1RNIA

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
210
Chain Sequence
b'SSERIRYAKWFLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGLVILDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF904
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
total genus 68
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1rniA01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1rniA03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1rniA02
3M1MA 1RO0A 1RNIA 1RO2A
chains in the Genus database with same CATH superfamily
1EOQA 1K8A1 2KG6A 1KC82 4E2WA 4PXHB 4MRTC 1YJNZ 1VQ71 2LTEA 1OR5A 5I4TG 1VQ7P 3I55Z 2GZGA 2GYKA 1NJI1 2E2HI 2LIWA 1YJWP 1YHQ1 4XROA 1M902 3DS1A 2VUMI 1YHQP 4XX2A 1VQLZ 1L1OC 3CXCY 3P05A 3NTEA 2W03A 3CCEZ 2BJOA 1VQN1 1K9MQ 3DS0A 2WPTA 2KOQA 3CMEZ 4MH4A 1KD1Q 4XFXA 3M1MA 1IMPA 1Q7Y2 3LUSA 1YJN1 1A43A 1K73Q 2RPRA 3HOVI 1YJNP 4TNUA 3CC21 3I551 2JUBA 2VLOA 1UJZA 2AFEA 2XT1A 3I55P 3CXCO 3CC2P 3CC4Z 1Q862 2KORA 1VQL1 4H2YC 2L0QA 1WW9A 1X3WA 2AYDA 2DE5A 2E7ZA 1VQLP 2K5RA 3VTNA 3DTJA 2O4HA 5HGLA 3CCE1 1KRLA 3CCEP 2VSQA 2RIQA 3CCLZ 3CMEP 2K0XA 1WCMI 2JU1A 1TFIA 1DL6A 2NVYI 4E33A 1VHNA 3G71Z 3H4EA 2RHBA 2FADA 3CC7Z 2V8KA 4S1TA 4MRIA 1K9M2 2QA4Z 1M6EX 1LQLA 4QTTA 3G1IA 1YI2Z 1KD12 3S1NI 4U0EA 3CMA1 3CMAP 3CCL1 1ZB8A 1QVFZ 2LIUA 3TE5B 3CCLP 2B63I 3IR7A 1YIJZ 1M901 2N50A 5D1PA 2JYGA 3VMHA 1QXFA 3G711 2ONTA 5C4JI 2N6YA 4BBRI 3CCMZ 1RO0A 3G71P 1Z6MA 3JAMf 1YUAA 1L0HA 2JR6A 2JBGA 3CC71 3CC7P 1Q7Y1 2QA41 1S7MA 1SFOI 2GDXA 1YI21 2QA4P 1RLYA 2JIRA 1YI2P 3NH4A 2OZKA 2E9HA 2GTIA 4E31A 1IUQA 4XFZA 2QLVB 1Q861 1QVFY 4PWVB 1M74A 2Y0SA 3RG2A 1YIJ1 3S14I 5F2OA 2MVUA 1YIJP 3NY7B 4A3MI 3I4MI 2KOOA 2M5RA 1M1KQ 2NAPA 4NB8A 3CCM1 3MGEA 5FLXb 1IMQA 3CCMP 2J6AA 4AYBA 5D1OA 2CG5B 2O53A 2H85A 2JO0A 1NP6A 3M4OI 5A2Qf 3PO3I 2MVVA 2JIPA 4BBSI 2RT9A 4HGZA 3RZOI 1BAJA 1VQP1 2VPZA 5HGNA 3J81b 1YUKA 3D6WA 2ERHA 5LL6f 3S15I 5F2KA 3IF8A 3F3PC 3CXCZ 5AN9F 1W2BY 1KD11 3NH5A 2Z44A 4IPYA 2MF4A 3GTMS 2VPWA 3KIHA 1R9TI 1K731 2PENA 5CZDB 3G29A 3DS2A 3G21A 3G6EZ 2P28A 2QRCB 2FACA 5EW5E 1Y1VS 2JA6I 3GCFA 2MR7A 4COPA 1YJW1 1M1K2 2KGEA 2GU2A 4NBBA 4NB9A 1W2BO 2IV2X 4BXXI 3H47A 1VQKZ 2VLNA 2VPYA 2V8IA 1FDIA 5EJDA 3BG1B 4E30A 2QREB 3G6E1 4U0DA 2BHVA 2K0YA 4A3EI 2VLPA 2K94A 1X0TA 2RBLA 2XV6A 3G6EP 1YJ9Z 1Z03A 3CCSZ 2V45A 1FR2A 2JQ4A 4CA3A 2X2BA 4U0AA 2KOSA 1RQFA 2AFDA 4U0BA 3NDJA 1EMVA 2MY5A 5HGOA 4UHPB 1VQK1 2FQ2A 4NFRA 1VQKP 2QEXZ 2JA8I 3DS3A 2P9XA 3GKQA 4A3FI 2M48A 4E2YA 2QRDB 3NDIA 5IP7I 5FLXf 2K92A 4X6AI 3CME1 1NUIA 1WZNA 1YJ91 1YJ9P 3CCS1 4NBGA 2DNWA 1ACPA 5KP6B 3HOUI 2PY8A 3CCSP 4U0CA 2GDWA 2NVXI 2K93A 5IP9I 2FVEA 1KQSY 3S2DI 3J81f 2PEIA 4NBAA 4NBEA 3GZMA 3CC41 4M0IA 3GJNA 3CC4P 3CCQZ 3GTOI 3EEDA 1Q82Q 1VLAA 2K2QA 4A3KI 2FVFA 2QEX1 1QVGZ 4A3CI 2Q4ZA 2QEXP 3HOZI 5C4XI 2GTHA 2JYLA 3HOYI 4Y52I 2AVAA 1K732 1EIAA 1KLPA 4RS4A 2PK7A 3HKZA 1M1K1 2KI7B 2LMLA 5HGMA 1TWHI 4RVHA 4DGLA 2OTJZ 1KQSO 