1RNIA

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
210
Chain Sequence
SSERIRYAKWFLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGLVILDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF904
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
total genus 68
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1rniA01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1rniA03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1rniA02
1RNIA 1RO2A 3M1MA 1RO0A
chains in the Genus database with same CATH superfamily
2BUOA 3CCRP 2E9HA 1RNIA 2GDWA 2ZAEB 3TE5B 7CEIA 4A3JI 4TNUA 1USPA 4IPYA 5D1OB 1N8R1 5JPAA 2O53A 4DK1A 4NBAA 1VQNZ 3H3VJ 3IFUA 4NBFA 5A2Qb 3CCUP 3CMEZ 2PY8A 3RZOI 1ACPA 2K94A 4HKGA 2W03A 3S1RI 4A3LI 3DS3A 2K0DX 2V8JA 5HGOA 3CXCO 3FQQA 3D2LA 2LIUA 3G711 2PNGA 1Q81Q 1WJ2A 3CD6Z 5HVCA 3G1GA 2GDYA 1NUIA 5IP7I 1ZH1A 3M1MA 1VQOP 2EHTA 3ESWA 3OW2Z 2E1MA 1ZB9A 1VQL1 2M8PA 3BG1B 1USPB 3CCVZ 4CL1A 3GTOI 3I561 4BY1I 3CCSZ 4MXUA 3PO2I 2JB0A 2GYKA 2EFJA 2N5HA 2EIAA 3CCJ1 3VMHA 3CCR1 1M6NA 1YITZ 3NH5A 2KGCA 3EJBA 3DTJA 5BS2A 1I3QI 1S7MA 1TWAI 2MVVA 1QRJA 4XFXA 3CMAP 1YHQZ 3JAMb 1M902 1RQFA 4NH1C 2DE7A 2KOSA 2JYGA 5BS1A 1VQ6P 2V8IA 5EW5E 3F3PC 3G6E1 4PWVB 2NAPA 2AF8A 2QNWA 1TWGI 2JIPA 3CCEZ 1BAJA 5I4TG 3CCMP 3MGEA 3CC7P 4MONA 4E30A 3KIFA 1GXHA 2KOOA 2H85A 1VQO1 2AFDA 1K9MQ 1VQ41 1VHNA 2KOQA 3J80b 3GTGI 4MH4A 3S1MI 3CCVP 5CM2M 2RIQA 1Q811 3T4NB 1VQK1 1K8AQ 2PENA 5CZDB 3B4QA 1WCMI 2N6YA 4RVDA 1VQ8Z 1N8R2 3GTLI 4Y52I 1W2BY 5FLXb 1YJNZ 1VQMP 1ZNVA 1Q16A 1HY8A 3CCLP 2JA8I 1Y1VS 2OTJP 3CME1 2J6AA 5A2Qf 2KG6A 2N5IA 3D6WA 2OTLP 4E2ZA 2N6ZA 2GZEA 2JIOA 2XXMA 2Z44A 4BPFA 1GXGA 1QVFZ 2MF4A 1KRLA 3IF8A 2MR8A 1KD1Q 1E0HA 1DNYA 5T6BA 1SIWA 1ZB8A 4GR2A 5T64A 2FQ0A 3CCM1 3CC71 3CD61 3NDJA 2HF1A 3CCQZ 2QEXP 1GPJA 3GTKI 1VKUA 5IP9I 3HOVI 4DQYB 4WYMA 2XV6A 2KI7B 2LPKA 2VLQA 1FR2A 3H47A 1L1OC 3CC4P 3VB9A 2JA7I 3CCV1 1DL6A 1Z6MA 3U50C 3CCS1 4M0IA 2OOYB 5C44I 4X6AI 2OOXB 4HGZA 3G71P 4Y7NI 1K732 2M48A 2PEMA 2KR5A 1YJNP 3GZMA 2EG5A 1VQ7P 1VQM1 3S2DI 2FVEA 2QKDA 1I6HI 2PEKA 3WBHA 1KQSY 3GCFA 1OR5A 1YHQ1 2JBGA 1NJIQ 1K8A1 3G1IA 3LRYA 4NB8A 3JAMf 4XX2A 3I56P 2LL8A 4A3GI 1IUQA 2MD9A 2AFEA 1VQPZ 3CCJP 1X3ZA 3VRLC 3QWUA 5LL6f 1Q82Q 1QYPA 2WAQA 4QTUA 3BG0B 2JIMA 2L0QA 2VUGA 2QRCB 3GTQI 3I4MI 2GTIA 2Y0SA 2JA5I 1Z02A 3DS4A 2QEX1 5KP6B 1L0IA 2RPRA 3CXCZ 1Q812 3NY7B 4COCA 1KD11 3CC41 2VSQA 1NQ4A 3G6EP 2YADA 3FKII 4H2YC 4EWCA 3KIHA 1JJ2Y 1VQ81 1Z01A 2LF4A 3CPWY 1M1KQ 3I4NI 2RT9A 2VPXA 1WIIA 1YJN1 3RG2A 1NP6A 2XZ1C 5FLXf 3HOXI 3G28A 1VQ71 3S14I 1VQ4P 2KG9A 1Y8CA 1HQBA 3CQZI 1Y1WI 1TFIA 2JGPA 1S72Z 1JWHC 1VQKP 3J7A4 2I3CA 2VLNA 2KWLA 2Q4ZA 2JAZA 1T8KA 2M8NA 