1MZ8A 3E2DA 1E0HA 3CCQ1 3H0GI 4MD9A 2OTJP 1AYIA 3KIHA 1VKUA 4EWCA 3IFUA 2W03A 3P5JB 1QVGZ 3CD61 1W2BO 2GDXA 4X6AI 3MONA 2M5RA 2K0DX 3HOYI 2NO8A 2OOYB 3GZLA 3NDIA 1YUAA 2CNRA 4BBRI 4E2XA 5C4XI 1Q821 5BS2A 4BBSI 2LFUA 4BXXI 3DS2A 2KGAA 2JA6I 4HGYA 4BY1I 3CMEP 4XFZA 4MRIA 4QNBA 1Q811 1K9M1 3I56Z 3S1NI 3EJBA 4NBCA 3CCVZ 3DS5A 1TFIA 2HU9A 2HF1A 2PY8A 2GTIA 2FVEA 2P9XA 1TWGI 2VLQA 1A8OA 4U0DA 2KWLA 3RZDI 3TE5B 2WB1A 3S2HI 1TWCI 3GTPI 2FHSC 3EJDA 3CCMZ 5I4TG 3CC7Z 1YITP 1VQ8Z 2PEQA 1QYPA 4IZ6A 3I56P 3I07A 1IMQA 2R93I 3CCVP 2QA41 2K3RA 4S1TA 5F2OA 4PXHB 2JIMA 3GTOI 3F3FC 1NP6A 1TWHI 3M4OI 2VPXA 3GKLC 2F4OA 4A3KI 5LL6f 3LMOA 3FKII 2FVFA 1EMVA 1S7MA 2YADA 2JA5I 3GTMI 2ERHA 1TWFI 3CCU1 2AYDA 3CC7P 5D1OA 4TNUA 1VQ9Z 3GTQI 1VQ81 2LIWA 2KW2A 2QLVB 3NH8A 1X0TA 5AN9F 2JIPA 1ZB9A 1HQBA 2JU1A 5C3EI 2EHSA 1L1OC 2JUBA 2Q51A 2OTL1 2FQ1A 4A3II 1VQ4P 1L0HA 5CZDB 1YJWP 1NJI1 1M901 1VLAA 3CQZI 2JR6A 3NDJA 4H2WC 1YJNP 2GZIA 2K2QA 5D1PA 4A3DI 2M6NA 1KD12 4MD7A 4DGLA 1VQ9P 4E30A 2L22A 1WW9A 3G6E1 3G4SZ 5HGMA 4NBBA 3GJNA 5KP7B 4BPFA 1M1K1 1YHQ1 3S1QI 4A3GI 4F37A 2MR7A 3BG1B 1I3QI 1VQN1 1AUMA 2KOPA 2LPKA 2PM9A 4XX2A 1T8KA 2VPWA 3G0VA 4RS4A 3U43A 1FDIA 3G711 1K8A1 4Y7NI 1VQK1 5HGOA 1USPA 4E2WA 4A3JI 3CMAZ 3CCEP 3LUSA 2IZ3A 1AA6A 4NFRA 2RT9A 3CCRP 2ONTA 3T4NB 2AVAA 3G4SP 3J80b 4M0IA 2MVUA 4NBHA 1VQOZ 1KQSZ 4NB9A 2AF8A 3P05A 1RO4A 2VLOA 2NVYI 3D9XA 4A3MI 1YUKA 3M1MA 4E31A 2QEX1 3PO3I 1IMPA 2MD9A 2PENA 2V8IA 3GCFA 5FLMI 3CCQZ 2NVXI 1Q7Y2 1K9MQ 4COPA 2N6YA 2PEMA 3CD6Z 2XT1A 1RQFA 3CC21 7CEIA 4U0FA 4A3FI 3CMAP 3J80f 2V45A 3FQQA 3HYBA 2MR8A 3G21A 4DQYB 1K83I 4RV9A 1VQOP 2MVVA 1KLPA 5A2Qb 2MF4A 2JS4A 1Q16A 3D6WA 3DS3A 2DE6A 4XRQA 1DNYA 3CPWO 3CCQP 1VQL1 2KG9A 2P3YA 1FR2A 2CWOA 1Q7YQ 5F2KA 3CD6P 1HY8A 1F80D 1K73Q 2RBLA 2DNWA 1Y8CA 2L9FA 3J81f 2LMLA 4COCA 5A2Qf 2NVTI 2VSQA 2O4HA 3HZQA 5C4JI 1P9NA 2EFJA 2CGQA 2N6ZA 4GR2A 4UHPB 2R7ZI 2WPTA 4NBGA 3CCL1 1S721 2I3CA 1WIIA 2QA4Z 2M8LA 5KP6B 1SIWA 2Z44A 2VPZA 1D1DA 1JJ2O 1Y1VS 1Y1WI 2V3VA 4BPHA 3HKZA 1N8R2 2VUGA 2GYKA 3CXCY 3MZLB 5T64A 4U0CA 2JA8I 2K94A 1L0IA 1KC82 2Q4ZA 2KORA 2V8JA 3H0DA 4NB8A 3CCUZ 3MGEA 1VQ51 2RPRA 1W2BY 3I551 5KP8B 3S2DI 1QVFO 2QA4P 2F4MA 2JAZA 4CA3A 2OTLZ 2KPIA 1Q861 2JYLA 2BUOA 4DG9A 2XV6A 1N2FA 1N8RQ 4RVGA 3DS0A 4WYMA 1NQ4A 5HVCA 2KG8A 4A3LI 3H4EA 4MD8A 4RVFA 2FQ2A 2XZ1C 2PEKA 1KC8Q 3GKQA 1NUIA 3CCUP 2PMZA 1JJ2Y 2G2KA 3S14I 3G28A 1DL6A 3CCMP 3S1RI 1YI21 4A93I 1VQ8P 3G6EZ 3Q87A 3NH5A 2E2II 1M6EX 4R0MA 1YHQZ 3M3YI 3CC41 1I6HI 5FLXb 1VQNZ 3J7A4 2JA7I 2OTLP 4RVHA 1X3WA 3EEDA 1QRJA 3HOZI 3RG2A 2LIYA 2QREB 3G71Z 2N98A 1VQKZ 4BPGA 5IP7I 3IR7A 5IP9I 1VQP1 2MY5A 1PFTA 2N50A 5FLXf 5EJDA 3VMIA 1VQ61 3G6EP 1AF8A 4U0AA 1YHQP 