3GTGI 2GZEA 2BUOA 3EJEA 2OARA 4HGYA 3LMOA 3VRLC 2ROQA 3BG0B 3I07A 4NEOA 3HYBA 4NOZA 3CCQ1 4RVFA 3EERA 3CCQP 4MXUA 1Q81Q 3CCUZ 1TWAI 3PO2I 1QVGY 1VQ9Z 3J7A4 2R6MA 2KOPA 5BS1A 2EGTA 1GPJA 3RG6C 4RV9A 3S1RI 4NBCA 2OOYB 5F2NA 2L9FA 2K0DX 4NBFA 1VQ8Z 2JA7I 2OTJ1 4U0FA 2XZ1C 2WAQA 3G28A 2OTJP 2E2II 1QYPA 2IZ3A 1I50I 3S2HI 1W2BZ 2PEQA 2V3VA 3S1MI 3G4SZ 4E2XA 1QVGO 1F80D 1Q16A 3GKLC 1VKUA 2KR5A 1K83I 2F4OA 3CCVZ 3CE7A 3VMIA 4MD9A 2XXMA 3VMGA 4GR6A 1NQ4A 1VQ91 2Z46A 2OTLZ 3CCUP 3OW2Y 1KC8Q 1VQ9P 1GXHA 1VQ81 5IT9b 4A3DI 1VQ8P 4XFYA 2JGPA 2L6EA 3T4NB 2CWOA 4NBHA 2LL8A 5T64A 3K7AI 1AYIA 3G4S1 1N8RQ 1Q812 5T6BA 3M3YI 2VUGA 3G4SP 2W04A 3OW2O 4A3LI 3FKII 2R93I 1X3OA 2Q51A 2JU2A 2KGCA 3CCVP 2PEMA 4CL1A 5FLMI 1HQBA 4F37A 1DV5A 1WJ2A 1VQ4Z 3HZQA 1P9NA 1UNKA 2KG9A 1VQ6Z 2CGQA 3CQZI 4NH1C 4Y7NI 1T8KA 2XZ0D 1JJ2Z 4COCA 4E32A 1L0IA 4BY1I 1ZMBA 5BS2A 3CCRZ 1YITZ 1VQNZ 4BPHA 1AF8A 2P3YA 2PEOA 1MZ8A 1E6JP 2EFJA 2JNYA 3J80b 2PMZA 2NO8A 4BY7I 2ZAEB 2K3RA 4IZ6A 2N5IA 3JAMb 3CC2Z 1VQ41 1Q821 1VQ61 1KQSZ 1VQ4P 1VQ6P 2VPXA 3IX0A 2JIQA 1PFTA 4MONA 1USPB 1N8R2 3CPWY 2M8NA 3F3FC 3EJDA 1JJ2Y 5T67A 3CCR1 1A8OA 1GXGA 2F4MA 2N98A 2Z45A 1YIT1 3CCRP 1JWHC 1SIWA 1S72Z 3NH8A 1ZNVA 2LOLA 1YITP 1VQNP 2LIYA 3GTMI 1USPA 2PNGA 1ZH1A 3FQQA 3KIFA 2L22A 4HH4A 4DQYB 2N5HA 3HOXI 1E0HA 2E1MA 5CM2M 1K8AQ 2KG8A 1BXIA 1Y1VI 3VB9A 4EWCA 2JB0A 3CPWO 4BPFA 2JS4A 2DGYA 2QR1B 1X3ZA 3MZKB 5KP7B 1JJ2O 1Q811 3G1GA 5IT9f 3GTPI 1D1DA 5A2Qb 1VQMZ 3QWUA 1NJIQ 1AUMA 2PM9A 3EJBA 3CCJZ 2FHSC 5JPAA 3DPHA 5C44I 4A3II 3CMAZ 3Q20A 4MD7A 1WIIA 2KW2A 3I4NI 1S721 2PEKA 2R92I 4A3JI 2DE7A 2VLQA 4R0MA 1S72P 1ML8A 1TWGI 3D9XA 3DS4A 2N6ZA 2YADA 3B4QA 2JMOA 2IZ4A 2KGAA 4MD8A 4XRQA 1AA6A 2L4BA 2KWLA 3FQMA 2NVTI 1TWCI 2E2JI 2FVAA 2EHTA 1VQM1 1KC81 2AF8A 3PO3S 1FDOA 2I3CA 3GZLA 1VQMP 2GZJA 2CQ8A 1I3QI 1RO4A 3CCJ1 2R7ZI 2MR8A 3NFZA 2EIAA 4H2XC 3CCJP 3OW2Z 2QNWA 2G2KA 2GDYA 2LEXA 2MD9A 3IFUA 4A3BI 1I6HI 2KGDA 3U43A 1RNIA 1K8A2 4A93I 1Z01A 1ZB9A 1VQ5Z 4QKOA 1K30A 4BPGA 2HU9A 3J80f 3I56Z 3RZDI 1N8R1 3H3VJ 3HOWI 3S1QI 2FAEA 4DK1A 4NBDA 1RO2A 2OOXB 2V8JA 1Y1WI 1Q822 4E2ZA 1NJI2 1CEIA 3GTQI 5DCKA 4HKGA 1Z02A 3S17I 7CEIA 3GTKI 2DE6A 4QTUA 4DG9A 2FQ1A 2LKIA 4QNBA 2GZFA 2AKLA 3CCU1 1VQOZ 3GTJI 1VQPZ 2JIOA 2JA5I 1DNYA 5C3EI 3Q87A 4H2WC 5KP8B 5D1OB 3U50C 3H0GI 1VQ51 2EHSA 2KPIA 3MZLB 2HF1A 2CNRA 4PH0A 3ESWA 1VQ5P 3P5JB 3GTLI 2YU9I 3S16I 2M8LA 3I561 3CD6Z 2LF4A 1HY8A 3MONA 3I56P 3G26A 5HV8A 3D2LA 1M90Q 2VF1A 4PH1A 3G0VA 2M6NA 2QKDA 3B5IA 3CCV1 2GZIA 1M6NA 1TWFI 1QVFO 1N2FA 3LRYA 4WYMA 1VQO1 2OTL1 2PEJA 3TDHB 1VQ7Z 4GR2A 1VQOP 2OTLP 1Q7YQ 1VQPP 3DS5A 1YJWZ 4A3GI 2JIMA 2M8PA 4RVGA 1QF8A 2EG5A 1YHQZ 2WB1A 3E2DA 3H0DA 2JAZA 3CPWZ 2FQ0A 1K9M1 3WBHA 3CD61 1Y8CA 3CD6P 1Q86Q 1QRJA 2LFUA 2NVQI 4RVDA 2K5XA 2KODA 5HVCA 2LPKA
chains in the Genus database with same CATH topology