3EJDA 2LFUA 3VMGA 1WW9A 3I55Z 5C4JI 2M6NA 2RBLA 2LIYA 2JO0A 3MZKB 1YJ9Z 1X3OA 3F3FC 4XRQA 1NJI1 4NBGA 2GTHA 4RS4A 1CEIA 3CXCY 1VQNP 3J81b 3CCQ1 3IX0A 2N98A 3CMEP 2KG8A 1RO2A 3PO3I 3GTPI 3H4EA 4MRTC 1Q821 2IZ3A 3DS0A 2E7ZA 2P3YA 2FQ2A 3H0GI 1L0HA 1K9M2 2MY5A 2KGEA 3HYBA 4NEOA 1Q7YQ 1YJWZ 3FQMA 2FACA 3OW2Y 3CD6P 5KP8B 4XFYA 3S1NI 2GZJA 2VPZA 1K8A2 2PEOA 1P9NA 1QF8A 2NVYI 3HOZI 3S17I 4XROA 3G4SZ 5FLMI 4S1TA 3CCSP 1KC81 3RZDI 2JIRA 1YIJZ 2L6EA 2K0XA 1VQP1 2P9XA 1W2BO 4PH1A 1M1K1 1YITP 4PH0A 1X0TA 2JMOA 5EJDA 1M90Q 3S1QI 1AA6A 2BHVA 1ZMBA 2PEIA 1UNKA 2K5XA 3NFZA 5KP7B 2AKLA 4H2WC 1YHQP 4NFRA 1VQN1 2JYLA 4BBRI 1KD12 1M6EX 3NTEA 2WPTA 2FAEA 2JNYA 1D1DA 3NH8A 4U0EA 2LTEA 2E2JI 2PM9A 1EMVA 2MR7A 2VPYA 3G29A 4QKOA 3Q20A 4NBBA 3U43A 2FVFA 3M3YI 4A3CI 4A93I 2ONTA 1IMQA 3HOWI 2NO8A 4R0MA 3CCEP 3CE7A 1VQ5Z 2LKIA 4E31A 3CC2Z 1YI2Z 2BJOA 2DE5A 1LQLA 2RHBA 3G0VA 1Q86Q 2XT1A 1DV5A 2G2KA 1VQ9Z 1ML8A 5F2OA 2GZFA 3D9XA 4E32A 1VQLZ 1Q7Y1 2O4HA 2PMZA 1S721 1YIJP 2PK7A 5D1PA 1NJI2 2FHSC 3CCRZ 2FADA 5T67A 1VQ8P 1YIT1 3I551 4U0DA 1VLAA 2N50A 1KQSO 1QVGZ 3S15I 3G21A 3GTJI 2CNRA 3HZQA 1YUAA 3H0DA 1EIAA 1Q822 3J81f 1QVGO 2K93A 1QVFY 3CCUZ 4A3DI 2DGYA 4UHPB 1RLYA 1E6JP 1M901 2NVQI 2DE6A 4U0CA 2YU9I 4BBSI 1Z03A 2V8KA 2CG5B 2VUMI 2IV2X 1IMPA 2DNWA 2GZGA 3CCE1 1RO0A 2K2QA 3GKLC 2OZKA 3S2HI 2PEQA 3CCQP 3CC2P 1Y1VI 4NB9A 2QR1B 5IT9b 4MD9A 4NOZA 2EGTA 3G4S1 3HKZA 3J80f 1M1K2 1K73Q 4MRIA 5F2KA 2K0YA 1JJ2O 1YIJ1 3GTMI 4A3II 2KGDA 3CPWO 1KC8Q 1A8OA 3EEDA 2IZ4A 1Q861 2R93I 2JS4A 1X3WA 4A3FI 1PFTA 4U0FA 4E2WA 2WB1A 3DS1A 3CMAZ 2HU9A 1WZNA 3NDIA 2JU1A 1VQPP 2R6MA 1N2FA 3MZLB 1VQ6Z 2K5RA 2R92I 3DS2A 3CCMZ 4NBDA 3CC7Z 1VQ51 3HOUI 3HOYI 3MONA 4H2XC 2X2BA 3CC21 1RO4A 3I07A 2VLPA 1YI21 2LMLA 1Q7Y2 2Z45A 4U0BA 1VQ91 1AYIA 1YUKA 3IR7A 2QLVB 3M4OI 2L9FA 4A3BI 4U0AA 5F2NA 3VMIA 2V45A 3K7AI 2L22A 3P5JB 2AVAA 5C4XI 3OW2O 2KODA 4BY7I 2JQ4A 1R9TI 2M5RA 4COPA 5C3EI 4QTTA 2KW2A 2KPIA 2EHSA 2JIQA 4XFZA 2JR6A 2FQ1A 1VQMZ 2QA4Z 1K731 2QREB 2VF1A 2AYDA 1MZ8A 2JU2A 1W2BZ 3CCLZ 4DG9A 4RVGA 4DGLA 3CCU1 2OTJZ 4MD8A 1S72P 3DPHA 1TWCI 3P05A 2L4BA 2R7ZI 2OTLZ 4IZ6A 4GR6A 3GKQA 1EOQA 3I55P 2E2II 4HGYA 4PXHB 4E2YA 2CGQA 1YJ9P 1FDOA 2JUBA 4NBHA 1VQKZ 2LIWA 2CWOA 1M74A 2QEXZ 3LUSA 4BPGA 4A3KI 5HGNA 5IT9f 3LMOA 4RV9A 2E2HI 3GJNA 1I50I 3CC4Z 2K92A 2KORA 1SFOI 1QXFA 1Q862 1K83I 2ROQA 2GZIA 1YJWP 1F80D 3VTNA 4BXXI 3G71Z 4MD7A 1KLPA 2KOPA 4BPHA 1AUMA 2QA4P 1A43A 1VQ7Z 2B63I 2P28A 2LEXA 3G4SP 3CMA1 2F4MA 2VPWA 1TWHI 2K3RA 2PEJA 1N8RQ 4RVFA 3I56Z 2Z46A 2W04A 2MVUA 1K30A 2XZ0D 1KQSZ 2F4OA 3CCJZ 1TWFI 4E2XA 3S16I 2Q51A 1VQ61 1FDIA 3GTMS 2KGAA 3B5IA 1YJ91 2GDXA 1UJZA 5HV8A 1BXIA 4A3EI 1QVFO 4RVHA 3EERA 3TDHB 3Q87A 4NBCA 3RG6C 4HH4A 2CQ8A 5AN9F 3G26A 3EJEA 5D1OA 4A3MI 3E2DA 3DS5A 2V3VA 3GZLA 4AYBA 3G6EZ 1YJW1 5HGLA 2OTL1 4E33A 2OARA 2M8LA 5HGMA 1VQ5P 1K9M1 2FVAA 5DCKA 1YI2P 2QA41 4F37A 4NBEA 2ERHA 1VQ9P 1VQOZ 2GU2A 1JJ2Z 1VQ4Z 3NH4A 1KC82 2VLOA 1VQLP 1AF8A 3CPWZ 3CCL1 2NVTI 3PO3S 2OTJ1 2LOLA 2QRDB 2JA6I 4QNBA 1QVGY 4CA3A 2NVXI