2DE7A 2J6AA 1I50I 1VQNP 5T6BA 1RO2A 2LKIA 3BG0B 4NBAA 2QEXZ 1Q822 2GZGA 2OOXB 2WAQA 1YIJ1 4IPYA 2CG5B 1VQ41 3G71P 1M6NA 3CCS1 1YJW1 1VQKP 1Q812 1K9M2 3GTLI 3JAMb 2VLPA 3U50C 3CC2Z 5HGNA 2JNYA 2KODA 1YJN1 5D1OB 3GTMS 3RZOI 4CL1A 3VMGA 3HOVI 4QTTA 2IZ4A 3G29A 2QEXP 1Q82Q 2AFEA 1WZNA 4NBFA 1VQLZ 1EOQA 3JAMf 2LOLA 1A43A 1X3OA 2PEOA 1RO0A 2QRCB 1VQ7Z 2LF4A 3OW2O 1Q81Q 2K5XA 3CC2P 2M8NA 1K732 2DE5A 1GXGA 3KIFA 2ROQA 1R9TI 2EG5A 2BJOA 2E2JI 3CCE1 1DV5A 3CCR1 1CEIA 2L4BA 3J81b 4PH1A 2FAEA 1X3ZA 1YJ91 3S17I 2JIQA 3IF8A 2JU2A 2H85A 1QVGO 4MXUA 2LL8A 4Y52I 2E7ZA 3CCLZ 1S72Z 3I4MI 1VQLP 1UJZA 2GU2A 4XFXA 1VQM1 1WCMI 2M8PA 2JQ4A 1ZNVA 2KG6A 3GTKI 1OR5A 4PWVB 1USPB 1VQ71 2W04A 2NVQI 3TDHB 4E2ZA 2N5HA 2OARA 5CM2M 2V8KA 4H2XC 1M902 3H3VJ 2FADA 2GZJA 3DTJA 2VUMI 3S16I 1VQ5Z 3NFZA 2KOQA 4NBDA 1FDOA 4BY7I 3I55Z 3CMEZ 3G26A 3CCLP 1S72P 2AFDA 3CCJ1 2FVAA 3G1GA 3D2LA 3PO3S 5HV8A 2JMOA 2RHBA 1VHNA 1RLYA 2EGTA 1ZB8A 2QR1B 2OTJ1 1KD11 1M1K2 1QVGY 2RIQA 4A3BI 3NTEA 3CXCZ 1GXHA 2JYGA 3CPWY 4MH4A 3CPWZ 2EHTA 1NJIQ 2GDYA 1M90Q 3B4QA 1K8A2 2E1MA 1VQ5P 1YI2Z
chains in the Genus database with same CATH topology
3FQMA 3I55P 1W2BZ 3S15I 1YITZ 5IT9b 3CME1 4NBEA 3CC4Z 4NH1C 4E32A 3G1IA 1M1KQ 2K5RA 5BS1A 3VMHA 3HOXI 3VTNA 3I4NI 3LRYA 2O53A 1VQPZ 5IT9f 2PEIA 1K8AQ 2E9HA 1VQ6Z 1YI2P 1JJ2Z 4HGZA 4AYBA 1KRLA 1YIT1 1IUQA 3CC4P 3H47A 1Q7Y1 3I561 2Z45A 1K731 2P28A 3CCV1 3VB9A 1YIJZ 2ZAEB 2OZKA 1VQ4Z 1Z01A 3CCSZ 4HH4A 1YJWZ 3HOWI 4A3CI 1QVFY 5C44I 5DCKA 1QVFZ 1VQPP 4U0EA 4MONA 1YJNZ 4QTUA 4E33A 3RG6C 1VQ6P 3S1MI 3CCM1 3CC71 1E6JP 4PH0A 3DS1A 2L6EA 2PK7A 1JWHC 3QWUA 3K7AI 3IX0A 2EIAA 1YIJP 1K30A 3CCSP 1QF8A 1KQSO 2DGYA 5JPAA 5F2NA 1Z03A 3WBHA 3CCEZ 1ZMBA 4E2YA 3CCRZ 3HOUI 3MZKB 1VQ91 1YJ9Z 3GTGI 2B63I 1Z02A 4RVDA 4GR6A 1TWAI 1N8R1 1SFOI 1VQMZ 3DS4A 4A3EI 2JO0A 1ML8A 5T67A 4DK1A 1KC81 2YU9I 1M74A 3B5IA 3VRLC 3PO2I 2Z46A 2AKLA 3GTJI 1Q862 4XFYA 1KD1Q 3EERA 1EIAA 1KQSY 1LQLA 1YJ9P 2M48A 3G4S1 3Q20A 1ZH1A 2KI7B 2E2HI 2VF1A 3CCJZ 1VQMP 4NOZA 1VQ7P 2GTHA 2OTJZ 4U0BA 1Y1VI 3ESWA 3F3PC 2R6MA 2R92I 2QRDB 1BAJA 5HGLA 1Q86Q 3CMA1 2PEJA 1NJI2 2BHVA 4XROA 3DPHA 3OW2Y 3OW2Z 3NH4A 1RNIA 1VQO1 2Y0SA 3CXCO 3CCJP 2QKDA 2XXMA 3E2DA 3CCQ1 3H0GI 4MD9A 2OTJP 3KIHA 4EWCA 3IFUA 2W03A 3P5JB 1QVGZ 3CD61 1W2BO 4X6AI 3MONA 3HOYI 2OOYB 3NDIA 1YUAA 4BBRI 4E2XA 5C4XI 1Q821 5BS2A 4BBSI 2LFUA 4BXXI 3DS2A 2JA6I 4HGYA 4BY1I 3CMEP 4XFZA 4MRIA 4QNBA 1Q811 1K9M1 3I56Z 3S1NI 4NBCA 3CCVZ 3DS5A 1TFIA 2HU9A 2HF1A 2PY8A 2GTIA 2P9XA 1TWGI 1A8OA 4U0DA 3RZDI 3TE5B 2WB1A 3S2HI 1TWCI 3GTPI 3CCMZ 5I4TG 3CC7Z 1YITP 1VQ8Z 2PEQA 1QYPA 3I56P 3I07A 2R93I 3CCVP 2QA41 2K3RA 4S1TA 5F2OA 3GTOI 3F3FC 1NP6A 1TWHI 3M4OI 2F4OA 4A3KI 5LL6f 3FKII 1S7MA 