1EOQA 1K8A1 1KC82 4E2WA 1YJNZ 1VQ71 5I4TG 1VQ7P 3I55Z 1NJI1 2E2HI 1YJWP 1YHQ1 4XROA 1M902 3DS1A 2VUMI 1YHQP 4XX2A 1VQLZ 1L1OC 3CXCY 3P05A 3NTEA 2W03A 3CCEZ 2BJOA 1VQN1 1K9MQ 3DS0A 3CMEZ 4MH4A 1KD1Q 4XFXA 3M1MA 1Q7Y2 3LUSA 1YJN1 1A43A 1K73Q 2RPRA 3HOVI 1YJNP 4TNUA 3CC21 3I551 2JUBA 3CXCO 2XT1A 3CC2P 3I55P 3CC4Z 1Q862 1VQL1 1WW9A 1X3WA 2DE5A 1VQLP 2K5RA 3VTNA 3DTJA 5HGLA 3CCE1 1KRLA 3CCEP 3CCLZ 2RIQA 3CMEP 1WCMI 1TFIA 1DL6A 2NVYI 4E33A 3G71Z 3H4EA 2RHBA 3CC7Z 2V8KA 4S1TA 4MRIA 1K9M2 2QA4Z 1M6EX 1LQLA 4QTTA 3G1IA 1YI2Z 1KD12 3S1NI 4U0EA 3CMA1 3CMAP 3CCL1 1ZB8A 1QVFZ 3TE5B 3CCLP 2B63I 1YIJZ 1M901 5D1PA 2JYGA 3VMHA 3G711 2ONTA 5C4JI 4BBRI 3CCMZ 1RO0A 3G71P 3JAMf 1YUAA 2JR6A 3CC71 3CC7P 1Q7Y1 2QA41 1S7MA 1SFOI 1YI21 2QA4P 1RLYA 1YI2P 3NH4A 2OZKA 2E9HA 2GTIA 4E31A 1IUQA 4XFZA 2QLVB 1Q861 1QVFY 1M74A 2Y0SA 1YIJ1 3S14I 5F2OA 1YIJP 4A3MI 3I4MI 4NB8A 1M1KQ 3CCM1 3MGEA 5FLXb 2J6AA 3CCMP 4AYBA 5D1OA 2O53A 2H85A 2JO0A 1NP6A 3M4OI 5A2Qf 3PO3I 4BBSI 2RT9A 4HGZA 3RZOI 1BAJA 1VQP1 5HGNA 3J81b 1YUKA 3D6WA 5LL6f 3S15I 5F2KA 3IF8A 3F3PC 3CXCZ 5AN9F 1W2BY 1KD11 3NH5A 2Z44A 4IPYA 3GTMS 3KIHA 1R9TI 1K731 2PENA 3G29A 3DS2A 3G21A 3G6EZ 2P28A 2QRCB 1Y1VS 2JA6I 3GCFA 4COPA 1YJW1 1M1K2 2GU2A 4NBBA 4NB9A 1W2BO 4BXXI 3H47A 1VQKZ 2V8IA 3BG1B 4E30A 2QREB 3G6E1 4U0DA 2BHVA 4A3EI 1YJ9Z 1X0TA 2RBLA 2XV6A 3G6EP 1Z03A 3CCSZ 4U0AA 1RQFA 4U0BA 3NDJA 5HGOA 1VQK1 4NFRA 1VQKP 2QEXZ 2JA8I 3DS3A 2P9XA 3GKQA 4A3FI 2M48A 4E2YA 2QRDB 3NDIA 5IP7I 5FLXf 4X6AI 3CME1 1NUIA 1YJ91 1YJ9P 3CCS1 4NBGA 3HOUI 2PY8A 3CCSP 4U0CA 2NVXI 5IP9I 1KQSY 3S2DI 3J81f 2PEIA 4NBAA 4NBEA 3CC41 4M0IA 3CC4P 3CCQZ 3GTOI 3EEDA 1Q82Q 1VLAA 4A3KI 2QEX1 1QVGZ 4A3CI 2Q4ZA 2QEXP 3HOZI 5C4XI 2GTHA 2JYLA 3HOYI 4Y52I 1K732 1EIAA 4RS4A 2PK7A 3HKZA 1M1K1 2KI7B 5HGMA 1TWHI 4RVHA 4DGLA 2OTJZ 1KQSO 3GTGI 2BUOA 2OARA 4HGYA 3VRLC 3BG0B 3I07A 3HYBA 4NOZA 3CCQ1 4RVFA 3EERA 3CCQP 4MXUA 1Q81Q 3CCUZ 1TWAI 3PO2I 1QVGY 1VQ9Z 3J7A4 2R6MA 5BS1A 2EGTA 3S1RI 3RG6C 4RV9A 4NBCA 2OOYB 5F2NA 4NBFA 1VQ8Z 2JA7I 2OTJ1 4U0FA 2WAQA 3G28A 2OTJP 2E2II 1QYPA 2IZ3A 1I50I 3S2HI 1W2BZ 2PEQA 3S1MI 3G4SZ 4E2XA 1QVGO 1K83I 2F4OA 3CCVZ 3VMIA 4MD9A 2XXMA 3VMGA 4GR6A 1VQ91 2OTLZ 2Z46A 3CCUP 3OW2Y 1KC8Q 1VQ9P 1VQ81 5IT9b 4A3DI 1VQ8P 4XFYA 2L6EA 3T4NB 2CWOA 4NBHA 5T64A 3K7AI 3G4S1 1N8RQ 1Q812 5T6BA 3M3YI 2VUGA 3G4SP 2W04A 3OW2O 4A3LI 3FKII 2R93I 2Q51A 5FLMI 4CL1A 3CCVP 2PEMA 1VQ4Z 3HZQA 1P9NA 1VQ6Z 3CQZI 4NH1C 4Y7NI 1JJ2Z 4COCA 4E32A 4BY1I 1ZMBA 5BS2A 3CCRZ 1YITZ 1VQNZ 2P3YA 2PEOA 1E6JP 2EFJA 2JNYA 3J80b 2PMZA 4BY7I 2ZAEB 2K3RA 3JAMb 3CC2Z 1VQ41 1Q821 1VQ61 1KQSZ 1VQ4P 1VQ6P 3IX0A 1PFTA 4MONA 1USPB 1N8R2 3CPWY 2M8NA 3F3FC 1JJ2Y 5T67A 3CCR1 1A8OA 2F4MA 2Z45A 1YIT1 3CCRP 1JWHC 1S72Z 3NH8A 1YITP 2LIYA 1VQNP 3GTMI 1USPA 1ZH1A 3FQQA 3KIFA 4HH4A 4DQYB 3HOXI 2E1MA 5CM2M 1K8AQ 1Y1VI 3VB9A 4EWCA 3CPWO 2QR1B 2JS4A 2DGYA 3MZKB 1X3ZA 1JJ2O 1Q811 3G1GA 5IT9f 3GTPI 1D1DA 5A2Qb 1VQMZ 3QWUA 1NJIQ 1AUMA 2PM9A 3CCJZ 5JPAA 3DPHA 5C44I 4A3II 3CMAZ 3Q20A 4MD7A 1WIIA 3I4NI 1S721 2PEKA 2R92I 4A3JI 2DE7A 1ML8A 1S72P 