chains in the Genus database with same CATH topology
2BUOA 3CCRP 2E9HA 1RNIA 2ZAEB 3TE5B 4A3JI 4TNUA 1USPA 4IPYA 5D1OB 1N8R1 5JPAA 2O53A 4DK1A 4NBAA 1VQNZ 3H3VJ 3IFUA 4NBFA 5A2Qb 3CCUP 3CMEZ 2PY8A 3RZOI 2W03A 3S1RI 4A3LI 3DS3A 2V8JA 5HGOA 3CXCO 3FQQA 3G711 1Q81Q 3CD6Z 3G1GA 1NUIA 5IP7I 1ZH1A 3M1MA 1VQOP 3ESWA 3OW2Z 2E1MA 1ZB9A 1VQL1 2M8PA 3BG1B 1USPB 3CCVZ 4CL1A 3GTOI 3I561 4BY1I 3CCSZ 4MXUA 3PO2I 2EFJA 2EIAA 3CCJ1 3VMHA 3CCR1 1M6NA 1YITZ 3NH5A 5BS2A 3DTJA 1I3QI 1S7MA 1TWAI 1QRJA 4XFXA 3CMAP 1YHQZ 3JAMb 1M902 1RQFA 4NH1C 2DE7A 2JYGA 5BS1A 1VQ6P 2V8IA 3F3PC 3G6E1 1TWGI 3CCEZ 1BAJA 5I4TG 3CCMP 3MGEA 3CC7P 4MONA 4E30A 3KIFA 2H85A 1VQO1 1K9MQ 1VQ41 3J80b 3GTGI 4MH4A 3S1MI 3CCVP 5CM2M 2RIQA 1Q811 3T4NB 1VQK1 1K8AQ 2PENA 1WCMI 4RVDA 4Y52I 1VQ8Z 1N8R2 3GTLI 1W2BY 5FLXb 1YJNZ 1VQMP 3CCLP 2JA8I 1Y1VS 2OTJP 3CME1 2J6AA 5A2Qf 3D6WA 2OTLP 4E2ZA 2XXMA 2Z44A 1QVFZ 1KRLA 3IF8A 1KD1Q 5T6BA 1ZB8A 4GR2A 5T64A 3CCM1 3CD61 3CC71 3NDJA 2HF1A 3CCQZ 2QEXP 3GTKI 3HOVI 5IP9I 4DQYB 4WYMA 2XV6A 2KI7B 3H47A 1L1OC 3VB9A 3CC4P 2JA7I 3CCV1 1DL6A 3U50C 3CCS1 4M0IA 2OOYB 5C44I 4X6AI 2OOXB 4HGZA 3G71P 4Y7NI 1K732 2M48A 2PEMA 1YJNP 2EG5A 1VQ7P 1VQM1 3S2DI 2QKDA 1I6HI 2PEKA 3WBHA 1KQSY 3GCFA 1YHQ1 1NJIQ 1K8A1 3G1IA 3LRYA 4NB8A 3JAMf 4XX2A 3I56P 4A3GI 1IUQA 1VQPZ 3CCJP 1X3ZA 3VRLC 3QWUA 5LL6f 1Q82Q 1QYPA 2WAQA 4QTUA 3BG0B 2VUGA 3GTQI 2QRCB 3I4MI 2GTIA 2Y0SA 2JA5I 1Z02A 3DS4A 2QEX1 2RPRA 3CXCZ 1Q812 4COCA 1KD11 3CC41 3G6EP 2YADA 3FKII 4EWCA 3KIHA 1JJ2Y 1VQ81 1Z01A 2LF4A 3CPWY 1M1KQ 3I4NI 2RT9A 1WIIA 1YJN1 1NP6A 5FLXf 1VQ71 3HOXI 3G28A 3S14I 1VQ4P 3CQZI 1Y1WI 1TFIA 1S72Z 1JWHC 1VQKP 3J7A4 2I3CA 2Q4ZA 2M8NA 2LFUA 3VMGA 1WW9A 3I55Z 5C4JI 2M6NA 2RBLA 2LIYA 2JO0A 3MZKB 1YJ9Z 3F3FC 1NJI1 4XRQA 4NBGA 2GTHA 4RS4A 3CXCY 1VQNP 3J81b 3CCQ1 3IX0A 3CMEP 3PO3I 1RO2A 3GTPI 3H4EA 1Q821 2IZ3A 3DS0A 2P3YA 3H0GI 1K9M2 3HYBA 1Q7YQ 1YJWZ 3FQMA 3OW2Y 3CD6P 4XFYA 3S1NI 1K8A2 2PEOA 1P9NA 1QF8A 2NVYI 3HOZI 3S17I 4XROA 3G4SZ 5FLMI 4S1TA 3CCSP 1KC81 3RZDI 1YIJZ 1M1K1 2L6EA 1VQP1 2P9XA 1W2BO 4PH1A 1YITP 4PH0A 1X0TA 2JMOA 1M90Q 3S1QI 2BHVA 1ZMBA 2PEIA 3NFZA 2AKLA 1YHQP 4NFRA 1VQN1 2JYLA 4BBRI 1KD12 1M6EX 3NTEA 2JNYA 1D1DA 3NH8A 4U0EA 2E2JI 2PM9A 3G29A 4NBBA 3Q20A 3M3YI 4A3CI 4A93I 2ONTA 3HOWI 3CCEP 1VQ5Z 4E31A 3CC2Z 1YI2Z 2RHBA 2BJOA 1LQLA 2DE5A 3G0VA 1Q86Q 2XT1A 2G2KA 1VQ9Z 1ML8A 5F2OA 