1RNIA

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
210
Chain Sequence
SSERIRYAKWFLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGLVILDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF904
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
total genus 68
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1rniA01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1rniA03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1rniA02
1RNIA 3M1MA 1RO2A 1RO0A
chains in the Genus database with same CATH superfamily
4U0EA 4MD8A 5EJDA 1YJ91 1Q821 1S721 3GTOI 1N2FA 1NP6A 1VQ91 2K5RA 5CM2M 3I56Z 1YUAA 2QKDA 4RVDA 2K0YA 3CD6Z 2VF1A 1VQ6Z 3HYBA 1Q86Q 2AYDA 3CCQ1 2J6AA 3GTGI 4NB8A 5HGLA 1VQ5P 3I55P 2YADA 3G71P 2K2QA 4R0MA 4XFXA 3GTQI 2K94A 3RZOI 2V45A 5FLMI 2NVTI 3GKLC 3HOUI 1VQL1 3H0DA 4GR6A 3G1IA 2JIPA 2QLVB 4A3MI 3D9XA 1R9TI 2KR5A 4PXHB 2E7ZA 3P5JB 2CNRA 3M3YI 4A3FI 2FQ0A 1CEIA 3S1NI 4UHPB 5IP7I 2IZ4A 3IR7A 2M48A 3PO3S 2F4MA 1IMQA 2DE5A 1WIIA 4RVHA 2N98A 2PEQA 2ZAEB 4PWVB 3CPWZ 2XZ1C 3GTMS 1VQ71 2QA41 5I4TG 1BXIA 3CCJP 1VQ8P 1TWAI 5C3EI 4NH1C 2OTJP 1L1OC 2GZEA 2VPYA 2JU2A 3CC4P 2GDWA 1EIAA 2N50A 1ZMBA 3DS4A 2QEX1 1KQSZ 2Z45A 2LEXA 1Q7Y1 2EHSA 1S72P 4NBDA 1M1K1 2BHVA 1VHNA 1N8RQ 1RLYA 2FAEA 3GKQA 4A3JI 2R93I 5KP8B 2OTLP 3CMAZ 2MR8A 3EJBA 3CCU1 3OW2Y 2FVFA 3DS0A 1QVGY 1VQP1 3CCQP 2JUBA 3G4SZ 2JMOA 2EIAA 1VQOZ 2GZGA 2EGTA 4U0BA 4XFZA 2K3RA 4MRIA 2WAQA 3PO3I 1K8AQ 1ZB8A 2BUOA 2LF4A 3J81f 1F80D 1K73Q 4A93I 1Q81Q 2R92I 2RHBA 1NJIQ 4E2WA 4S1TA 2MVVA 1VQLP 1UNKA 1WW9A 1QVFZ 3NH5A 1AF8A 3HOVI 2OARA 3CCV1 2O4HA 4A3CI 4NBFA 1A43A 1VQ4P 2V8KA 2DE6A 2PEKA 4RV9A 3CC21 5HGOA 1VQ7P 2QA4P 5T67A 3G28A 1Z01A 3TDHB 5HGNA 3D2LA 1FDIA 1Q16A 2K0DX 2PEMA 3CCEZ 2QRDB 2KGDA 3HKZA 2K92A 3CPWO 4XFYA 4Y52I 3GZMA 1SIWA 3RG6C 4XX2A 2QEXP 2EG5A 2KG6A 5F2OA 1N8R2 1RQFA 5BS1A 2E2JI 2ERHA 3H47A 1DNYA 1X3OA 3S1MI 3CCUP 2GZFA 1LQLA 5FLXf 2JQ4A 1VQPP 5AN9F 3LRYA 3CCSP 3CCL1 2V8JA 1TFIA 3VMHA 1KQSO 3K7AI 1K732 1YJWP 1JJ2O 1TWCI 2OOXB 1E6JP 1QRJA 3RG2A 2R6MA 3B4QA 2FACA 3G6EP 1M6NA 1BAJA 1YHQZ 3QWUA 3GTLI 2GZIA 2M6NA 3CCVP 2KGCA 3CC7P 4IPYA 4BPGA 3EJEA 1Z03A 3I561 2BJOA 1I3QI 4BBRI 2E1MA 3CD61 4QKOA 1VQ61 3MZLB 3NDJA 1QVFO 2M8NA 4COPA 1Q7Y2 2JA8I 3CQZI 2JA7I 2W03A 2LIWA 2MD9A 3MGEA 4CL1A 3S1QI 2L0QA 5C44I 2N6YA 4U0AA 1QF8A 1Y1WI 1M901 2QR1B 4HH4A 3FQQA 5D1OA 2IV2X 3BG0B 2R7ZI 3S2HI 2K0XA 4IZ6A 1ZB9A 2GYKA 1VLAA 3I55Z 3F3PC 4CA3A 3OW2Z 3CCLP 1QVGZ 4NBBA 2XZ0D 3G71Z 2LL8A 1IMPA 3DS1A 2AVAA 1OR5A 2I3CA 2W04A 4E33A 2OZKA 1P9NA 3NH8A 1YITP 2ONTA 3CXCY 2GDYA 1VQNZ 3S2DI 2LFUA 2L6EA 5C4JI 2KWLA 3GZLA 2M8LA 5D1PA 1Z6MA 3HZQA 3G21A 2K5XA 2CG5B 1YJNP 3FQMA 2M5RA 3CMA1 3CD6P 4BBSI 3CCJZ 3DS5A 3S1RI 3G4S1 1VQ8Z 1RO0A 2RT9A 2KG8A 1K9M1 4NB9A 1VQO1 2GTHA 2OOYB 3EEDA 2E2HI 2L9FA 2DNWA 3WBHA 2JGPA 2KODA 3D6WA 3GJNA 2NVQI 2CQ8A 3NY7B 4E31A 1YJ9P 1VQKZ 1RO4A 1ZNVA 2KGEA 2KPIA 3G26A 1DV5A 3IF8A 4NOZA 1VQ9P 3CCMZ 