3D9XA 1TWGI 3DS4A 2YADA 2JMOA 2IZ4A 4MD8A 4XRQA 3FQMA 2NVTI 1TWCI 2E2JI 1VQM1 1KC81 3PO3S 2I3CA 1VQMP 3CCJ1 1I3QI 1RO4A 2R7ZI 3NFZA 2EIAA 3CCJP 3OW2Z 2G2KA 3IFUA 4A3BI 1I6HI 1RNIA 1K8A2 4A93I 1Z01A 1ZB9A 1VQ5Z 1K30A 2HU9A 3J80f 1N8R1 3I56Z 3RZDI 3H3VJ 3HOWI 3S1QI 4DK1A 4NBDA 1RO2A 2OOXB 2V8JA 1Y1WI 1Q822 4E2ZA 1NJI2 3GTQI 5DCKA 1Z02A 3S17I 3GTKI 2DE6A 4QTUA 4QNBA 2AKLA 3CCU1 1VQOZ 3GTJI 1VQPZ 2JA5I 5C3EI 3Q87A 5D1OB 3U50C 1VQ51 3H0GI 2KPIA 3MZLB 2HF1A 3ESWA 4PH0A 1VQ5P 3P5JB 3GTLI 2YU9I 3S16I 2M8LA 3I561 3CD6Z 2LF4A 3MONA 3I56P 3G26A 1M90Q 2VF1A 4PH1A 3G0VA 2M6NA 2QKDA 3B5IA 3CCV1 1M6NA 1TWFI 1QVFO 1N2FA 3LRYA 4WYMA 1VQO1 2OTL1 2PEJA 3TDHB 1VQ7Z 4GR2A 1VQOP 2OTLP 1Q7YQ 1VQPP 3DS5A 1YJWZ 4A3GI 2M8PA 4RVGA 1QF8A 2EG5A 1YHQZ 2WB1A 3E2DA 3H0DA 3CPWZ 1K9M1 3WBHA 3CD61 3CD6P 1Q86Q 1QRJA 2LFUA 2NVQI 4RVDA 2KODA 2O4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1M A;  1RO0 A;  1RNI A;  1RO2 A; 
#chains in the Genus database with same CATH topology
 1EOQ A;  1K8A 1;  2KG6 A;  1KC8 2;  4E2W A;  4PXH B;  4MRT C;  1YJN Z;  1VQ7 1;  2LTE A;  1OR5 A;  5I4T G;  1VQ7 P;  3I55 Z;  2GZG A;  2GYK A;  1NJI 1;  2E2H I;  2LIW A;  1YJW P;  1YHQ 1;  4XRO A;  1M90 2;  3DS1 A;  2VUM I;  1YHQ P;  4XX2 A;  1VQL Z;  1L1O C;  3CXC Y;  3P05 A;  3NTE A;  2W03 A;  3CCE Z;  2BJO A;  1VQN 1;  1K9M Q;  3DS0 A;  2WPT A;  2KOQ A;  3CME Z;  4MH4 A;  1KD1 Q;  4XFX A;  3M1M A;  1IMP A;  1Q7Y 2;  3LUS A;  1YJN 1;  1A43 A;  1K73 Q;  2RPR A;  3HOV I;  1YJN P;  4TNU A;  3CC2 1;  3I55 1;  2JUB A;  2VLO A;  1UJZ A;  2AFE A;  2XT1 A;  3I55 P;  3CXC O;  3CC2 P;  3CC4 Z;  1Q86 2;  2KOR A;  1VQL 1;  4H2Y C;  2L0Q A;  1WW9 A;  1X3W A;  2AYD A;  2DE5 A;  2E7Z A;  1VQL P;  2K5R A;  3VTN A;  3DTJ A;  2O4H A;  5HGL A;  3CCE 1;  1KRL A;  3CCE P;  2VSQ A;  2RIQ A;  3CCL Z;  3CME P;  2K0X A;  1WCM I;  2JU1 A;  1TFI A;  1DL6 A;  2NVY I;  4E33 A;  1VHN A;  3G71 Z;  3H4E A;  2RHB A;  2FAD A;  3CC7 Z;  2V8K A;  4S1T A;  4MRI A;  1K9M 2;  2QA4 Z;  1M6E X;  1LQL A;  4QTT A;  3G1I A;  1YI2 Z;  1KD1 2;  3S1N I;  4U0E A;  3CMA 1;  3CMA P;  3CCL 1;  1ZB8 A;  1QVF Z;  2LIU A;  3TE5 B;  3CCL P;  2B63 I;  3IR7 A;  1YIJ Z;  1M90 1;  2N50 A;  5D1P A;  2JYG A;  3VMH A;  1QXF A;  3G71 1;  2ONT A;  5C4J I;  2N6Y A;  4BBR I;  3CCM Z;  1RO0 A;  3G71 P;  1Z6M A;  3JAM f;  1YUA A;  1L0H A;  2JR6 A;  2JBG A;  3CC7 1;  3CC7 P;  1Q7Y 1;  2QA4 1;  1S7M A;  1SFO I;  2GDX A;  1YI2 1;  2QA4 P;  1RLY A;  2JIR A;  1YI2 P;  3NH4 A;  2OZK A;  2E9H A;  2GTI A;  4E31 A;  1IUQ A;  4XFZ A;  2QLV B;  1Q86 1;  1QVF Y;  4PWV B;  1M74 A;  2Y0S A;  3RG2 A;  1YIJ 1;  3S14 I;  5F2O A;  2MVU A;  1YIJ P;  3NY7 B;  4A3M I;  3I4M I;  2KOO A;  2M5R A;  1M1K Q;  2NAP A;  4NB8 A;  3CCM 1;  3MGE A;  5FLX b;  1IMQ A;  3CCM P;  2J6A A;  4AYB A;  5D1O A;  2CG5 B;  2O53 A;  2H85 A;  2JO0 A;  1NP6 A;  3M4O I;  5A2Q f;  3PO3 I;  2MVV A;  2JIP A;  4BBS I;  2RT9 A;  4HGZ A;  