4E32A 3D9XA 1VQLZ 1Q7Y1 2O4HA 2PMZA 1S721 1YIJP 2PK7A 5D1PA 1NJI2 3CCRZ 5T67A 1VQ8P 1YIT1 3I551 4U0DA 1VLAA 1KQSO 1QVGZ 3S15I 3G21A 3GTJI 3HZQA 1YUAA 3H0DA 1EIAA 1Q822 3J81f 1QVGO 1QVFY 4A3DI 3CCUZ 2DGYA 1RLYA 1E6JP 1M901 2NVQI 2DE6A 4U0CA 2YU9I 4BBSI 1Z03A 2V8KA 2VUMI 3CCE1 1RO0A 3S2HI 2OZKA 2PEQA 3CCQP 3CC2P 1Y1VI 4NB9A 2QR1B 5IT9b 4MD9A 4NOZA 2EGTA 3G4S1 3HKZA 3J80f 1M1K2 1K73Q 4MRIA 5F2KA 1JJ2O 1YIJ1 3GTMI 4A3II 3CPWO 1KC8Q 1A8OA 3EEDA 2IZ4A 1Q861 2R93I 2JS4A 1X3WA 4A3FI 1PFTA 4U0FA 4E2WA 2WB1A 3DS1A 3CMAZ 2HU9A 3NDIA 1VQPP 2R6MA 1N2FA 3MZLB 1VQ6Z 2K5RA 2R92I 3DS2A 3CCMZ 4NBDA 3CC7Z 1VQ51 3HOUI 3HOYI 3MONA 3CC21 1RO4A 3I07A 1YI21 1Q7Y2 2Z45A 4U0BA 1VQ91 1YUKA 3M4OI 2QLVB 4A3BI 4U0AA 5F2NA 3VMIA 3K7AI 3P5JB 5C4XI 3OW2O 2KODA 4BY7I 1R9TI 4COPA 5C3EI 4QTTA 2KPIA 4XFZA 2JR6A 1VQMZ 2QA4Z 1K731 2QREB 2VF1A 1W2BZ 3CCLZ 4RVGA 4DGLA 3CCU1 2OTJZ 4MD8A 1S72P 3DPHA 1TWCI 3P05A 2R7ZI 2OTLZ 4GR6A 3GKQA 1EOQA 3I55P 2E2II 4HGYA 4E2YA 1YJ9P 2JUBA 4NBHA 2CWOA 1M74A 2QEXZ 3LUSA 4A3KI 5HGNA 5IT9f 4RV9A 2E2HI 1I50I 3CC4Z 1SFOI 1Q862 1K83I 3VTNA 1YJWP 4BXXI 3G71Z 4MD7A 1AUMA 2QA4P 1A43A 1VQ7Z 2B63I 2P28A 3G4SP 3CMA1 2F4MA 1TWHI 2K3RA 2PEJA 1N8RQ 4RVFA 3I56Z 2Z46A 2W04A 1KQSZ 1K30A 2F4OA 3CCJZ 1TWFI 4E2XA 3S16I 2Q51A 1VQ61 3GTMS 3B5IA 1YJ91 4A3EI 1QVFO 4RVHA 3EERA 3TDHB 3Q87A 4NBCA 3RG6C 4HH4A 5AN9F 3G26A 5D1OA 4A3MI 3E2DA 3DS5A 4AYBA 3G6EZ 1YJW1 5HGLA 2OTL1 4E33A 2OARA 2M8LA 5HGMA 1VQ5P 1K9M1 5DCKA 1YI2P 2QA41 4NBEA 1VQ9P 1VQOZ 2GU2A 1JJ2Z 1VQ4Z 3NH4A 1KC82 1VQLP 3CPWZ 3CCL1 2NVTI 3PO3S 2OTJ1 2QRDB 2JA6I 4QNBA 1QVGY 1VQKZ 2NVXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RNI A;  1RO2 A;  3M1M A;  1RO0 A; 
#chains in the Genus database with same CATH topology
 2BUO A;  3CCR P;  2E9H A;  1RNI A;  2GDW A;  2ZAE B;  3TE5 B;  7CEI A;  4A3J I;  4TNU A;  1USP A;  4IPY A;  5D1O B;  1N8R 1;  5JPA A;  2O53 A;  4DK1 A;  4NBA A;  1VQN Z;  3H3V J;  3IFU A;  4NBF A;  5A2Q b;  3CCU P;  3CME Z;  2PY8 A;  3RZO I;  1ACP A;  2K94 A;  4HKG A;  2W03 A;  3S1R I;  4A3L I;  3DS3 A;  2K0D X;  2V8J A;  5HGO A;  3CXC O;  3FQQ A;  3D2L A;  2LIU A;  3G71 1;  2PNG A;  1Q81 Q;  1WJ2 A;  3CD6 Z;  5HVC A;  3G1G A;  2GDY A;  1NUI A;  5IP7 I;  1ZH1 A;  3M1M A;  1VQO P;  2EHT A;  3ESW A;  3OW2 Z;  2E1M A;  1ZB9 A;  1VQL 1;  2M8P A;  3BG1 B;  1USP B;  3CCV Z;  4CL1 A;  3GTO I;  3I56 1;  4BY1 I;  3CCS Z;  4MXU A;  3PO2 I;  2JB0 A;  2GYK A;  2EFJ A;  2N5H A;  2EIA A;  3CCJ 1;  3VMH A;  3CCR 1;  1M6N A;  1YIT Z;  3NH5 A;  2KGC A;  3EJB A;  3DTJ A;  5BS2 A;  1I3Q I;  1S7M A;  1TWA I;  2MVV A;  1QRJ A;  4XFX A;  3CMA P;  1YHQ Z;  3JAM b;  1M90 2;  1RQF A;  4NH1 C;  2DE7 A;  2KOS A;  2JYG