2XXMA 3NTEA 3JAMf 2WPTA 4MXUA 4RVFA 1YIJZ 1VQMZ 4TNUA 1AA6A 1KD11 1K30A 1KC81 4H2YC 1WZNA 4MH4A 3I4MI 4F37A 2VLQA 4NBHA 3GTKI 3GTMI 2KG9A 3CCE1 3CMEZ 1HQBA 3TE5B 3HOWI 3CCRZ 1USPA 3OW2O 3KIFA 2KW2A 3EERA 1JWHC 1VQ4Z 2JAZA 2F4OA 2YU9I 3CMAP 4H2WC 1YI2Z 1M902 2Q4ZA 2FADA 2KOOA 5D1OB 3G4SP 1YUKA 3J80f 1Q822 1Q7YQ 1VQOP 5A2Qf 2JIMA 2ROQA 3IFUA 3G0VA 3J81b 5F2KA 3E2DA 4H2XC 4MRTC 2PK7A 3S14I 1YHQ1 1TWFI 3ESWA 2V3VA 2V8IA 3LUSA 5DCKA 3DS2A 3VB9A 3CPWY 4XRQA 1M74A 1X3WA 4RS4A 1W2BY 2FQ2A 2RIQA 2PMZA 2L4BA 1VKUA 3HOXI 3CCSZ 4BY7I 1NUIA 3M4OI 4NBGA 2DE7A 4MONA 2VPWA 1FR2A 3HOZI 3J80b 4E2YA 1YJWZ 2P9XA 2PM9A 1QYPA 1AYIA 5A2Qb 5F2NA 4NBCA 2VUMI 1T8KA 3G6EZ 2JO0A 2JIOA 3CXCZ 1K9M2 4DK1A 1RNIA 1JJ2Y 4BPFA 4NEOA 3CC7Z 3KIHA 2E2II 1E0HA 5IT9f 3B5IA 2MR7A 3Q87A 3CC2P 3I551 3GTJI 1WJ2A 5FLXb 1M1K2 3G711 1PFTA 2G2KA 1VQN1 1Q861 4HKGA 1KD12 3T4NB 3PO2I 1YHQP 2LOLA 1KC82 2DGYA 3P05A 3GTPI 4PH0A 1EMVA 2CWOA 3EJDA 1M6EX 1VQ5Z 1USPB 2FVEA 2AFDA 3BG1B 3CCJ1 5IT9b 3CE7A 1VQ81 4BY1I 2OTJ1 2NVYI 2FQ1A 2EFJA 1YITZ 3GCFA 1K83I 4A3GI 1L0HA 2NO8A 2KI7B 3DS3A 2JA6I 4A3II 2B63I 3LMOA 4HGZA 4A3DI 2MY5A 2N6ZA 2E9HA 2IZ3A 3Q20A 1VQK1 2GDXA 3VMIA 1YJNZ 4M0IA 2AF8A 5HVCA 3RZDI 2OTL1 3CCM1 5T64A 3I56P 3M1MA 5HV8A 1M90Q 1FDOA 1VQ6P 3IX0A 3CXCO 3FKII 1YIJ1 4DGLA 1VQM1 2P3YA 4E2ZA 1I6HI 1Q82Q 2OTJZ 2CGQA 4EWCA 3NH4A 1RO2A 4NBAA 1IUQA 1N8R1 2Z46A 1S7MA 4XROA 3MZKB 2QNWA 3CC4Z 3U50C 1VQNP 2VLPA 4GR2A 5C4XI 2PY8A 2PEJA 3CME1 4PH1A 4DQYB 1YJ9Z 4MD7A 2JYGA 3CCR1 1MZ8A 1S72Z 2JS4A 1VQ9Z 1L0IA 2OTLZ 1WCMI 1K8A1 1VQ41 2GU2A 2JA5I 1K731 4COCA 2JB0A 2PENA 2PEOA 4NBEA 4A3EI 1Q811 3H0GI 3CCQZ 1YI21 1NJI1 2EHTA 4X6AI 1W2BZ 3G1GA 1KLPA 2LIYA 5BS2A 2X2BA 5JPAA 4U0FA 1Y8CA 1VQLZ 4E30A 2XV6A 2VPXA 5IP9I 2FHSC 1QVGO 1K9MQ 2XT1A 1VQKP 2VUGA 4QTUA 1JJ2Z 2MVUA 1Q862 3CCMP 2JIQA 3J7A4 1GXHA 1VQ7Z 2QA4Z 3S17I 4DG9A 3CCS1 1X0TA 3JAMb 4QNBA 4U0DA 1YIJP 1DL6A 1VQMP 2PEIA 2FVAA 4WYMA 1M1KQ 1YJW1 3U43A 2KOQA 2VLNA 3G6E1 1UJZA 3G29A 3I07A 2AKLA 2Z44A 3CMEP 2QEXZ 1KD1Q 1D1DA 3CCRP 3S16I 2LMLA 5EW5E 2MF4A 2LIUA 1ML8A 1KC8Q 3CC71 4RVGA 2JBGA 2N5HA 4E2XA 3CCUZ 1X3ZA 1VQPZ 1YI2P 1GXGA 1Z02A 5HGMA 3VRLC 2LPKA 2K93A 1HY8A 2QREB 4A3KI 2GTIA 3I4NI 2M8PA 2LTEA 5LL6f 2QRCB 2JYLA 1EOQA 1GPJA 4U0CA 3CCEP 2Q51A 1KQSY 1SFOI 4BPHA 5CZDB 2GZJA 1W2BO 4NFRA 3CCVZ 1Y1VS 2O53A 2WB1A 3VTNA 2AFEA 2JNYA 1I50I 3CC2Z 2LKIA 2HU9A 3DTJA 4A3LI 4Y7NI 1VQ51 1AUMA 3S15I 4QTTA 1ZH1A 2KOSA 4AYBA 1K8A2 4BXXI 3MONA 3NDIA 1YIT1 1Q812 5T6BA 3F3FC 1NJI2 1QVFY 1TWGI 2VPZA 1A8OA 3DPHA 7CEIA 2VLOA 1YJN1 1TWHI 2KORA 2KGAA 1KRLA 2NAPA 2KOPA 2N5IA 2VSQA 5KP6B 3VMGA 2RBLA 3H4EA 1QXFA 4E32A 4A3BI 2JU1A 2PNGA 2H85A 3CCLZ 2JR6A 1Y1VI 4HGYA 2RPRA 1NQ4A 2L22A 3HOYI 5KP7B 4MD9A 1ACPA 2JIRA 2HF1A 3H3VJ 2P28A 3NFZA 3CC41 2NVXI 2Y0SA
chains in the Genus database with same CATH topology