2YADA 2JA5I 3GTMI 1TWFI 3CCU1 3CC7P 5D1OA 4TNUA 1VQ9Z 3GTQI 1VQ81 2QLVB 3NH8A 1X0TA 5AN9F 1ZB9A 5C3EI 2OTL1 1L1OC 2JUBA 2Q51A 4A3II 1VQ4P 1YJWP 1NJI1 1M901 1VLAA 3CQZI 2JR6A 3NDJA 1YJNP 5D1PA 4A3DI 2M6NA 1KD12 4MD7A 4DGLA 1VQ9P 4E30A 1WW9A 3G6E1 3G4SZ 5HGMA 4NBBA 1M1K1 1YHQ1 3S1QI 4A3GI 1VQN1 3BG1B 1I3QI 1AUMA 2PM9A 4XX2A 4RS4A 3G0VA 3G711 1K8A1 4Y7NI 1VQK1 5HGOA 1USPA 4E2WA 4A3JI 3CMAZ 3CCEP 3LUSA 2IZ3A 4NFRA 2RT9A 3CCRP 2ONTA 3T4NB 3G4SP 3J80b 4M0IA 4NBHA 1KQSZ 1VQOZ 4NB9A 1RO4A 3P05A 2NVYI 3D9XA 4A3MI 1YUKA 3M1MA 4E31A 2QEX1 3PO3I 2PENA 2V8IA 3GCFA 5FLMI 3CCQZ 2NVXI 1Q7Y2 1K9MQ 4COPA 2PEMA 3CD6Z 2XT1A 1RQFA 3CC21 4U0FA 4A3FI 3CMAP 3J80f 3FQQA 3HYBA 3G21A 4DQYB 1K83I 4RV9A 1VQOP 5A2Qb 2JS4A 3D6WA 3DS3A 2DE6A 4XRQA 3CPWO 3CCQP 1VQL1 2P3YA 2CWOA 1Q7YQ 5F2KA 3CD6P 1K73Q 2RBLA 3J81f 4COCA 5A2Qf 2NVTI 2O4HA 3HZQA 5C4JI 1P9NA 2EFJA 4GR2A 2R7ZI 4NBGA 3CCL1 1S721 2I3CA 1WIIA 2QA4Z 2M8LA 2Z44A 1D1DA 1JJ2O 1Y1VS 1Y1WI 3HKZA 1N8R2 2VUGA 3CXCY 3MZLB 5T64A 4U0CA 2JA8I 1KC82 2Q4ZA 2V8JA 3H0DA 4NB8A 3CCUZ 3MGEA 1VQ51 2RPRA 1W2BY 3I551 3S2DI 1QVFO 2QA4P 2F4MA 2OTLZ 2KPIA 1Q861 2JYLA 2BUOA 2XV6A 1N2FA 1N8RQ 4RVGA 3DS0A 4WYMA 4A3LI 3H4EA 4MD8A 4RVFA 2PEKA 1KC8Q 3GKQA 1NUIA 3CCUP 2PMZA 1JJ2Y 2G2KA 3S14I 3G28A 1DL6A 3CCMP 3S1RI 1YI21 4A93I 1VQ8P 3G6EZ 3Q87A 3NH5A 2E2II 1M6EX 1YHQZ 3M3YI 3CC41 1I6HI 5FLXb 1VQNZ 3J7A4 2JA7I 2OTLP 4RVHA 1X3WA 3EEDA 1QRJA 3HOZI 2LIYA 2QREB 3G71Z 1VQKZ 5IP7I 5IP9I 1VQP1 1PFTA 5FLXf 1VQ61 3VMIA 3G6EP 4U0AA 1YHQP 2DE7A 2J6AA 1I50I 1VQNP 5T6BA 1RO2A 3BG0B 4NBAA 2QEXZ 1Q822 2OOXB 2WAQA 1YIJ1 4IPYA 1VQ41 3G71P 1M6NA 3CCS1 1YJW1 1VQKP 1Q812 1K9M2 3GTLI 3JAMb 3U50C 3CC2Z 5HGNA 2JNYA 2KODA 1YJN1 5D1OB 3GTMS 3RZOI 4CL1A 3VMGA 3HOVI 4QTTA 2IZ4A 3G29A 2QEXP 1Q82Q 4NBFA 1VQLZ 1EOQA 3JAMf 1A43A 2PEOA 1RO0A 2QRCB 1VQ7Z 2LF4A 3OW2O 1Q81Q 3CC2P 2M8NA 1K732 2DE5A 3KIFA 1R9TI 2EG5A 2BJOA 2E2JI 3CCE1 3CCR1 3J81b 4PH1A 1X3ZA 1YJ91 3S17I 3IF8A 4MXUA 2H85A 1QVGO 4Y52I 3CCLZ 1S72Z 3I4MI 1VQLP 2GU2A 4XFXA 1VQM1 1WCMI 2M8PA 3GTKI 1VQ71 1USPB 2W04A 2NVQI 3TDHB 4E2ZA 2OARA 5CM2M 2V8KA 1M902 3H3VJ 3S16I 3DTJA 2VUMI 1VQ5Z 3NFZA 4NBDA 4BY7I 3I55Z 3CMEZ 3G26A 3CCLP 1S72P 3CCJ1 3G1GA 3PO3S 2JMOA 2RHBA 1RLYA 2EGTA 1ZB8A 2QR1B 2OTJ1 1KD11 1M1K2 1QVGY 2RIQA 4A3BI 3NTEA 3CXCZ 2JYGA 3CPWY 4MH4A 3CPWZ 1NJIQ 1M90Q 1K8A2 2E1MA 1VQ5P 1YI2Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RO2 A;  1RO0 A;  3M1M A;  1RNI A; 
#chains in the Genus database with same CATH topology