A;  5BS1 A;  1VQ6 P;  2V8I A;  5EW5 E;  3F3P C;  3G6E 1;  4PWV B;  2NAP A;  2AF8 A;  2QNW A;  1TWG I;  2JIP A;  3CCE Z;  1BAJ A;  5I4T G;  3CCM P;  3MGE A;  3CC7 P;  4MON A;  4E30 A;  3KIF A;  1GXH A;  2KOO A;  2H85 A;  1VQO 1;  2AFD A;  1K9M Q;  1VQ4 1;  1VHN A;  2KOQ A;  3J80 b;  3GTG I;  4MH4 A;  3S1M I;  3CCV P;  5CM2 M;  2RIQ A;  1Q81 1;  3T4N B;  1VQK 1;  1K8A Q;  2PEN A;  5CZD B;  3B4Q A;  1WCM I;  2N6Y A;  4RVD A;  1VQ8 Z;  1N8R 2;  3GTL I;  4Y52 I;  1W2B Y;  5FLX b;  1YJN Z;  1VQM P;  1ZNV A;  1Q16 A;  1HY8 A;  3CCL P;  2JA8 I;  1Y1V S;  2OTJ P;  3CME 1;  2J6A A;  5A2Q f;  2KG6 A;  2N5I A;  3D6W A;  2OTL P;  4E2Z A;  2N6Z A;  2GZE A;  2JIO A;  2XXM A;  2Z44 A;  4BPF A;  1GXG A;  1QVF Z;  2MF4 A;  1KRL A;  3IF8 A;  2MR8 A;  1KD1 Q;  1E0H A;  1DNY A;  5T6B A;  1SIW A;  1ZB8 A;  4GR2 A;  5T64 A;  2FQ0 A;  3CCM 1;  3CC7 1;  3CD6 1;  3NDJ A;  2HF1 A;  3CCQ Z;  2QEX P;  1GPJ A;  3GTK I;  1VKU A;  5IP9 I;  3HOV I;  4DQY B;  4WYM A;  2XV6 A;  2KI7 B;  2LPK A;  2VLQ A;  1FR2 A;  3H47 A;  1L1O C;  3CC4 P;  3VB9 A;  2JA7 I;  3CCV 1;  1DL6 A;  1Z6M A;  3U50 C;  3CCS 1;  4M0I A;  2OOY B;  5C44 I;  4X6A I;  2OOX B;  4HGZ A;  3G71 P;  4Y7N I;  1K73 2;  2M48 A;  2PEM A;  2KR5 A;  1YJN P;  3GZM A;  2EG5 A;  1VQ7 P;  1VQM 1;  3S2D I;  2FVE A;  2QKD A;  1I6H I;  2PEK A;  3WBH A;  1KQS Y;  3GCF A;  1OR5 A;  1YHQ 1;  2JBG A;  1NJI Q;  1K8A 1;  3G1I A;  3LRY A;  4NB8 A;  3JAM f;  4XX2 A;  3I56 P;  2LL8 A;  4A3G I;  1IUQ A;  2MD9 A;  2AFE A;  1VQP Z;  3CCJ P;  1X3Z A;  3VRL C;  3QWU A;  5LL6 f;  1Q82 Q;  1QYP A;  2WAQ A;  4QTU A;  3BG0 B;  2JIM A;  2L0Q A;  2VUG A;  2QRC B;  3GTQ I;  3I4M I;  2GTI A;  2Y0S A;  2JA5 I;  1Z02 A;  3DS4 A;  2QEX 1;  5KP6 B;  1L0I A;  2RPR A;  3CXC Z;  1Q81 2;  3NY7 B;  4COC A;  1KD1 1;  3CC4 1;  2VSQ A;  1NQ4 A;  3G6E P;  2YAD A;  3FKI I;  4H2Y C;  4EWC A;  3KIH A;  1JJ2 Y;  1VQ8 1;  1Z01 A;  2LF4 A;  3CPW Y;  1M1K Q;  3I4N I;  2RT9 A;  2VPX A;  1WII A;  1YJN 1;  3RG2 A;  1NP6 A;  2XZ1 C;  5FLX f;  3HOX I;  3G28 A;  1VQ7 1;  3S14 I;  1VQ4 P;  2KG9 A;  1Y8C A;  1HQB A;  3CQZ I;  1Y1W I;  1TFI A;  2JGP A;  1S72 Z;  1JWH C;  1VQK P;  3J7A 4;  2I3C A;  2VLN A;  2KWL A;  2Q4Z A;  2JAZ A;  1T8K A;  2M8N A;  3EJD A;  2LFU A;  3VMG A;  1WW9 A;  3I55 Z;  5C4J I;  2M6N A;  2RBL A;  2LIY A;  2JO0 A;  3MZK B;  1YJ9 Z;  1X3O A;  3F3F C;  4XRQ A;  1NJI 1;  4NBG A;  2GTH A;  4RS4 A;  1CEI A;  3CXC Y;  1VQN P;  3J81 b;  3CCQ 1;  3IX0 A;  2N98 A;  3CME P;  2KG8 A;  1RO2 A;  3PO3 I;  3GTP I;  3H4E A;  4MRT C;  1Q82 1;  2IZ3 A;  3DS0 A;  2E7Z A;  2P3Y A;  2FQ2 A;  3H0G I;  1L0H A;  1K9M 2;  2MY5 A;  2KGE A;  3HYB A;  4NEO A;  1Q7Y Q;  1YJW