3RZO I;  1BAJ A;  1VQP 1;  2VPZ A;  5HGN A;  3J81 b;  1YUK A;  3D6W A;  2ERH A;  5LL6 f;  3S15 I;  5F2K A;  3IF8 A;  3F3P C;  3CXC Z;  5AN9 F;  1W2B Y;  1KD1 1;  3NH5 A;  2Z44 A;  4IPY A;  2MF4 A;  3GTM S;  2VPW A;  3KIH A;  1R9T I;  1K73 1;  2PEN A;  5CZD B;  3G29 A;  3DS2 A;  3G21 A;  3G6E Z;  2P28 A;  2QRC B;  2FAC A;  5EW5 E;  1Y1V S;  2JA6 I;  3GCF A;  2MR7 A;  4COP A;  1YJW 1;  1M1K 2;  2KGE A;  2GU2 A;  4NBB A;  4NB9 A;  1W2B O;  2IV2 X;  4BXX I;  3H47 A;  1VQK Z;  2VLN A;  2VPY A;  2V8I A;  1FDI A;  5EJD A;  3BG1 B;  4E30 A;  2QRE B;  3G6E 1;  4U0D A;  2BHV A;  2K0Y A;  4A3E I;  2VLP A;  2K94 A;  1X0T A;  2RBL A;  2XV6 A;  3G6E P;  1YJ9 Z;  1Z03 A;  3CCS Z;  2V45 A;  1FR2 A;  2JQ4 A;  4CA3 A;  2X2B A;  4U0A A;  2KOS A;  1RQF A;  2AFD A;  4U0B A;  3NDJ A;  1EMV A;  2MY5 A;  5HGO A;  4UHP B;  1VQK 1;  2FQ2 A;  4NFR A;  1VQK P;  2QEX Z;  2JA8 I;  3DS3 A;  2P9X A;  3GKQ A;  4A3F I;  2M48 A;  4E2Y A;  2QRD B;  3NDI A;  5IP7 I;  5FLX f;  2K92 A;  4X6A I;  3CME 1;  1NUI A;  1WZN A;  1YJ9 1;  1YJ9 P;  3CCS 1;  4NBG A;  2DNW A;  1ACP A;  5KP6 B;  3HOU I;  2PY8 A;  3CCS P;  4U0C A;  2GDW A;  2NVX I;  2K93 A;  5IP9 I;  2FVE A;  1KQS Y;  3S2D I;  3J81 f;  2PEI A;  4NBA A;  4NBE A;  3GZM A;  3CC4 1;  4M0I A;  3GJN A;  3CC4 P;  3CCQ Z;  3GTO I;  3EED A;  1Q82 Q;  1VLA A;  2K2Q A;  4A3K I;  2FVF A;  2QEX 1;  1QVG Z;  4A3C I;  2Q4Z A;  2QEX P;  3HOZ I;  5C4X I;  2GTH A;  2JYL A;  3HOY I;  4Y52 I;  2AVA A;  1K73 2;  1EIA A;  1KLP A;  4RS4 A;  2PK7 A;  3HKZ A;  1M1K 1;  2KI7 B;  2LML A;  5HGM A;  1TWH I;  4RVH A;  4DGL A;  2OTJ Z;  1KQS O;  3GTG I;  2GZE A;  2BUO A;  3EJE A;  2OAR A;  4HGY A;  3LMO A;  3VRL C;  2ROQ A;  3BG0 B;  3I07 A;  4NEO A;  3HYB A;  4NOZ A;  3CCQ 1;  4RVF A;  3EER A;  3CCQ P;  4MXU A;  1Q81 Q;  3CCU Z;  1TWA I;  3PO2 I;  1QVG Y;  1VQ9 Z;  3J7A 4;  2R6M A;  2KOP A;  5BS1 A;  2EGT A;  1GPJ A;  3RG6 C;  4RV9 A;  3S1R I;  4NBC A;  2OOY B;  5F2N A;  2L9F A;  2K0D X;  4NBF A;  1VQ8 Z;  2JA7 I;  2OTJ 1;  4U0F A;  2XZ1 C;  2WAQ A;  3G28 A;  2OTJ P;  2E2I I;  1QYP A;  2IZ3 A;  1I50 I;  3S2H I;  1W2B Z;  2PEQ A;  2V3V A;  3S1M I;  3G4S Z;  4E2X A;  1QVG O;  1F80 D;  1Q16 A;  3GKL C;  1VKU A;  2KR5 A;  1K83 I;  2F4O A;  3CCV Z;  3CE7 A;  3VMI A;  4MD9 A;  2XXM A;  3VMG A;  4GR6 A;  1NQ4 A;  1VQ9 1;  2Z46 A;  2OTL Z;  3CCU P;  3OW2 Y;  1KC8 Q;  1VQ9 P;  1GXH A;  1VQ8 1;  5IT9 b;  4A3D I;  1VQ8 P;  4XFY A;  2JGP A;  2L6E A;  3T4N B;  2CWO A;  4NBH A;  2LL8 A;  5T64 A;  3K7A I;  1AYI A;  3G4S 1;  1N8R Q;  1Q81 2;  5T6B A;  3M3Y I;  2VUG A;  3G4S P;  2W04 A;  3OW2 O;  4A3L I;  3FKI I;  2R93 I;  1X3O A;  2Q51 A;  2JU2 A;  2KGC A;  3CCV P;  2PEM A;  4CL1 A;  5FLM I;  1HQB A;  4F37 A;  1DV5 A;  1WJ2 A;  1VQ4 Z;  3HZQ A;  1P9N A;  1UNK A;  2KG9 A;  1VQ6 Z;  2CGQ A;  3CQZ I;  4NH1 C;  4Y7N I;  1T8K A;  2XZ0 D;  1JJ2 Z;  4COC A;  4E32 A;  1L0I A;  4BY1 I;  1ZMB A;  5BS2 A;  3CCR