4U0EA 4MD8A 1YJ91 1Q821 1S721 3GTOI 1N2FA 1NP6A 1VQ91 2K5RA 5CM2M 3I56Z 1YUAA 2QKDA 4RVDA 3CD6Z 2VF1A 1VQ6Z 3HYBA 1Q86Q 3GTGI 3CCQ1 2J6AA 4NB8A 5HGLA 1VQ5P 3I55P 2YADA 3G71P 4XFXA 3GTQI 3RZOI 5FLMI 2NVTI 3HOUI 1VQL1 3H0DA 4GR6A 3G1IA 2QLVB 4A3MI 3D9XA 1R9TI 3P5JB 3M3YI 4A3FI 3S1NI 5IP7I 2IZ4A 2M48A 3PO3S 2F4MA 2DE5A 1WIIA 4RVHA 2PEQA 2ZAEB 3CPWZ 3GTMS 1VQ71 2QA41 5I4TG 3CCJP 1VQ8P 1TWAI 5C3EI 4NH1C 2OTJP 1L1OC 3CC4P 1EIAA 1ZMBA 3DS4A 2QEX1 1KQSZ 2Z45A 1Q7Y1 1S72P 4NBDA 1M1K1 2BHVA 1N8RQ 1RLYA 3GKQA 4A3JI 2R93I 2OTLP 3CMAZ 3CCU1 3OW2Y 1QVGY 3DS0A 1VQP1 3CCQP 2JUBA 3G4SZ 2JMOA 2EIAA 1VQOZ 2EGTA 4U0BA 2K3RA 4XFZA 4MRIA 2WAQA 3PO3I 1K8AQ 1ZB8A 2BUOA 2LF4A 3J81f 1K73Q 4A93I 1Q81Q 2R92I 2RHBA 1NJIQ 4E2WA 4S1TA 1VQLP 1WW9A 1QVFZ 3NH5A 3HOVI 2OARA 3CCV1 2O4HA 4A3CI 4NBFA 1A43A 1VQ4P 2V8KA 2DE6A 2PEKA 4RV9A 3CC21 5HGOA 1VQ7P 2QA4P 5T67A 3G28A 1Z01A 3TDHB 5HGNA 2PEMA 3CCEZ 2QRDB 3HKZA 4Y52I 3CPWO 4XFYA 3RG6C 4XX2A 2QEXP 2EG5A 5F2OA 1N8R2 1RQFA 5BS1A 2E2JI 3H47A 3S1MI 3CCUP 1LQLA 5FLXf 1VQPP 5AN9F 3LRYA 3CCSP 3CCL1 2V8JA 1TFIA 3VMHA 1KQSO 3K7AI 1K732 1YJWP 1JJ2O 1TWCI 2OOXB 1E6JP 1QRJA 2R6MA 3G6EP 1M6NA 1BAJA 1YHQZ 3QWUA 3GTLI 2M6NA 3CCVP 3CC7P 4IPYA 1Z03A 3I561 2BJOA 1I3QI 4BBRI 2E1MA 3CD61 1VQ61 3MZLB 3NDJA 1QVFO 2M8NA 4COPA 1Q7Y2 2JA8I 3CQZI 2JA7I 2W03A 3MGEA 4CL1A 3S1QI 5C44I 4U0AA 1QF8A 1Y1WI 1M901 2QR1B 4HH4A 3FQQA 5D1OA 2R7ZI 3BG0B 3S2HI 1ZB9A 1VLAA 3I55Z 3F3PC 3OW2Z 1QVGZ 3CCLP 4NBBA 3G71Z 3DS1A 2I3CA 2W04A 4E33A 2OZKA 1P9NA 3NH8A 1YITP 2ONTA 3CXCY 1VQNZ 3S2DI 2LFUA 2L6EA 5C4JI 2M8LA 5D1PA 3HZQA 3G21A 1YJNP 3FQMA 3CMA1 3CD6P 4BBSI 3CCJZ 3DS5A 3S1RI 3G4S1 1VQ8Z 1RO0A 2RT9A 1K9M1 4NB9A 1VQO1 2GTHA 2OOYB 3EEDA 2E2HI 3WBHA 2KODA 3D6WA 2NVQI 4E31A 1YJ9P 1VQKZ 1RO4A 2KPIA 3G26A 3IF8A 4NOZA 1VQ9P 3CCMZ 2XXMA 3NTEA 3JAMf 4MXUA 4RVFA 1YIJZ 1VQMZ 4TNUA 1KD11 1K30A 1KC81 4MH4A 3I4MI 4NBHA 3GTKI 3GTMI 3CCE1 3CMEZ 3TE5B 3HOWI 3CCRZ 1USPA 3OW2O 3KIFA 3EERA 1JWHC 1VQ4Z 2F4OA 2YU9I 3CMAP 1YI2Z 1M902 2Q4ZA 5D1OB 3G4SP 1YUKA 3J80f 1Q822 1Q7YQ 1VQOP 5A2Qf 3IFUA 3G0VA 3J81b 5F2KA 3E2DA 2PK7A 3S14I 1YHQ1 1TWFI 3ESWA 2V8IA 3LUSA 5DCKA 3DS2A 3VB9A 3CPWY 4XRQA 1M74A 1X3WA 4RS4A 1W2BY 2RIQA 2PMZA 3CCSZ 3HOXI 4BY7I 1NUIA 3M4OI 4NBGA 2DE7A 4MONA 3HOZI 3J80b 4E2YA 1YJWZ 2P9XA 2PM9A 1QYPA 5A2Qb 5F2NA 4NBCA 2VUMI 3G6EZ 2JO0A 3CXCZ 1K9M2 4DK1A 1RNIA 1JJ2Y 3CC7Z 3KIHA 2E2II 5IT9f 3B5IA 3Q87A 3CC2P 3I551 3GTJI 5FLXb 1M1K2 3G711 1PFTA 2G2KA 1VQN1 1Q861 1KD12 3T4NB 3PO2I 1YHQP 1KC82 2DGYA 3P05A 3GTPI 4PH0A 2CWOA 1M6EX 1VQ5Z 1USPB 3BG1B 3CCJ1 5IT9b 1VQ81 4BY1I 2OTJ1 2NVYI 2EFJA 1YITZ 3GCFA 1K83I 4A3GI 2KI7B 3DS3A 2JA6I 4A3II 2B63I 4HGZA 4A3DI 2IZ3A 2E9HA 3Q20A 1VQK1 3VMIA 1YJNZ 4M0IA 3RZDI 2OTL1 3CCM1 5T64A 3I56P 3M1MA 1M90Q 1VQ6P 3IX0A 3CXCO 3FKII 1YIJ1 4DGLA 1VQM1 2P3YA 4E2ZA 1I6HI 1Q82Q 2OTJZ 4EWCA 3NH4A 1RO2A 4NBAA 1IUQA 1N8R1 2Z46A 1S7MA 4XROA 3MZKB 3CC4Z 3U50C 1VQNP 5C4XI 4GR2A 2PY8A 2PEJA 3CME1 4PH1A 4DQYB 1YJ9Z 4MD7A 2JYGA 3CCR1 1S72Z 2JS4A 1VQ9Z 2OTLZ 1WCMI 1K8A1 1VQ41 2GU2A 2JA5I 1K731 4COCA 2PENA 