 3FQM A;  3I55 P;  2X2B A;  1W2B Z;  3S15 I;  1YIT Z;  5IT9 b;  1UNK A;  1BXI A;  3CME 1;  4NBE A;  2FQ0 A;  3CC4 Z;  4NH1 C;  4E32 A;  2K0X A;  3G1I A;  3NY7 B;  1M1K Q;  2JBG A;  2K5R A;  5BS1 A;  3VMH A;  3HOX I;  2K93 A;  3VTN A;  3I4N I;  3LRY A;  2O53 A;  1VQP Z;  2N5I A;  5IT9 f;  2PEI A;  1K8A Q;  2E9H A;  2GDW A;  1YI2 P;  1JJ2 Z;  1VQ6 Z;  4HGZ A;  4AYB A;  1KRL A;  4HKG A;  1YIT 1;  1IUQ A;  3CC4 P;  3H47 A;  1Q7Y 1;  3I56 1;  2Z45 A;  1K73 1;  2P28 A;  3CCV 1;  3VB9 A;  2K0Y A;  2QNW A;  2KGC A;  1YIJ Z;  4MRT C;  2ZAE B;  2OZK A;  1VQ4 Z;  1Z01 A;  3CCS Z;  4HH4 A;  1YJW Z;  3HOW I;  4A3C I;  2LIU A;  1QVF Y;  5C44 I;  5DCK A;  1QVF Z;  1VQP P;  4U0E A;  4MON A;  1YJN Z;  4QTU A;  4E33 A;  3RG6 C;  1VQ6 P;  2JB0 A;  3S1M I;  3CCM 1;  3CC7 1;  1E6J P;  4PH0 A;  3DS1 A;  2L6E A;  2PK7 A;  1JWH C;  3QWU A;  3K7A I;  3IX0 A;  2EIA A;  4QKO A;  1YIJ P;  1K30 A;  2JIR A;  3CCS P;  1QF8 A;  1KQS O;  2DGY A;  5JPA A;  5F2N A;  1Z03 A;  2PNG A;  2XZ0 D;  2JGP A;  3WBH A;  3CCE Z;  1ZMB A;  4E2Y A;  3CCR Z;  2LEX A;  3HOU I;  2KGD A;  3MZK B;  1VQ9 1;  1YJ9 Z;  3GTG I;  2B63 I;  1Z02 A;  4RVD A;  2K92 A;  4GR6 A;  1TWA I;  1N8R 1;  1SFO I;  1VQM Z;  3DS4 A;  4A3E I;  2JO0 A;  1ML8 A;  5T67 A;  4DK1 A;  1KC8 1;  2YU9 I;  1M74 A;  3B5I A;  3EJE A;  2L0Q A;  3VRL C;  3PO2 I;  2Z46 A;  2NAP A;  2AKL A;  2KOS A;  3GTJ I;  1Q86 2;  2VLN A;  4XFY A;  1KD1 Q;  3EER A;  1EIA A;  1KQS Y;  1LQL A;  1YJ9 P;  2M48 A;  3G4S 1;  3Q20 A;  1ZH1 A;  2KI7 B;  2E2H I;  2KOO A;  2KR5 A;  1ACP A;  2VF1 A;  3CCJ Z;  1VQM P;  4NEO A;  1QXF A;  2JIO A;  4NOZ A;  3CE7 A;  1VQ7 P;  2GTH A;  2OTJ Z;  4U0B A;  1Y1V I;  2CQ8 A;  2LTE A;  3ESW A;  3F3P C;  2R6M A;  2R92 I;  2QRD B;  1BAJ A;  2KGE A;  2GZE A;  5HGL A;  3GZM A;  1Q86 Q;  4H2Y C;  3CMA 1;  2PEJ A;  5EW5 E;  1NJI 2;  2BHV A;  4XRO A;  3DPH A;  3OW2 Y;  2GZF A;  3OW2 Z;  3NH4 A;  1RNI A;  1GPJ A;  1VQO 1;  1Z6M A;  1WJ2 A;  2Y0S A;  3CXC O;  3CCJ P;  2QKD A;  2VPY A;  2XXM A;  2FAC A;  2IV2 X;  1MZ8 A;  3E2D A;  1E0H A;  3CCQ 1;  3H0G I;  4MD9 A;  2OTJ P;  1AYI A;  3KIH A;  1VKU A;  4EWC A;  3IFU A;  2W03 A;  3P5J B;  1QVG Z;  3CD6 1;  1W2B O;  2GDX A;  4X6A I;  3MON A;  2M5R A;  2K0D X;  3HOY I;  2NO8 A;  2OOY B;  3GZL A;  3NDI A;  1YUA A;  2CNR A;  4BBR I;  4E2X A;  5C4X I;  1Q82 1;  5BS2 A;  4BBS I;  2LFU A;  4BXX I;  3DS2 A;  2KGA A;  2JA6 I;  4HGY A;  4BY1 I;  3CME P;  4XFZ A;  4MRI A;  4QNB A;  1Q81 1;  1K9M 1;  3I56 Z;  3S1N I;  3EJB A;  4NBC A;  3CCV Z;  3DS5 A;  1TFI A;  2HU9 A;  2HF1 A;  2PY8 A;  2GTI A;  2FVE A;  2P9X A;  1TWG I;  2VLQ A;  1A8O A;  4U0D A;  2KWL A;  3RZD I;  3TE5 B;  2WB1 A;  3S2H I;  1TWC I;  3GTP I;  2FHS C;  3EJD A;  3CCM Z;  5I4T G;  3CC7 Z;  1YIT P;  1VQ8 Z;  2PEQ A;  1QYP A;  4IZ6 A;  3I56 P;  3I07 A;  1IMQ A;  2R93 I;  3CCV P;  2QA4 1;  2K3R A;  4S1T A;  5F2O A;  