Z;  1YIT Z;  1VQN Z;  4BPH A;  1AF8 A;  2P3Y A;  2PEO A;  1MZ8 A;  1E6J P;  2EFJ A;  2JNY A;  3J80 b;  2PMZ A;  2NO8 A;  4BY7 I;  2ZAE B;  2K3R A;  4IZ6 A;  2N5I A;  3JAM b;  3CC2 Z;  1VQ4 1;  1Q82 1;  1VQ6 1;  1KQS Z;  1VQ4 P;  1VQ6 P;  2VPX A;  3IX0 A;  2JIQ A;  1PFT A;  4MON A;  1USP B;  1N8R 2;  3CPW Y;  2M8N A;  3F3F C;  3EJD A;  1JJ2 Y;  5T67 A;  3CCR 1;  1A8O A;  1GXG A;  2F4M A;  2N98 A;  2Z45 A;  1YIT 1;  3CCR P;  1JWH C;  1SIW A;  1S72 Z;  3NH8 A;  1ZNV A;  2LOL A;  1YIT P;  1VQN P;  2LIY A;  3GTM I;  1USP A;  2PNG A;  1ZH1 A;  3FQQ A;  3KIF A;  2L22 A;  4HH4 A;  4DQY B;  2N5H A;  3HOX I;  1E0H A;  2E1M A;  5CM2 M;  1K8A Q;  2KG8 A;  1BXI A;  1Y1V I;  3VB9 A;  4EWC A;  2JB0 A;  3CPW O;  4BPF A;  2JS4 A;  2DGY A;  2QR1 B;  1X3Z A;  3MZK B;  5KP7 B;  1JJ2 O;  1Q81 1;  3G1G A;  5IT9 f;  3GTP I;  1D1D A;  5A2Q b;  1VQM Z;  3QWU A;  1NJI Q;  1AUM A;  2PM9 A;  3EJB A;  3CCJ Z;  2FHS C;  5JPA A;  3DPH A;  5C44 I;  4A3I I;  3CMA Z;  3Q20 A;  4MD7 A;  1WII A;  2KW2 A;  3I4N I;  1S72 1;  2PEK A;  2R92 I;  4A3J I;  2DE7 A;  2VLQ A;  4R0M A;  1S72 P;  1ML8 A;  1TWG I;  3D9X A;  3DS4 A;  2N6Z A;  2YAD A;  3B4Q A;  2JMO A;  2IZ4 A;  2KGA A;  4MD8 A;  4XRQ A;  1AA6 A;  2L4B A;  2KWL A;  3FQM A;  2NVT I;  1TWC I;  2E2J I;  2FVA A;  2EHT A;  1VQM 1;  1KC8 1;  2AF8 A;  3PO3 S;  1FDO A;  2I3C A;  3GZL A;  1VQM P;  2GZJ A;  2CQ8 A;  1I3Q I;  1RO4 A;  3CCJ 1;  2R7Z I;  2MR8 A;  3NFZ A;  2EIA A;  4H2X C;  3CCJ P;  3OW2 Z;  2QNW A;  2G2K A;  2GDY A;  2LEX A;  2MD9 A;  3IFU A;  4A3B I;  1I6H I;  2KGD A;  3U43 A;  1RNI A;  1K8A 2;  4A93 I;  1Z01 A;  1ZB9 A;  1VQ5 Z;  4QKO A;  1K30 A;  4BPG A;  2HU9 A;  3J80 f;  3I56 Z;  3RZD I;  1N8R 1;  3H3V J;  3HOW I;  3S1Q I;  2FAE A;  4DK1 A;  4NBD A;  1RO2 A;  2OOX B;  2V8J A;  1Y1W I;  1Q82 2;  4E2Z A;  1NJI 2;  1CEI A;  3GTQ I;  5DCK A;  4HKG A;  1Z02 A;  3S17 I;  7CEI A;  3GTK I;  2DE6 A;  4QTU A;  4DG9 A;  2FQ1 A;  2LKI A;  4QNB A;  2GZF A;  2AKL A;  3CCU 1;  1VQO Z;  3GTJ I;  1VQP Z;  2JIO A;  2JA5 I;  1DNY A;  5C3E I;  3Q87 A;  4H2W C;  5KP8 B;  5D1O B;  3U50 C;  3H0G I;  1VQ5 1;  2EHS A;  2KPI A;  3MZL B;  2HF1 A;  2CNR A;  4PH0 A;  3ESW A;  1VQ5 P;  3P5J B;  3GTL I;  2YU9 I;  3S16 I;  2M8L A;  3I56 1;  3CD6 Z;  2LF4 A;  1HY8 A;  3MON A;  3I56 P;  3G26 A;  5HV8 A;  3D2L A;  1M90 Q;  2VF1 A;  4PH1 A;  3G0V A;  2M6N A;  2QKD A;  3B5I A;  3CCV 1;  2GZI A;  1M6N A;  1TWF I;  1QVF O;  1N2F A;  3LRY A;  4WYM A;  1VQO 1;  2OTL 1;  2PEJ A;  3TDH B;  1VQ7 Z;  4GR2 A;  1VQO P;  2OTL P;  1Q7Y Q;  1VQP P;  3DS5 A;  1YJW Z;  4A3G I;  2JIM A;  2M8P A;  4RVG A;  1QF8 A;  2EG5 A;  1YHQ Z;  2WB1 A;  3E2D A;  3H0D A;  2JAZ A;  3CPW Z;  2FQ0 A;  1K9M 1;  3WBH A;  3CD6 1;  1Y8C A;  3CD6 P;  1Q86 Q;  1QRJ A;  2LFU A;  2NVQ I;  4RVD A;  2K5X A;  2KOD A;  5HVC A;  2LPK A; 
#chains in the Genus database with same CATH homology