Z;  3FQM A;  2FAC A;  3OW2 Y;  3CD6 P;  5KP8 B;  4XFY A;  3S1N I;  2GZJ A;  2VPZ A;  1K8A 2;  2PEO A;  1P9N A;  1QF8 A;  2NVY I;  3HOZ I;  3S17 I;  4XRO A;  3G4S Z;  5FLM I;  4S1T A;  3CCS P;  1KC8 1;  3RZD I;  2JIR A;  1YIJ Z;  2L6E A;  2K0X A;  1VQP 1;  2P9X A;  1W2B O;  4PH1 A;  1M1K 1;  1YIT P;  4PH0 A;  1X0T A;  2JMO A;  5EJD A;  1M90 Q;  3S1Q I;  1AA6 A;  2BHV A;  1ZMB A;  2PEI A;  1UNK A;  2K5X A;  3NFZ A;  5KP7 B;  2AKL A;  4H2W C;  1YHQ P;  4NFR A;  1VQN 1;  2JYL A;  4BBR I;  1KD1 2;  1M6E X;  3NTE A;  2WPT A;  2FAE A;  2JNY A;  1D1D A;  3NH8 A;  4U0E A;  2LTE A;  2E2J I;  2PM9 A;  1EMV A;  2MR7 A;  2VPY A;  3G29 A;  4QKO A;  3Q20 A;  4NBB A;  3U43 A;  2FVF A;  3M3Y I;  4A3C I;  4A93 I;  2ONT A;  1IMQ A;  3HOW I;  2NO8 A;  4R0M A;  3CCE P;  3CE7 A;  1VQ5 Z;  2LKI A;  4E31 A;  3CC2 Z;  1YI2 Z;  2BJO A;  2DE5 A;  1LQL A;  2RHB A;  3G0V A;  1Q86 Q;  2XT1 A;  1DV5 A;  2G2K A;  1VQ9 Z;  1ML8 A;  5F2O A;  2GZF A;  3D9X A;  4E32 A;  1VQL Z;  1Q7Y 1;  2O4H A;  2PMZ A;  1S72 1;  1YIJ P;  2PK7 A;  5D1P A;  1NJI 2;  2FHS C;  3CCR Z;  2FAD A;  5T67 A;  1VQ8 P;  1YIT 1;  3I55 1;  4U0D A;  1VLA A;  2N50 A;  1KQS O;  1QVG Z;  3S15 I;  3G21 A;  3GTJ I;  2CNR A;  3HZQ A;  1YUA A;  3H0D A;  1EIA A;  1Q82 2;  3J81 f;  1QVG O;  2K93 A;  1QVF Y;  3CCU Z;  4A3D I;  2DGY A;  4UHP B;  1RLY A;  1E6J P;  1M90 1;  2NVQ I;  2DE6 A;  4U0C A;  2YU9 I;  4BBS I;  1Z03 A;  2V8K A;  2CG5 B;  2VUM I;  2IV2 X;  1IMP A;  2DNW A;  2GZG A;  3CCE 1;  1RO0 A;  2K2Q A;  3GKL C;  2OZK A;  3S2H I;  2PEQ A;  3CCQ P;  3CC2 P;  1Y1V I;  4NB9 A;  2QR1 B;  5IT9 b;  4MD9 A;  4NOZ A;  2EGT A;  3G4S 1;  3HKZ A;  3J80 f;  1M1K 2;  1K73 Q;  4MRI A;  5F2K A;  2K0Y A;  1JJ2 O;  1YIJ 1;  3GTM I;  4A3I I;  2KGD A;  3CPW O;  1KC8 Q;  1A8O A;  3EED A;  2IZ4 A;  1Q86 1;  2R93 I;  2JS4 A;  1X3W A;  4A3F I;  1PFT A;  4U0F A;  4E2W A;  2WB1 A;  3DS1 A;  3CMA Z;  2HU9 A;  1WZN A;  3NDI A;  2JU1 A;  1VQP P;  2R6M A;  1N2F A;  3MZL B;  1VQ6 Z;  2K5R A;  2R92 I;  3DS2 A;  3CCM Z;  4NBD A;  3CC7 Z;  1VQ5 1;  3HOU I;  3HOY I;  3MON A;  4H2X C;  2X2B A;  3CC2 1;  1RO4 A;  3I07 A;  2VLP A;  1YI2 1;  2LML A;  1Q7Y 2;  2Z45 A;  4U0B A;  1VQ9 1;  1AYI A;  1YUK A;  3IR7 A;  2QLV B;  3M4O I;  2L9F A;  4A3B I;  4U0A A;  5F2N A;  3VMI A;  2V45 A;  3K7A I;  2L22 A;  3P5J B;  2AVA A;  5C4X I;  3OW2 O;  2KOD A;  4BY7 I;  2JQ4 A;  1R9T I;  2M5R A;  4COP A;  5C3E I;  4QTT A;  2KW2 A;  2KPI A;  2EHS A;  2JIQ A;  4XFZ A;  2JR6 A;  2FQ1 A;  1VQM Z;  2QA4 Z;  1K73 1;  2QRE B;  2VF1 A;  2AYD A;  1MZ8 A;  2JU2 A;  1W2B Z;  3CCL Z;  4DG9 A;  4RVG A;  4DGL A;  3CCU 1;  2OTJ Z;  4MD8 A;  1S72 P;  3DPH A;  1TWC I;  