4PXH B;  2JIM A;  3GTO I;  3F3F C;  1NP6 A;  1TWH I;  3M4O I;  2VPX A;  3GKL C;  2F4O A;  4A3K I;  5LL6 f;  3LMO A;  3FKI I;  2FVF A;  1EMV A;  1S7M A;  2YAD A;  2JA5 I;  3GTM I;  2ERH A;  1TWF I;  3CCU 1;  2AYD A;  3CC7 P;  5D1O A;  4TNU A;  1VQ9 Z;  3GTQ I;  1VQ8 1;  2LIW A;  2KW2 A;  2QLV B;  3NH8 A;  1X0T A;  5AN9 F;  2JIP A;  1ZB9 A;  1HQB A;  2JU1 A;  5C3E I;  2EHS A;  1L1O C;  2JUB A;  2Q51 A;  2OTL 1;  2FQ1 A;  4A3I I;  1VQ4 P;  1L0H A;  5CZD B;  1YJW P;  1NJI 1;  1M90 1;  1VLA A;  3CQZ I;  2JR6 A;  3NDJ A;  4H2W C;  1YJN P;  2GZI A;  2K2Q A;  5D1P A;  4A3D I;  2M6N A;  1KD1 2;  4MD7 A;  4DGL A;  1VQ9 P;  4E30 A;  2L22 A;  1WW9 A;  3G6E 1;  3G4S Z;  5HGM A;  4NBB A;  3GJN A;  5KP7 B;  4BPF A;  1M1K 1;  1YHQ 1;  3S1Q I;  4A3G I;  4F37 A;  2MR7 A;  3BG1 B;  1I3Q I;  1VQN 1;  1AUM A;  2KOP A;  2LPK A;  2PM9 A;  4XX2 A;  1T8K A;  2VPW A;  3G0V A;  4RS4 A;  3U43 A;  1FDI A;  3G71 1;  1K8A 1;  4Y7N I;  1VQK 1;  5HGO A;  1USP A;  4E2W A;  4A3J I;  3CMA Z;  3CCE P;  3LUS A;  2IZ3 A;  1AA6 A;  4NFR A;  2RT9 A;  3CCR P;  2ONT A;  3T4N B;  2AVA A;  3G4S P;  3J80 b;  4M0I A;  2MVU A;  4NBH A;  1VQO Z;  1KQS Z;  4NB9 A;  2AF8 A;  3P05 A;  1RO4 A;  2VLO A;  2NVY I;  3D9X A;  4A3M I;  1YUK A;  3M1M A;  4E31 A;  2QEX 1;  3PO3 I;  1IMP A;  2MD9 A;  2PEN A;  2V8I A;  3GCF A;  5FLM I;  3CCQ Z;  2NVX I;  1Q7Y 2;  1K9M Q;  4COP A;  2N6Y A;  2PEM A;  3CD6 Z;  2XT1 A;  1RQF A;  3CC2 1;  7CEI A;  4U0F A;  4A3F I;  3CMA P;  3J80 f;  2V45 A;  3FQQ A;  3HYB A;  2MR8 A;  3G21 A;  4DQY B;  1K83 I;  4RV9 A;  1VQO P;  2MVV A;  1KLP A;  5A2Q b;  2MF4 A;  2JS4 A;  1Q16 A;  3D6W A;  3DS3 A;  2DE6 A;  4XRQ A;  1DNY A;  3CPW O;  3CCQ P;  1VQL 1;  2KG9 A;  2P3Y A;  1FR2 A;  2CWO A;  1Q7Y Q;  5F2K A;  3CD6 P;  1HY8 A;  1F80 D;  1K73 Q;  2RBL A;  2DNW A;  1Y8C A;  2L9F A;  3J81 f;  2LML A;  4COC A;  5A2Q f;  2NVT I;  2VSQ A;  2O4H A;  3HZQ A;  5C4J I;  1P9N A;  2EFJ A;  2CGQ A;  2N6Z A;  4GR2 A;  4UHP B;  2R7Z I;  2WPT A;  4NBG A;  3CCL 1;  1S72 1;  2I3C A;  1WII A;  2QA4 Z;  2M8L A;  5KP6 B;  1SIW A;  2Z44 A;  2VPZ A;  1D1D A;  1JJ2 O;  1Y1V S;  1Y1W I;  2V3V A;  4BPH A;  3HKZ A;  1N8R 2;  2VUG A;  2GYK A;  3CXC Y;  3MZL B;  5T64 A;  4U0C A;  2JA8 I;  2K94 A;  1L0I A;  1KC8 2;  2Q4Z A;  2KOR A;  2V8J A;  3H0D A;  4NB8 A;  3CCU Z;  3MGE A;  1VQ5 1;  2RPR A;  1W2B Y;  3I55 1;  5KP8 B;  3S2D I;  1QVF O;  2QA4 P;  2F4M A;  2JAZ A;  4CA3 A;  2OTL Z;  2KPI A;  1Q86 1;  2JYL A;  2BUO A;  4DG9 A;  2XV6 A;  1N2F A;  1N8R Q;  4RVG A;  3DS0 A;  4WYM A;  1NQ4 A;  5HVC A;  2KG8 A;  4A3L I;  3H4E A;  4MD8 A;  4RVF A;  2FQ2 A;  2XZ1 C;  2PEK A;  1KC8 Q;  3GKQ A;  1NUI A;  3CCU P;  2PMZ A;  1JJ2 Y;  2G2K A;  3S14 I;  3G28 A;  1DL6 A;  3CCM P;  3S1R I;  1YI2 1;  4A93 I;  1VQ8 P;  3G6E Z;  3Q87 A;  3NH5 A;  2E2I I;  1M6E X;  4R0M A;  1YHQ Z;  3M3Y I;  3CC4 1;  1I6H I;  5FLX b;  1VQN Z;  3J7A 4;  2JA7 I;  2OTL P;  4RVH A;  1X3W A;  3EED A;  1QRJ A;  3HOZ I;  3RG2 A;  2LIY A;  2QRE B;  3G71 Z;  2N98 A;  1VQK Z;  4BPG A;  5IP7 I;  3IR7 A;  5IP9 I;  1VQP 1;  2MY5 A;  1PFT A;  2N50 A;  5FLX f;  5EJD A;  3VMI A;  1VQ6 1;  3G6E P;  1AF8 A;  4U0A A;  1YHQ P;  2DE7 A;  2J6A A;  1I50 I;  1VQN P;  5T6B A;  1RO2 A;  2LKI A;  3BG0 B;  4NBA A;  2QEX Z;  1Q82 2;  2GZG A;  2OOX B;  2WAQ A;  1YIJ 1;  4IPY A;  2CG5 B;  1VQ4 1;  3G71 P;  1M6N A;  3CCS 1;  1YJW 1;  1VQK P;  1Q81 2;  1K9M 2;  3GTL I;  3JAM b;  2VLP A;  3U50 C;  3CC2 Z;  5HGN A;  2JNY A;  2KOD A;  1YJN 1;  5D1O B;  3GTM S;  3RZO I;  4CL1 A;  3VMG A;  3HOV I;  4QTT A;  2IZ4 A;  3G29 A;  2QEX P;  1Q82 Q;  2AFE A;  1WZN A;  4NBF A;  1VQL Z;  1EOQ A;  3JAM f;  2LOL A;  1A43 A;  1X3O A;  2PEO A;  1RO0 A;  2QRC B;  1VQ7 Z;  2LF4 A;  3OW2 O;  1Q81 Q;  2K5X A;  3CC2 P;  2M8N A;  1K73 2;  2DE5 A;  1GXG A;  3KIF A;  2ROQ A;  1R9T I;  2EG5 A;  2BJO A;  2E2J I;  3CCE 1;  1DV5 A;  3CCR 1;  1CEI A;  2L4B A;  3J81 b;  4PH1 A;  2FAE A;  1X3Z A;  1YJ9 1;  3S17 I;  2JIQ A;  3IF8 A;  2JU2 A;  2H85 A;  1QVG O;  4MXU A;  2LL8 A;  4Y52 I;  2E7Z A;  3CCL Z;  1S72 Z;  3I4M I;  1VQL P;  1UJZ A;  2GU2 A;  4XFX A;  1VQM 1;  1WCM I;  2M8P A;  2JQ4 A;  1ZNV A;  2KG6 A;  3GTK I;  1OR5 A;  4PWV B;  1USP B;  1VQ7 1;  2W04 A;  2NVQ I;  3TDH B;  4E2Z A;  2N5H A;  2OAR A;  5CM2 M;  2V8K A;  4H2X C;  1M90 2;  3H3V J;  2FAD A;  2GZJ A;  3DTJ A;  2VUM I;  3S16 I;  1VQ5 Z;  3NFZ A;  2KOQ A;  4NBD A;  1FDO A;  4BY7 I;  3I55 Z;  3CME Z;  3G26 A;  3CCL P;  1S72 P;  2AFD A;  3CCJ 1;  2FVA A;  3G1G A;  3D2L A;  3PO3 S;  5HV8 A;  2JMO A;  2RHB A;  1VHN A;  1RLY A;  2EGT A;  1ZB8 A;  2QR1 B;  2OTJ 1;  1KD1 1;  1M1K 2;  1QVG Y;  2RIQ A;  4A3B I;  3NTE A;  3CXC Z;  1GXH A;  2JYG A;  3CPW Y;  4MH4 A;  3CPW Z;  2EHT A;  1NJI Q;  2GDY A;  1M90 Q;  3B4Q A;  1K8A 2;  2E1M A;  1VQ5 P;  1YI2 Z; 
#chains in the Genus database with same CATH homology
 3FQM A;  3I55 P;  1W2B Z;  3S15 I;  1YIT Z;  5IT9 b;  3CME 1;  4NBE A;  3CC4 Z;  4NH1 C;  4E32 A;  3G1I A;  1M1K Q;  2K5R A;  5BS1 A;  3VMH A;  3HOX I;  3VTN A;  3I4N I;  3LRY A;  2O53 A;  1VQP Z;  5IT9 f;  2PEI A;  1K8A Q;  2E9H A;  1VQ6 Z;  1YI2 P;  1JJ2 Z;  4HGZ A;  4AYB A;  1KRL A;  1YIT 1;  1IUQ A;  3CC4 P;  3H47 A;  1Q7Y 1;  3I56 1;  2Z45 A;  1K73 1;  2P28 A;  3CCV 1;  3VB9 A;  1YIJ Z;  2ZAE B;  2OZK A;  1VQ4 Z;  1Z01 A;  3CCS Z;  4HH4 A;  1YJW Z;  3HOW I;  4A3C I;  1QVF Y;  5C44 I;  