 1EOQ A;  1K8A 1;  1KC8 2;  4E2W A;  1YJN Z;  1VQ7 1;  5I4T G;  1VQ7 P;  3I55 Z;  1NJI 1;  2E2H I;  1YJW P;  1YHQ 1;  4XRO A;  1M90 2;  3DS1 A;  2VUM I;  1YHQ P;  4XX2 A;  1VQL Z;  1L1O C;  3CXC Y;  3P05 A;  3NTE A;  2W03 A;  3CCE Z;  2BJO A;  1VQN 1;  1K9M Q;  3DS0 A;  3CME Z;  4MH4 A;  1KD1 Q;  4XFX A;  3M1M A;  1Q7Y 2;  3LUS A;  1YJN 1;  1A43 A;  1K73 Q;  2RPR A;  3HOV I;  1YJN P;  4TNU A;  3CC2 1;  3I55 1;  2JUB A;  3CXC O;  2XT1 A;  3CC2 P;  3I55 P;  3CC4 Z;  1Q86 2;  1VQL 1;  1WW9 A;  1X3W A;  2DE5 A;  1VQL P;  2K5R A;  3VTN A;  3DTJ A;  5HGL A;  3CCE 1;  1KRL A;  3CCE P;  3CCL Z;  2RIQ A;  3CME P;  1WCM I;  1TFI A;  1DL6 A;  2NVY I;  4E33 A;  3G71 Z;  3H4E A;  2RHB A;  3CC7 Z;  2V8K A;  4S1T A;  4MRI A;  1K9M 2;  2QA4 Z;  1M6E X;  1LQL A;  4QTT A;  3G1I A;  1YI2 Z;  1KD1 2;  3S1N I;  4U0E A;  3CMA 1;  3CMA P;  3CCL 1;  1ZB8 A;  1QVF Z;  3TE5 B;  3CCL P;  2B63 I;  1YIJ Z;  1M90 1;  5D1P A;  2JYG A;  3VMH A;  3G71 1;  2ONT A;  5C4J I;  4BBR I;  3CCM Z;  1RO0 A;  3G71 P;  3JAM f;  1YUA A;  2JR6 A;  3CC7 1;  3CC7 P;  1Q7Y 1;  2QA4 1;  1S7M A;  1SFO I;  1YI2 1;  2QA4 P;  1RLY A;  1YI2 P;  3NH4 A;  2OZK A;  2E9H A;  2GTI A;  4E31 A;  1IUQ A;  4XFZ A;  2QLV B;  1Q86 1;  1QVF Y;  1M74 A;  2Y0S A;  1YIJ 1;  3S14 I;  5F2O A;  1YIJ P;  4A3M I;  3I4M I;  4NB8 A;  1M1K Q;  3CCM 1;  3MGE A;  5FLX b;  2J6A A;  3CCM P;  4AYB A;  5D1O A;  2O53 A;  2H85 A;  2JO0 A;  1NP6 A;  3M4O I;  5A2Q f;  3PO3 I;  4BBS I;  2RT9 A;  4HGZ A;  3RZO I;  1BAJ A;  1VQP 1;  5HGN A;  3J81 b;  1YUK A;  3D6W A;  5LL6 f;  3S15 I;  5F2K A;  3IF8 A;  3F3P C;  3CXC Z;  5AN9 F;  1W2B Y;  1KD1 1;  3NH5 A;  2Z44 A;  4IPY A;  3GTM S;  3KIH A;  1R9T I;  1K73 1;  2PEN A;  3G29 A;  3DS2 A;  3G21 A;  3G6E Z;  2P28 A;  2QRC B;  1Y1V S;  2JA6 I;  3GCF A;  4COP A;  1YJW 1;  1M1K 2;  2GU2 A;  4NBB A;  4NB9 A;  1W2B O;  4BXX I;  3H47 A;  1VQK Z;  2V8I A;  3BG1 B;  4E30 A;  2QRE B;  3G6E 1;  4U0D A;  2BHV A;  4A3E I;  1YJ9 Z;  1X0T A;  2RBL A;  2XV6 A;  3G6E P;  1Z03 A;  3CCS Z;  4U0A A;  1RQF A;  4U0B A;  3NDJ A;  5HGO A;  1VQK 1;  4NFR A;  1VQK P;  2QEX Z;  2JA8 I;  3DS3 A;  2P9X A;  3GKQ A;  4A3F I;  2M48 A;  4E2Y A;  2QRD B;  3NDI A;  5IP7 I;  5FLX f;  4X6A I;  3CME 1;  1NUI A;  1YJ9 1;  1YJ9 P;  3CCS 1;  4NBG A;  3HOU I;  2PY8 A;  3CCS P;  4U0C A;  2NVX I;  5IP9 I;  1KQS Y;  3S2D I;  3J81 f;  2PEI A;  4NBA A;  4NBE A;  3CC4 1;  4M0I A;  3CC4 P;  3CCQ Z;  3GTO I;  3EED A;  1Q82 Q;  1VLA A;  4A3K I;  2QEX 1;  1QVG Z;  4A3C I;  2Q4Z A;  2QEX P;  3HOZ I;  5C4X I;  2GTH A;  2JYL A;  3HOY I;  4Y52 I;  1K73 2;  1EIA A;  4RS4 A;  2PK7 A;  3HKZ A;  1M1K 1;  2KI7 B;  5HGM A;  1TWH I;  4RVH A;  4DGL A;  2OTJ Z;  1KQS O;  3GTG I;  2BUO A;  2OAR A;  4HGY A;  3VRL C;  3BG0 B;  3I07 A;  3HYB A;  4NOZ A;  3CCQ 1;  4RVF A;  3EER A;  3CCQ P;  4MXU A;  1Q81 Q;  3CCU Z;  1TWA I;  3PO2 I;  1QVG Y;  1VQ9 Z;  3J7A 4;  2R6M A;  5BS1 A;  2EGT A;  3S1R I;  3RG6 C;  4RV9 