2PEOA 4NBEA 1Q811 4A3EI 3H0GI 3CCQZ 1YI21 1NJI1 4X6AI 1W2BZ 3G1GA 2LIYA 5BS2A 5JPAA 4U0FA 1VQLZ 4E30A 2XV6A 5IP9I 1K9MQ 1QVGO 2XT1A 1VQKP 2VUGA 4QTUA 1JJ2Z 1Q862 3CCMP 3J7A4 1VQ7Z 2QA4Z 3S17I 3CCS1 1X0TA 3JAMb 4QNBA 4U0DA 1YIJP 1DL6A 1VQMP 2PEIA 4WYMA 1M1KQ 1YJW1 3G6E1 3G29A 3I07A 2AKLA 2Z44A 3CMEP 2QEXZ 1KD1Q 1D1DA 3CCRP 3S16I 3CC71 1ML8A 1KC8Q 4RVGA 4E2XA 3CCUZ 1X3ZA 1VQPZ 1YI2P 1Z02A 5HGMA 3VRLC 2QREB 4A3KI 3I4NI 2GTIA 2M8PA 5LL6f 2QRCB 2JYLA 1EOQA 2Q51A 4U0CA 3CCEP 1KQSY 1SFOI 1W2BO 4NFRA 3CCVZ 1Y1VS 2O53A 2WB1A 3VTNA 2JNYA 1I50I 3CC2Z 2HU9A 3DTJA 4A3LI 4Y7NI 1VQ51 1AUMA 3S15I 4QTTA 1ZH1A 4AYBA 1K8A2 4BXXI 3MONA 3NDIA 1YIT1 1Q812 5T6BA 3F3FC 1NJI2 1QVFY 1TWGI 1A8OA 3DPHA 1YJN1 1TWHI 1KRLA 3VMGA 2RBLA 3H4EA 4E32A 4A3BI 2H85A 3CCLZ 2JR6A 1Y1VI 4HGYA 2RPRA 3HOYI 4MD9A 2HF1A 3H3VJ 2P28A 3NFZA 3CC41 2NVXI 2Y0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RNI A;  3M1M A;  1RO2 A;  1RO0 A; 
#chains in the Genus database with same CATH topology
 4U0E A;  4MD8 A;  5EJD A;  1YJ9 1;  1Q82 1;  1S72 1;  3GTO I;  1N2F A;  1NP6 A;  1VQ9 1;  2K5R A;  5CM2 M;  3I56 Z;  1YUA A;  2QKD A;  4RVD A;  2K0Y A;  3CD6 Z;  2VF1 A;  1VQ6 Z;  3HYB A;  1Q86 Q;  2AYD A;  3CCQ 1;  2J6A A;  3GTG I;  4NB8 A;  5HGL A;  1VQ5 P;  3I55 P;  2YAD A;  3G71 P;  2K2Q A;  4R0M A;  4XFX A;  3GTQ I;  2K94 A;  3RZO I;  2V45 A;  5FLM I;  2NVT I;  3GKL C;  3HOU I;  1VQL 1;  3H0D A;  4GR6 A;  3G1I A;  2JIP A;  2QLV B;  4A3M I;  3D9X A;  1R9T I;  2KR5 A;  4PXH B;  2E7Z A;  3P5J B;  2CNR A;  3M3Y I;  4A3F I;  2FQ0 A;  1CEI A;  3S1N I;  4UHP B;  5IP7 I;  2IZ4 A;  3IR7 A;  2M48 A;  3PO3 S;  2F4M A;  1IMQ A;  2DE5 A;  1WII A;  4RVH A;  2N98 A;  2PEQ A;  2ZAE B;  4PWV B;  3CPW Z;  2XZ1 C;  3GTM S;  1VQ7 1;  2QA4 1;  5I4T G;  1BXI A;  3CCJ P;  1VQ8 P;  1TWA I;  5C3E I;  4NH1 C;  2OTJ P;  1L1O C;  2GZE A;  2VPY A;  2JU2 A;  3CC4 P;  2GDW A;  1EIA A;  2N50 A;  1ZMB A;  3DS4 A;  2QEX 1;  1KQS Z;  2Z45 A;  2LEX A;  1Q7Y 1;  2EHS A;  1S72 P;  4NBD A;  1M1K 1;  2BHV A;  1VHN A;  1N8R Q;  1RLY A;  2FAE A;  3GKQ A;  4A3J I;  2R93 I;  5KP8 B;  2OTL P;  3CMA Z;  2MR8 A;  3EJB A;  3CCU 1;  3OW2 Y;  2FVF A;  3DS0 A;  1QVG Y;  1VQP 1;  3CCQ P;  2JUB A;  3G4S Z;  2JMO A;  2EIA A;  1VQO Z;  2GZG A;  2EGT A;  4U0B A;  4XFZ A;  2K3R A;  4MRI A;  2WAQ A;  3PO3 I;  1K8A Q;  1ZB8 A;  2BUO A;  2LF4 A;  3J81 f;  1F80 D;  1K73 Q;  4A93 I;  1Q81 Q;  2R92 I;  2RHB A;  1NJI Q;  4E2W A;  4S1T A;  2MVV A;  1VQL P;  1UNK A;  1WW9 A;  1QVF Z;  3NH5 A;  1AF8 A;  3HOV I;  2OAR A;  3CCV 1;  2O4H A;  4A3C I;  4NBF A;  1A43 A;  1VQ4 P;  2V8K A;  2DE6 A;  2PEK A;  4RV9 A;  3CC2 1;  5HGO A;  1VQ7 P;  2QA4 P;  5T67 A;  3G28 A;  1Z01 A;  3TDH B;  5HGN A;  3D2L A;  1FDI A;  1Q16 A;  2K0D X;  2PEM A;  3CCE Z;  2QRD B;  2KGD A;  3HKZ A;  2K92 A;  3CPW O;  4XFY A;  4Y52 I;  3GZM A;  1SIW A;  3RG6 C;  4XX2 A;  2QEX P;  2EG5 A;  2KG6 A;  5F2O A;  1N8R 2;  1RQF A;  5BS1 A;  2E2J I;  2ERH A;  3H47 A;  1DNY A;  1X3O A;  3S1M I;  3CCU P;  2GZF A;  1LQL A;  5FLX f;  2JQ4 A;  1VQP P;  5AN9 F;  3LRY A;  3CCS P;  3CCL 1;  2V8J A;  1TFI A;  3VMH A;  1KQS O;  3K7A I;  1K73 2;  1YJW P;  1JJ2 O;  1TWC I;  2OOX B;  1E6J P;  1QRJ A;  3RG2 A;  2R6M A;  3B4Q A;  2FAC A;  3G6E P;  1M6N A;  1BAJ A;  1YHQ Z;  3QWU A;  3GTL I;  2GZI A;  2M6N A;  3CCV P;  2KGC A;  3CC7 P;  4IPY A;  4BPG A;  3EJE A;  1Z03 A;  3I56 1;  2BJO A;  1I3Q I;  4BBR I;  2E1M A;  3CD6 1;  4QKO A;  1VQ6 1;  3MZL B;  3NDJ A;  1QVF O;  2M8N A;  4COP A;  1Q7Y 2;  2JA8 I;  3CQZ I;  2JA7 I;  2W03 A;  2LIW A;  2MD9 A;  3MGE A;  4CL1 A;  3S1Q I;  2L0Q A;  5C44 I;  2N6Y A;  4U0A A;  1QF8 A;  1Y1W I;  1M90 1;  2QR1 B;  4HH4 A;  3FQQ A;  5D1O A;  2IV2 X;  3BG0 B;  2R7Z I;  3S2H I;  2K0X A;  4IZ6 A;  1ZB9 A;  2GYK A;  1VLA A;  3I55 Z;  3F3P C;  4CA3 A;  3OW2 Z;  3CCL P;  1QVG Z;  4NBB A;  2XZ0 D;  3G71 Z;  2LL8 A;  1IMP A;  3DS1 A;  2AVA A;  1OR5 A;  2I3C A;  2W04 A;  4E33 A;  2OZK A;  1P9N A;  3NH8 A;  1YIT P;  2ONT A;  3CXC Y;  2GDY A;  1VQN Z;  3S2D I;  2LFU A;  2L6E A;  5C4J I;  2KWL A;  3GZL A;  2M8L A;  5D1P A;  1Z6M A;  3HZQ A;  3G21 A;  2K5X A;  2CG5 B;  1YJN P;  3FQM A;  2M5R A;  3CMA 1;  3CD6 P;  4BBS I;  3CCJ Z;  3DS5 A;  3S1R I;  3G4S 1;  1VQ8 Z;  1RO0 A;  2RT9 A;  2KG8 A;  1K9M 1;  4NB9 A;  1VQO 1;  2GTH A;  2OOY B;  3EED A;  2E2H I;  2L9F A;  2DNW A;  3WBH A;  2JGP A;  2KOD A;  3D6W A;  3GJN A;  2NVQ I;  2CQ8 A;  3NY7 B;  4E31 A;  1YJ9 P;  1VQK Z;  1RO4 A;  1ZNV A;  2KGE A;  2KPI A;  3G26 A;  1DV5 A;  3IF8 A;  4NOZ A;  1VQ9 P;  3CCM Z;  2XXM A;  3NTE A;  3JAM f;  2WPT A;  4MXU A;  4RVF A;  1YIJ Z;  1VQM Z;  4TNU A;  1AA6 A;  1KD1 1;  1K30 A;  1KC8 1;  4H2Y C;  1WZN A;  4MH4 A;  3I4M I;  4F37 A;  2VLQ A;  4NBH A;  3GTK I;  3GTM I;  2KG9 A;  3CCE 1;  3CME Z;  1HQB A;  3TE5 B;  3HOW I;  3CCR Z;  1USP A;  3OW2 O;  3KIF A;  2KW2 A;  3EER A;  1JWH C;  1VQ4 Z;  2JAZ A;  2F4O A;  2YU9 I;  3CMA P;  4H2W C;  1YI2 Z;  1M90 2;  2Q4Z A;  2FAD A;  2KOO A;  5D1O B;  3G4S P;  1YUK A;  3J80 f;  1Q82 2;  1Q7Y Q;  1VQO P;  5A2Q f;  2JIM A;  2ROQ A;  3IFU A;  3G0V A;  3J81 b;  5F2K A;  3E2D A;  4H2X C;  4MRT C;  2PK7 A;  3S14 I;  1YHQ 1;  1TWF I;  3ESW A;  2V3V A;  2V8I A;  3LUS A;  5DCK A;  3DS2 A;  3VB9 A;  3CPW Y;  4XRQ A;  1M74 A;  1X3W A;  4RS4 A;  1W2B Y;  2FQ2 A;  2RIQ A;  2PMZ A;  2L4B A;  1VKU A;  3HOX I;  3CCS Z;  4BY7 I;  1NUI A;  3M4O I;  4NBG A;  2DE7 A;  4MON A;  2VPW A;  1FR2 A;  3HOZ I;  3J80 b;  4E2Y A;  1YJW Z;  2P9X A;  2PM9 A;  1QYP A;  1AYI A;  5A2Q b;  5F2N A;  4NBC A;  2VUM I;  1T8K A;  3G6E Z;  2JO0 A;  2JIO A;  3CXC Z;  1K9M 2;  4DK1 A;  1RNI A;  1JJ2 Y;  4BPF A;  4NEO A;  3CC7 Z;  3KIH A;  2E2I I;  1E0H A;  5IT9 f;  3B5I A;  2MR7 A;  3Q87 A;  3CC2 P;  3I55 1;  3GTJ I;  1WJ2 A;  5FLX b;  1M1K 2;  3G71 1;  1PFT A;  2G2K A;  1VQN 1;  1Q86 1;  4HKG A;  1KD1 2;  3T4N