5DCK A;  1QVF Z;  1VQP P;  4U0E A;  4MON A;  1YJN Z;  4QTU A;  4E33 A;  3RG6 C;  1VQ6 P;  3S1M I;  3CCM 1;  3CC7 1;  1E6J P;  4PH0 A;  3DS1 A;  2L6E A;  2PK7 A;  1JWH C;  3QWU A;  3K7A I;  3IX0 A;  2EIA A;  1YIJ P;  1K30 A;  3CCS P;  1QF8 A;  1KQS O;  2DGY A;  5JPA A;  5F2N A;  1Z03 A;  3WBH A;  3CCE Z;  1ZMB A;  4E2Y A;  3CCR Z;  3HOU I;  3MZK B;  1VQ9 1;  1YJ9 Z;  3GTG I;  2B63 I;  1Z02 A;  4RVD A;  4GR6 A;  1TWA I;  1N8R 1;  1SFO I;  1VQM Z;  3DS4 A;  4A3E I;  2JO0 A;  1ML8 A;  5T67 A;  4DK1 A;  1KC8 1;  2YU9 I;  1M74 A;  3B5I A;  3VRL C;  3PO2 I;  2Z46 A;  2AKL A;  3GTJ I;  1Q86 2;  4XFY A;  1KD1 Q;  3EER A;  1EIA A;  1KQS Y;  1LQL A;  1YJ9 P;  2M48 A;  3G4S 1;  3Q20 A;  1ZH1 A;  2KI7 B;  2E2H I;  2VF1 A;  3CCJ Z;  1VQM P;  4NOZ A;  1VQ7 P;  2GTH A;  2OTJ Z;  4U0B A;  1Y1V I;  3ESW A;  3F3P C;  2R6M A;  2R92 I;  2QRD B;  1BAJ A;  5HGL A;  1Q86 Q;  3CMA 1;  2PEJ A;  1NJI 2;  2BHV A;  4XRO A;  3DPH A;  3OW2 Y;  3OW2 Z;  3NH4 A;  1RNI A;  1VQO 1;  2Y0S A;  3CXC O;  3CCJ P;  2QKD A;  2XXM A;  3E2D A;  3CCQ 1;  3H0G I;  4MD9 A;  2OTJ P;  3KIH A;  4EWC A;  3IFU A;  2W03 A;  3P5J B;  1QVG Z;  3CD6 1;  1W2B O;  4X6A I;  3MON A;  3HOY I;  2OOY B;  3NDI A;  1YUA A;  4BBR I;  4E2X A;  5C4X I;  1Q82 1;  5BS2 A;  4BBS I;  2LFU A;  4BXX I;  3DS2 A;  2JA6 I;  4HGY A;  4BY1 I;  3CME P;  4XFZ A;  4MRI A;  4QNB A;  1Q81 1;  1K9M 1;  3I56 Z;  3S1N I;  4NBC A;  3CCV Z;  3DS5 A;  1TFI A;  2HU9 A;  2HF1 A;  2PY8 A;  2GTI A;  2P9X A;  1TWG I;  1A8O A;  4U0D A;  3RZD I;  3TE5 B;  2WB1 A;  3S2H I;  1TWC I;  3GTP I;  3CCM Z;  5I4T G;  3CC7 Z;  1YIT P;  1VQ8 Z;  2PEQ A;  1QYP A;  3I56 P;  3I07 A;  2R93 I;  3CCV P;  2QA4 1;  2K3R A;  4S1T A;  5F2O A;  3GTO I;  3F3F C;  1NP6 A;  1TWH I;  3M4O I;  2F4O A;  4A3K I;  5LL6 f;  3FKI I;  1S7M A;  2YAD A;  2JA5 I;  3GTM I;  1TWF I;  3CCU 1;  3CC7 P;  5D1O A;  4TNU A;  1VQ9 Z;  3GTQ I;  1VQ8 1;  2QLV B;  3NH8 A;  1X0T A;  5AN9 F;  1ZB9 A;  5C3E I;  2OTL 1;  1L1O C;  2JUB A;  2Q51 A;  4A3I I;  1VQ4 P;  1YJW P;  1NJI 1;  1M90 1;  1VLA A;  3CQZ I;  2JR6 A;  3NDJ A;  1YJN P;  5D1P A;  4A3D I;  2M6N A;  1KD1 2;  4MD7 A;  4DGL A;  1VQ9 P;  4E30 A;  1WW9 A;  3G6E 1;  3G4S Z;  5HGM A;  4NBB A;  1M1K 1;  1YHQ 1;  3S1Q I;  4A3G I;  1VQN 1;  3BG1 B;  1I3Q I;  1AUM A;  2PM9 A;  4XX2 A;  4RS4 A;  3G0V A;  3G71 1;  1K8A 1;  4Y7N I;  1VQK 1;  5HGO A;  1USP A;  4E2W A;  4A3J I;  3CMA Z;  3CCE P;  3LUS A;  2IZ3 A;  4NFR A;  2RT9 A;  3CCR P;  2ONT A;  3T4N B;  3G4S P;  3J80 b;  4M0I A;  4NBH A;  1KQS Z;  1VQO Z;  4NB9 A;  1RO4 A;  3P05 A;  2NVY I;  3D9X A;  4A3M I;  1YUK A;  3M1M A;  4E31 A;  2QEX 1;  3PO3 I;  2PEN A;  2V8I A;  3GCF A;  5FLM