A;  4NBC A;  2OOY B;  5F2N A;  4NBF A;  1VQ8 Z;  2JA7 I;  2OTJ 1;  4U0F A;  2WAQ A;  3G28 A;  2OTJ P;  2E2I I;  1QYP A;  2IZ3 A;  1I50 I;  3S2H I;  1W2B Z;  2PEQ A;  3S1M I;  3G4S Z;  4E2X A;  1QVG O;  1K83 I;  2F4O A;  3CCV Z;  3VMI A;  4MD9 A;  2XXM A;  3VMG A;  4GR6 A;  1VQ9 1;  2OTL Z;  2Z46 A;  3CCU P;  3OW2 Y;  1KC8 Q;  1VQ9 P;  1VQ8 1;  5IT9 b;  4A3D I;  1VQ8 P;  4XFY A;  2L6E A;  3T4N B;  2CWO A;  4NBH A;  5T64 A;  3K7A I;  3G4S 1;  1N8R Q;  1Q81 2;  5T6B A;  3M3Y I;  2VUG A;  3G4S P;  2W04 A;  3OW2 O;  4A3L I;  3FKI I;  2R93 I;  2Q51 A;  5FLM I;  4CL1 A;  3CCV P;  2PEM A;  1VQ4 Z;  3HZQ A;  1P9N A;  1VQ6 Z;  3CQZ I;  4NH1 C;  4Y7N I;  1JJ2 Z;  4COC A;  4E32 A;  4BY1 I;  1ZMB A;  5BS2 A;  3CCR Z;  1YIT Z;  1VQN Z;  2P3Y A;  2PEO A;  1E6J P;  2EFJ A;  2JNY A;  3J80 b;  2PMZ A;  4BY7 I;  2ZAE B;  2K3R A;  3JAM b;  3CC2 Z;  1VQ4 1;  1Q82 1;  1VQ6 1;  1KQS Z;  1VQ4 P;  1VQ6 P;  3IX0 A;  1PFT A;  4MON A;  1USP B;  1N8R 2;  3CPW Y;  2M8N A;  3F3F C;  1JJ2 Y;  5T67 A;  3CCR 1;  1A8O A;  2F4M A;  2Z45 A;  1YIT 1;  3CCR P;  1JWH C;  1S72 Z;  3NH8 A;  1YIT P;  2LIY A;  1VQN P;  3GTM I;  1USP A;  1ZH1 A;  3FQQ A;  3KIF A;  4HH4 A;  4DQY B;  3HOX I;  2E1M A;  5CM2 M;  1K8A Q;  1Y1V I;  3VB9 A;  4EWC A;  3CPW O;  2QR1 B;  2JS4 A;  2DGY A;  3MZK B;  1X3Z A;  1JJ2 O;  1Q81 1;  3G1G A;  5IT9 f;  3GTP I;  1D1D A;  5A2Q b;  1VQM Z;  3QWU A;  1NJI Q;  1AUM A;  2PM9 A;  3CCJ Z;  5JPA A;  3DPH A;  5C44 I;  4A3I I;  3CMA Z;  3Q20 A;  4MD7 A;  1WII A;  3I4N I;  1S72 1;  2PEK A;  2R92 I;  4A3J I;  2DE7 A;  1ML8 A;  1S72 P;  3D9X A;  1TWG I;  3DS4 A;  2YAD A;  2JMO A;  2IZ4 A;  4MD8 A;  4XRQ A;  3FQM A;  2NVT I;  1TWC I;  2E2J I;  1VQM 1;  1KC8 1;  3PO3 S;  2I3C A;  1VQM P;  3CCJ 1;  1I3Q I;  1RO4 A;  2R7Z I;  3NFZ A;  2EIA A;  3CCJ P;  3OW2 Z;  2G2K A;  3IFU A;  4A3B I;  1I6H I;  1RNI A;  1K8A 2;  4A93 I;  1Z01 A;  1ZB9 A;  1VQ5 Z;  1K30 A;  2HU9 A;  3J80 f;  1N8R 1;  3I56 Z;  3RZD I;  3H3V J;  3HOW I;  3S1Q I;  4DK1 A;  4NBD A;  1RO2 A;  2OOX B;  2V8J A;  1Y1W I;  1Q82 2;  4E2Z A;  1NJI 2;  3GTQ I;  5DCK A;  1Z02 A;  3S17 I;  3GTK I;  2DE6 A;  4QTU A;  4QNB A;  2AKL A;  3CCU 1;  1VQO Z;  3GTJ I;  1VQP Z;  2JA5 I;  5C3E I;  3Q87 A;  5D1O B;  3U50 C;  1VQ5 1;  3H0G I;  2KPI A;  3MZL B;  2HF1 A;  3ESW A;  4PH0 A;  1VQ5 P;  3P5J B;  3GTL I;  2YU9 I;  3S16 I;  2M8L A;  3I56 1;  3CD6 Z;  2LF4 A;  3MON A;  3I56 P;  3G26 A;  1M90 Q;  2VF1 A;  4PH1 A;  3G0V A;  2M6N A;  2QKD A;  3B5I A;  3CCV 1;  1M6N A;  1TWF I;  1QVF O;  1N2F A;  3LRY A;  4WYM A;  1VQO 1;  2OTL 1;  2PEJ A;  3TDH B;  1VQ7 Z;  4GR2 A;  1VQO P;  2OTL P;  1Q7Y Q;  1VQP P;  3DS5 A;  1YJW Z;  4A3G I;  2M8P A;  4RVG A;  1QF8 A;  2EG5 A;  1YHQ Z;  2WB1 A;  3E2D A;  3H0D A;  3CPW Z;  1K9M 1;  3WBH A;  3CD6 1;  3CD6 P;  1Q86 Q;  1QRJ A;  2LFU A;  2NVQ I;  4RVD A;  2KOD A;  2O4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...