B;  3PO2 I;  1YHQ P;  2LOL A;  1KC8 2;  2DGY A;  3P05 A;  3GTP I;  4PH0 A;  1EMV A;  2CWO A;  3EJD A;  1M6E X;  1VQ5 Z;  1USP B;  2FVE A;  2AFD A;  3BG1 B;  3CCJ 1;  5IT9 b;  3CE7 A;  1VQ8 1;  4BY1 I;  2OTJ 1;  2NVY I;  2FQ1 A;  2EFJ A;  1YIT Z;  3GCF A;  1K83 I;  4A3G I;  1L0H A;  2NO8 A;  2KI7 B;  3DS3 A;  2JA6 I;  4A3I I;  2B63 I;  3LMO A;  4HGZ A;  4A3D I;  2MY5 A;  2N6Z A;  2E9H A;  2IZ3 A;  3Q20 A;  1VQK 1;  2GDX A;  3VMI A;  1YJN Z;  4M0I A;  2AF8 A;  5HVC A;  3RZD I;  2OTL 1;  3CCM 1;  5T64 A;  3I56 P;  3M1M A;  5HV8 A;  1M90 Q;  1FDO A;  1VQ6 P;  3IX0 A;  3CXC O;  3FKI I;  1YIJ 1;  4DGL A;  1VQM 1;  2P3Y A;  4E2Z A;  1I6H I;  1Q82 Q;  2OTJ Z;  2CGQ A;  4EWC A;  3NH4 A;  1RO2 A;  4NBA A;  1IUQ A;  1N8R 1;  2Z46 A;  1S7M A;  4XRO A;  3MZK B;  2QNW A;  3CC4 Z;  3U50 C;  1VQN P;  2VLP A;  4GR2 A;  5C4X I;  2PY8 A;  2PEJ A;  3CME 1;  4PH1 A;  4DQY B;  1YJ9 Z;  4MD7 A;  2JYG A;  3CCR 1;  1MZ8 A;  1S72 Z;  2JS4 A;  1VQ9 Z;  1L0I A;  2OTL Z;  1WCM I;  1K8A 1;  1VQ4 1;  2GU2 A;  2JA5 I;  1K73 1;  4COC A;  2JB0 A;  2PEN A;  2PEO A;  4NBE A;  4A3E I;  1Q81 1;  3H0G I;  3CCQ Z;  1YI2 1;  1NJI 1;  2EHT A;  4X6A I;  1W2B Z;  3G1G A;  1KLP A;  2LIY A;  5BS2 A;  2X2B A;  5JPA A;  4U0F A;  1Y8C A;  1VQL Z;  4E30 A;  2XV6 A;  2VPX A;  5IP9 I;  2FHS C;  1QVG O;  1K9M Q;  2XT1 A;  1VQK P;  2VUG A;  4QTU A;  1JJ2 Z;  2MVU A;  1Q86 2;  3CCM P;  2JIQ A;  3J7A 4;  1GXH A;  1VQ7 Z;  2QA4 Z;  3S17 I;  4DG9 A;  3CCS 1;  1X0T A;  3JAM b;  4QNB A;  4U0D A;  1YIJ P;  1DL6 A;  1VQM P;  2PEI A;  2FVA A;  4WYM A;  1M1K Q;  1YJW 1;  3U43 A;  2KOQ A;  2VLN A;  3G6E 1;  1UJZ A;  3G29 A;  3I07 A;  2AKL A;  2Z44 A;  3CME P;  2QEX Z;  1KD1 Q;  1D1D A;  3CCR P;  3S16 I;  2LML A;  5EW5 E;  2MF4 A;  2LIU A;  1ML8 A;  1KC8 Q;  3CC7 1;  4RVG A;  2JBG A;  2N5H A;  4E2X A;  3CCU Z;  1X3Z A;  1VQP Z;  1YI2 P;  1GXG A;  1Z02 A;  5HGM A;  3VRL C;  2LPK A;  2K93 A;  1HY8 A;  2QRE B;  4A3K I;  2GTI A;  3I4N I;  2M8P A;  2LTE A;  5LL6 f;  2QRC B;  2JYL A;  1EOQ A;  1GPJ A;  4U0C A;  3CCE P;  2Q51 A;  1KQS Y;  1SFO I;  4BPH A;  5CZD B;  2GZJ A;  1W2B O;  4NFR A;  3CCV Z;  1Y1V S;  2O53 A;  2WB1 A;  3VTN A;  2AFE A;  2JNY A;  1I50 I;  3CC2 Z;  2LKI A;  2HU9 A;  3DTJ A;  4A3L I;  4Y7N I;  1VQ5 1;  1AUM A;  3S15 I;  4QTT A;  1ZH1 A;  2KOS A;  4AYB A;  1K8A 2;  4BXX I;  3MON A;  3NDI A;  1YIT 1;  1Q81 2;  5T6B A;  3F3F C;  1NJI 2;  1QVF Y;  1TWG I;  2VPZ A;  1A8O A;  3DPH A;  7CEI A;  2VLO A;  1YJN 1;  1TWH I;  2KOR A;  2KGA A;  1KRL A;  2NAP A;  2KOP A;  2N5I A;  2VSQ A;  5KP6 B;  3VMG A;  2RBL A;  3H4E A;  1QXF A;  4E32 A;  4A3B I;  2JU1 A;  2PNG A;  2H85 A;  3CCL Z;  2JR6 A;  1Y1V I;  4HGY A;  2RPR A;  1NQ4 A;  2L22 A;  3HOY I;  5KP7 B;  4MD9 A;  1ACP A;  2JIR A;  2HF1 A;  3H3V J;  2P28 A;  3NFZ A;  3CC4 1;  2NVX I;  2Y0S A; 
#chains in the Genus database with same CATH homology