3P05 A;  2L4B A;  2R7Z I;  2OTL Z;  4IZ6 A;  4GR6 A;  3GKQ A;  1EOQ A;  3I55 P;  2E2I I;  4HGY A;  4PXH B;  4E2Y A;  2CGQ A;  1YJ9 P;  1FDO A;  2JUB A;  4NBH A;  1VQK Z;  2LIW A;  2CWO A;  1M74 A;  2QEX Z;  3LUS A;  4BPG A;  4A3K I;  5HGN A;  5IT9 f;  3LMO A;  4RV9 A;  2E2H I;  3GJN A;  1I50 I;  3CC4 Z;  2K92 A;  2KOR A;  1SFO I;  1QXF A;  1Q86 2;  1K83 I;  2ROQ A;  2GZI A;  1YJW P;  1F80 D;  3VTN A;  4BXX I;  3G71 Z;  4MD7 A;  1KLP A;  2KOP A;  4BPH A;  1AUM A;  2QA4 P;  1A43 A;  1VQ7 Z;  2B63 I;  2P28 A;  2LEX A;  3G4S P;  3CMA 1;  2F4M A;  2VPW A;  1TWH I;  2K3R A;  2PEJ A;  1N8R Q;  4RVF A;  3I56 Z;  2Z46 A;  2W04 A;  2MVU A;  1K30 A;  2XZ0 D;  1KQS Z;  2F4O A;  3CCJ Z;  1TWF I;  4E2X A;  3S16 I;  2Q51 A;  1VQ6 1;  1FDI A;  3GTM S;  2KGA A;  3B5I A;  1YJ9 1;  2GDX A;  1UJZ A;  5HV8 A;  1BXI A;  4A3E I;  1QVF O;  4RVH A;  3EER A;  3TDH B;  3Q87 A;  4NBC A;  3RG6 C;  4HH4 A;  2CQ8 A;  5AN9 F;  3G26 A;  3EJE A;  5D1O A;  4A3M I;  3E2D A;  3DS5 A;  2V3V A;  3GZL A;  4AYB A;  3G6E Z;  1YJW 1;  5HGL A;  2OTL 1;  4E33 A;  2OAR A;  2M8L A;  5HGM A;  1VQ5 P;  1K9M 1;  2FVA A;  5DCK A;  1YI2 P;  2QA4 1;  4F37 A;  4NBE A;  2ERH A;  1VQ9 P;  1VQO Z;  2GU2 A;  1JJ2 Z;  1VQ4 Z;  3NH4 A;  1KC8 2;  2VLO A;  1VQL P;  1AF8 A;  3CPW Z;  3CCL 1;  2NVT I;  3PO3 S;  2OTJ 1;  2LOL A;  2QRD B;  2JA6 I;  4QNB A;  1QVG Y;  4CA3 A;  2NVX I; 
#chains in the Genus database with same CATH homology
 2BUO A;  3CCR P;  2E9H A;  1RNI A;  2ZAE B;  3TE5 B;  4A3J I;  4TNU A;  1USP A;  4IPY A;  5D1O B;  1N8R 1;  5JPA A;  2O53 A;  4DK1 A;  4NBA A;  1VQN Z;  3H3V J;  3IFU A;  4NBF A;  5A2Q b;  3CCU P;  3CME Z;  2PY8 A;  3RZO I;  2W03 A;  3S1R I;  4A3L I;  3DS3 A;  2V8J A;  5HGO A;  3CXC O;  3FQQ A;  3G71 1;  1Q81 Q;  3CD6 Z;  3G1G A;  1NUI A;  5IP7 I;  1ZH1 A;  3M1M A;  1VQO P;  3ESW A;  3OW2 Z;  2E1M A;  1ZB9 A;  1VQL 1;  2M8P A;  3BG1 B;  1USP B;  3CCV Z;  4CL1 A;  3GTO I;  3I56 1;  4BY1 I;  3CCS Z;  4MXU A;  3PO2 I;  2EFJ A;  2EIA A;  3CCJ 1;  3VMH A;  3CCR 1;  1M6N A;  1YIT Z;  3NH5 A;  5BS2 A;  3DTJ A;  1I3Q I;  1S7M A;  1TWA I;  1QRJ A;  4XFX A;  3CMA P;  1YHQ Z;  3JAM b;  1M90 2;  1RQF A;  4NH1 C;  2DE7 A;  2JYG A;  5BS1 A;  1VQ6 P;  2V8I A;  3F3P C;  3G6E 1;  1TWG I;  3CCE Z;  1BAJ A;  5I4T G;  3CCM P;  3MGE A;  3CC7 P;  4MON A;  4E30 A;  3KIF A;  2H85 A;  1VQO 1;  1K9M Q;  1VQ4 1;  3J80 b;  3GTG I;  4MH4 A;  3S1M I;  3CCV P;  5CM2 M;  2RIQ A;  1Q81 1;  3T4N B;  1VQK 1;  1K8A Q;  2PEN A;  1WCM I;  4RVD A;  4Y52 I;  1VQ8 Z;  1N8R 2;  3GTL I;  1W2B Y;  5FLX b;  1YJN Z;  1VQM P;  3CCL P;  2JA8 I;  1Y1V S;  2OTJ P;  3CME 1;  2J6A A;  5A2Q f;  3D6W A;  2OTL P;  4E2Z