I;  3CCQ Z;  2NVX I;  1Q7Y 2;  1K9M Q;  4COP A;  2PEM A;  3CD6 Z;  2XT1 A;  1RQF A;  3CC2 1;  4U0F A;  4A3F I;  3CMA P;  3J80 f;  3FQQ A;  3HYB A;  3G21 A;  4DQY B;  1K83 I;  4RV9 A;  1VQO P;  5A2Q b;  2JS4 A;  3D6W A;  3DS3 A;  2DE6 A;  4XRQ A;  3CPW O;  3CCQ P;  1VQL 1;  2P3Y A;  2CWO A;  1Q7Y Q;  5F2K A;  3CD6 P;  1K73 Q;  2RBL A;  3J81 f;  4COC A;  5A2Q f;  2NVT I;  2O4H A;  3HZQ A;  5C4J I;  1P9N A;  2EFJ A;  4GR2 A;  2R7Z I;  4NBG A;  3CCL 1;  1S72 1;  2I3C A;  1WII A;  2QA4 Z;  2M8L A;  2Z44 A;  1D1D A;  1JJ2 O;  1Y1V S;  1Y1W I;  3HKZ A;  1N8R 2;  2VUG A;  3CXC Y;  3MZL B;  5T64 A;  4U0C A;  2JA8 I;  1KC8 2;  2Q4Z A;  2V8J A;  3H0D A;  4NB8 A;  3CCU Z;  3MGE A;  1VQ5 1;  2RPR A;  1W2B Y;  3I55 1;  3S2D I;  1QVF O;  2QA4 P;  2F4M A;  2OTL Z;  2KPI A;  1Q86 1;  2JYL A;  2BUO A;  2XV6 A;  1N2F A;  1N8R Q;  4RVG A;  3DS0 A;  4WYM A;  4A3L I;  3H4E A;  4MD8 A;  4RVF A;  2PEK A;  1KC8 Q;  3GKQ A;  1NUI A;  3CCU P;  2PMZ A;  1JJ2 Y;  2G2K A;  3S14 I;  3G28 A;  1DL6 A;  3CCM P;  3S1R I;  1YI2 1;  4A93 I;  1VQ8 P;  3G6E Z;  3Q87 A;  3NH5 A;  2E2I I;  1M6E X;  1YHQ Z;  3M3Y I;  3CC4 1;  1I6H I;  5FLX b;  1VQN Z;  3J7A 4;  2JA7 I;  2OTL P;  4RVH A;  1X3W A;  3EED A;  1QRJ A;  3HOZ I;  2LIY A;  2QRE B;  3G71 Z;  1VQK Z;  5IP7 I;  5IP9 I;  1VQP 1;  1PFT A;  5FLX f;  1VQ6 1;  3VMI A;  3G6E P;  4U0A A;  1YHQ P;  2DE7 A;  2J6A A;  1I50 I;  1VQN P;  5T6B A;  1RO2 A;  3BG0 B;  4NBA A;  2QEX Z;  1Q82 2;  2OOX B;  2WAQ A;  1YIJ 1;  4IPY A;  1VQ4 1;  3G71 P;  1M6N A;  3CCS 1;  1YJW 1;  1VQK P;  1Q81 2;  1K9M 2;  3GTL I;  3JAM b;  3U50 C;  3CC2 Z;  5HGN A;  2JNY A;  2KOD A;  1YJN 1;  5D1O B;  3GTM S;  3RZO I;  4CL1 A;  3VMG A;  3HOV I;  4QTT A;  2IZ4 A;  3G29 A;  2QEX P;  1Q82 Q;  4NBF A;  1VQL Z;  1EOQ A;  3JAM f;  1A43 A;  2PEO A;  1RO0 A;  2QRC B;  1VQ7 Z;  2LF4 A;  3OW2 O;  1Q81 Q;  3CC2 P;  2M8N A;  1K73 2;  2DE5 A;  3KIF A;  1R9T I;  2EG5 A;  2BJO A;  2E2J I;  3CCE 1;  3CCR 1;  3J81 b;  4PH1 A;  1X3Z A;  1YJ9 1;  3S17 I;  3IF8 A;  4MXU A;  2H85 A;  1QVG O;  4Y52 I;  3CCL Z;  1S72 Z;  3I4M I;  1VQL P;  2GU2 A;  4XFX A;  1VQM 1;  1WCM I;  2M8P A;  3GTK I;  1VQ7 1;  1USP B;  2W04 A;  2NVQ I;  3TDH B;  4E2Z A;  2OAR A;  5CM2 M;  2V8K A;  1M90 2;  3H3V J;  3S16 I;  3DTJ A;  2VUM I;  1VQ5 Z;  3NFZ A;  4NBD A;  4BY7 I;  3I55 Z;  3CME Z;  3G26 A;  3CCL P;  1S72 P;  3CCJ 1;  3G1G A;  3PO3 S;  2JMO A;  2RHB A;  1RLY A;  2EGT A;  1ZB8 A;  2QR1 B;  2OTJ 1;  1KD1 1;  1M1K 2;  1QVG Y;  2RIQ A;  4A3B I;  3NTE A;  3CXC Z;  2JYG A;  3CPW Y;  4MH4 A;  3CPW Z;  1NJI Q;  1M90 Q;  1K8A 2;  2E1M A;  1VQ5 P;  1YI2 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...