 4U0E A;  4MD8 A;  1YJ9 1;  1Q82 1;  1S72 1;  3GTO I;  1N2F A;  1NP6 A;  1VQ9 1;  2K5R A;  5CM2 M;  3I56 Z;  1YUA A;  2QKD A;  4RVD A;  3CD6 Z;  2VF1 A;  1VQ6 Z;  3HYB A;  1Q86 Q;  3GTG I;  3CCQ 1;  2J6A A;  4NB8 A;  5HGL A;  1VQ5 P;  3I55 P;  2YAD A;  3G71 P;  4XFX A;  3GTQ I;  3RZO I;  5FLM I;  2NVT I;  3HOU I;  1VQL 1;  3H0D A;  4GR6 A;  3G1I A;  2QLV B;  4A3M I;  3D9X A;  1R9T I;  3P5J B;  3M3Y I;  4A3F I;  3S1N I;  5IP7 I;  2IZ4 A;  2M48 A;  3PO3 S;  2F4M A;  2DE5 A;  1WII A;  4RVH A;  2PEQ A;  2ZAE B;  3CPW Z;  3GTM S;  1VQ7 1;  2QA4 1;  5I4T G;  3CCJ P;  1VQ8 P;  1TWA I;  5C3E I;  4NH1 C;  2OTJ P;  1L1O C;  3CC4 P;  1EIA A;  1ZMB A;  3DS4 A;  2QEX 1;  1KQS Z;  2Z45 A;  1Q7Y 1;  1S72 P;  4NBD A;  1M1K 1;  2BHV A;  1N8R Q;  1RLY A;  3GKQ A;  4A3J I;  2R93 I;  2OTL P;  3CMA Z;  3CCU 1;  3OW2 Y;  1QVG Y;  3DS0 A;  1VQP 1;  3CCQ P;  2JUB A;  3G4S Z;  2JMO A;  2EIA A;  1VQO Z;  2EGT A;  4U0B A;  2K3R A;  4XFZ A;  4MRI A;  2WAQ A;  3PO3 I;  1K8A Q;  1ZB8 A;  2BUO A;  2LF4 A;  3J81 f;  1K73 Q;  4A93 I;  1Q81 Q;  2R92 I;  2RHB A;  1NJI Q;  4E2W A;  4S1T A;  1VQL P;  1WW9 A;  1QVF Z;  3NH5 A;  3HOV I;  2OAR A;  3CCV 1;  2O4H A;  4A3C I;  4NBF A;  1A43 A;  1VQ4 P;  2V8K A;  2DE6 A;  2PEK A;  4RV9 A;  3CC2 1;  5HGO A;  1VQ7 P;  2QA4 P;  5T67 A;  3G28 A;  1Z01 A;  3TDH B;  5HGN A;  2PEM A;  3CCE Z;  2QRD B;  3HKZ A;  4Y52 I;  3CPW O;  4XFY A;  3RG6 C;  4XX2 A;  2QEX P;  2EG5 A;  5F2O A;  1N8R 2;  1RQF A;  5BS1 A;  2E2J I;  3H47 A;  3S1M I;  3CCU P;  1LQL A;  5FLX f;  1VQP P;  5AN9 F;  3LRY A;  3CCS P;  3CCL 1;  2V8J A;  1TFI A;  3VMH A;  1KQS O;  3K7A I;  1K73 2;  1YJW P;  1JJ2 O;  1TWC I;  2OOX B;  1E6J P;  1QRJ A;  2R6M A;  3G6E P;  1M6N A;  1BAJ A;  1YHQ Z;  3QWU A;  3GTL I;  2M6N A;  3CCV P;  3CC7 P;  4IPY A;  1Z03 A;  3I56 1;  2BJO A;  1I3Q I;  4BBR I;  2E1M A;  3CD6 1;  1VQ6 1;  3MZL B;  3NDJ A;  1QVF O;  2M8N A;  4COP A;  1Q7Y 2;  2JA8 I;  3CQZ I;  2JA7 I;  2W03 A;  3MGE A;  4CL1 A;  3S1Q I;  5C44 I;  4U0A A;  1QF8 A;  1Y1W I;  1M90 1;  2QR1 B;  4HH4 A;  3FQQ A;  5D1O A;  2R7Z I;  3BG0 B;  3S2H I;  1ZB9 A;  1VLA A;  3I55 Z;  3F3P C;  3OW2 Z;  1QVG Z;  3CCL P;  4NBB A;  3G71 Z;  3DS1 A;  2I3C A;  2W04 A;  4E33 A;  2OZK A;  1P9N A;  3NH8 A;  1YIT P;  2ONT A;  3CXC Y;  1VQN Z;  3S2D I;  2LFU A;  2L6E A;  5C4J I;  2M8L A;  5D1P A;  3HZQ A;  3G21 A;  1YJN P;  3FQM A;  3CMA 1;  3CD6 P;  4BBS I;  3CCJ Z;  3DS5 A;  3S1R I;  3G4S 1;  1VQ8 Z;  1RO0 A;  2RT9 A;  1K9M 1;  4NB9 A;  1VQO 1;  2GTH A;  2OOY B;  3EED A;  2E2H I;  3WBH A;  2KOD A;  3D6W A;  2NVQ I;  4E31 A;  1YJ9 P;  1VQK Z;  1RO4 A;  2KPI A;  3G26 A;  3IF8 A;  4NOZ A;  1VQ9 P;  3CCM Z;  2XXM A;  3NTE A;  3JAM f;  4MXU A;  4RVF A;  1YIJ Z;  1VQM Z;  4TNU A;  1KD1 1;  1K30 A;  1KC8 1;  4MH4 A;  3I4M I;  4NBH A;  3GTK I;  3GTM I;  3CCE 1;  3CME Z;  3TE5 B;  3HOW I;  3CCR Z;  1USP A;  3OW2 O;  3KIF A;  3EER A;  1JWH C;  1VQ4 Z;  2F4O A;  2YU9 I;  3CMA P;  1YI2 Z;  1M90 2;  2Q4Z A;  5D1O B;  3G4S P;  1YUK A;  3J80 f;  1Q82 2;  1Q7Y Q;  1VQO P;  5A2Q f;  3IFU A;  3G0V A;  3J81 b;  5F2K A;  3E2D A;  2PK7 A;  3S14 I;  1YHQ 1;  1TWF I;  3ESW A;  2V8I A;  3LUS A;  5DCK A;  3DS2 A;  3VB9 A;  3CPW Y;  4XRQ A;  1M74 A;  1X3W A;  4RS4 A;  1W2B Y;  2RIQ A;  2PMZ A;  3CCS Z;  3HOX I;  4BY7 I;  1NUI A;  3M4O I;  4NBG A;  2DE7 A;  4MON A;  3HOZ I;  3J80 b;  4E2Y A;  1YJW Z;  2P9X A;  2PM9 A;  1QYP A;  5A2Q b;  5F2N A;  4NBC A;  2VUM I;  3G6E Z;  2JO0 A;  3CXC Z;  1K9M 2;  4DK1 A;  1RNI A;  1JJ2 Y;  3CC7 Z;  3KIH A;  2E2I I;  5IT9 f;  3B5I A;  3Q87 A;  3CC2 P;  3I55 1;  3GTJ I;  5FLX b;  1M1K 2;  3G71 1;  1PFT A;  2G2K A;  1VQN 1;  1Q86 1;  1KD1 2;  3T4N B;  3PO2 I;  1YHQ P;  1KC8 2;  2DGY A;  3P05 A;  3GTP I;  4PH0 A;  2CWO A;  1M6E X;  1VQ5 Z;  1USP B;  3BG1 B;  3CCJ 1;  5IT9 b;  1VQ8 1;  4BY1 I;  2OTJ 1;  2NVY I;  2EFJ A;  1YIT Z;  3GCF A;  1K83 I;  4A3G I;  2KI7 B;  3DS3 A;  2JA6 I;  4A3I I;  2B63 I;  4HGZ A;  4A3D I;  2IZ3 A;  2E9H A;  3Q20 A;  1VQK 1;  3VMI A;  1YJN Z;  4M0I A;  3RZD I;  2OTL 1;  3CCM 1;  5T64 A;  3I56 P;  3M1M A;  1M90 Q;  1VQ6 P;  3IX0 A;  3CXC O;  3FKI I;  1YIJ 1;  4DGL A;  1VQM 1;  2P3Y A;  4E2Z A;  1I6H I;  1Q82 Q;  2OTJ Z;  4EWC A;  3NH4 A;  1RO2 A;  4NBA A;  1IUQ A;  1N8R 1;  2Z46 A;  1S7M A;  4XRO A;  3MZK B;  3CC4 Z;  3U50 C;  1VQN P;  5C4X I;  4GR2 A;  2PY8 A;  2PEJ A;  3CME 1;  4PH1 A;  4DQY B;  1YJ9 Z;  4MD7 A;  2JYG A;  3CCR 1;  1S72 Z;  2JS4 A;  1VQ9 Z;  2OTL Z;  1WCM I;  1K8A 1;  1VQ4 1;  2GU2 A;  2JA5 I;  1K73 1;  4COC A;  2PEN A;  2PEO A;  4NBE A;  1Q81 1;  4A3E I;  3H0G I;  3CCQ Z;  1YI2 1;  1NJI 1;  4X6A I;  1W2B Z;  3G1G A;  2LIY A;  5BS2 A;  5JPA A;  4U0F A;  1VQL Z;  4E30 A;  2XV6 A;  5IP9 I;  1K9M Q;  1QVG O;  2XT1 A;  1VQK P;  2VUG A;  4QTU A;  1JJ2 Z;  1Q86 2;  3CCM P;  3J7A 4;  1VQ7 Z;  2QA4 Z;  3S17 I;  3CCS 1;  1X0T A;  3JAM b;  4QNB A;  4U0D A;  1YIJ P;  1DL6 A;  1VQM P;  2PEI A;  4WYM A;  1M1K Q;  1YJW 1;  3G6E 1;  3G29 A;  3I07 A;  2AKL A;  2Z44 A;  3CME P;  2QEX Z;  1KD1 Q;  1D1D A;  3CCR P;  3S16 I;  3CC7 1;  1ML8 A;  1KC8 Q;  4RVG A;  4E2X A;  3CCU Z;  1X3Z A;  1VQP Z;  1YI2 P;  1Z02 A;  5HGM A;  3VRL C;  2QRE B;  4A3K I;  3I4N I;  2GTI A;  2M8P A;  5LL6 f;  2QRC B;  2JYL A;  1EOQ A;  2Q51 A;  4U0C A;  3CCE P;  1KQS Y;  1SFO I;  1W2B O;  4NFR A;  3CCV Z;  1Y1V S;  2O53 A;  2WB1 A;  3VTN A;  2JNY A;  1I50 I;  3CC2 Z;  2HU9 A;  3DTJ A;  4A3L I;  4Y7N I;  1VQ5 1;  1AUM A;  3S15 I;  4QTT A;  1ZH1 A;  4AYB A;  1K8A 2;  4BXX I;  3MON A;  3NDI A;  1YIT 1;  1Q81 2;  5T6B A;  3F3F C;  1NJI 2;  1QVF Y;  1TWG I;  1A8O A;  3DPH A;  1YJN 1;  1TWH I;  1KRL A;  3VMG A;  2RBL A;  3H4E A;  4E32 A;  4A3B I;  2H85 A;  3CCL Z;  2JR6 A;  1Y1V I;  4HGY A;  2RPR A;  3HOY I;  4MD9 A;  2HF1 A;  3H3V J;  2P28 A;  3NFZ A;  3CC4 1;  2NVX I;  2Y0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...