A;  2XXM A;  2Z44 A;  1QVF Z;  1KRL A;  3IF8 A;  1KD1 Q;  5T6B A;  1ZB8 A;  4GR2 A;  5T64 A;  3CCM 1;  3CD6 1;  3CC7 1;  3NDJ A;  2HF1 A;  3CCQ Z;  2QEX P;  3GTK I;  3HOV I;  5IP9 I;  4DQY B;  4WYM A;  2XV6 A;  2KI7 B;  3H47 A;  1L1O C;  3VB9 A;  3CC4 P;  2JA7 I;  3CCV 1;  1DL6 A;  3U50 C;  3CCS 1;  4M0I A;  2OOY B;  5C44 I;  4X6A I;  2OOX B;  4HGZ A;  3G71 P;  4Y7N I;  1K73 2;  2M48 A;  2PEM A;  1YJN P;  2EG5 A;  1VQ7 P;  1VQM 1;  3S2D I;  2QKD A;  1I6H I;  2PEK A;  3WBH A;  1KQS Y;  3GCF A;  1YHQ 1;  1NJI Q;  1K8A 1;  3G1I A;  3LRY A;  4NB8 A;  3JAM f;  4XX2 A;  3I56 P;  4A3G I;  1IUQ A;  1VQP Z;  3CCJ P;  1X3Z A;  3VRL C;  3QWU A;  5LL6 f;  1Q82 Q;  1QYP A;  2WAQ A;  4QTU A;  3BG0 B;  2VUG A;  3GTQ I;  2QRC B;  3I4M I;  2GTI A;  2Y0S A;  2JA5 I;  1Z02 A;  3DS4 A;  2QEX 1;  2RPR A;  3CXC Z;  1Q81 2;  4COC A;  1KD1 1;  3CC4 1;  3G6E P;  2YAD A;  3FKI I;  4EWC A;  3KIH A;  1JJ2 Y;  1VQ8 1;  1Z01 A;  2LF4 A;  3CPW Y;  1M1K Q;  3I4N I;  2RT9 A;  1WII A;  1YJN 1;  1NP6 A;  5FLX f;  1VQ7 1;  3HOX I;  3G28 A;  3S14 I;  1VQ4 P;  3CQZ I;  1Y1W I;  1TFI A;  1S72 Z;  1JWH C;  1VQK P;  3J7A 4;  2I3C A;  2Q4Z A;  2M8N A;  2LFU A;  3VMG A;  1WW9 A;  3I55 Z;  5C4J I;  2M6N A;  2RBL A;  2LIY A;  2JO0 A;  3MZK B;  1YJ9 Z;  3F3F C;  1NJI 1;  4XRQ A;  4NBG A;  2GTH A;  4RS4 A;  3CXC Y;  1VQN P;  3J81 b;  3CCQ 1;  3IX0 A;  3CME P;  3PO3 I;  1RO2 A;  3GTP I;  3H4E A;  1Q82 1;  2IZ3 A;  3DS0 A;  2P3Y A;  3H0G I;  1K9M 2;  3HYB A;  1Q7Y Q;  1YJW Z;  3FQM A;  3OW2 Y;  3CD6 P;  4XFY A;  3S1N I;  1K8A 2;  2PEO A;  1P9N A;  1QF8 A;  2NVY I;  3HOZ I;  3S17 I;  4XRO A;  3G4S Z;  5FLM I;  4S1T A;  3CCS P;  1KC8 1;  3RZD I;  1YIJ Z;  1M1K 1;  2L6E A;  1VQP 1;  2P9X A;  1W2B O;  4PH1 A;  1YIT P;  4PH0 A;  1X0T A;  2JMO A;  1M90 Q;  3S1Q I;  2BHV A;  1ZMB A;  2PEI A;  3NFZ A;  2AKL A;  1YHQ P;  4NFR A;  1VQN 1;  2JYL A;  4BBR I;  1KD1 2;  1M6E X;  3NTE A;  2JNY A;  1D1D A;  3NH8 A;  4U0E A;  2E2J I;  2PM9 A;  3G29 A;  4NBB A;  3Q20 A;  3M3Y I;  4A3C I;  4A93 I;  2ONT A;  3HOW I;  3CCE P;  1VQ5 Z;  4E31 A;  3CC2 Z;  1YI2 Z;  2RHB A;  2BJO A;  1LQL A;  2DE5 A;  3G0V A;  1Q86 Q;  2XT1 A;  2G2K A;  1VQ9 Z;  1ML8 A;  5F2O A;  4E32 A;  3D9X A;  1VQL Z;  1Q7Y 1;  2O4H A;  2PMZ A;  1S72 1;  1YIJ P;  2PK7 A;  5D1P A;  1NJI 2;  3CCR Z;  5T67 A;  1VQ8 P;  1YIT 1;  3I55 1;  4U0D A;  1VLA A;  1KQS O;  1QVG Z;  3S15 I;  3G21 A;  3GTJ I;  3HZQ A;  1YUA A;  3H0D A;  1EIA A;  1Q82 2;  3J81 f;  1QVG O;  1QVF Y;  4A3D I;  3CCU Z;  2DGY A;  1RLY A;  1E6J P;  1M90 1;  2NVQ I;  2DE6 A;  4U0C A;  2YU9 I;  4BBS I;  1Z03 A;  2V8K A;  2VUM I;  3CCE 1;  1RO0 A;  3S2H I;  2OZK A;  2PEQ A;  3CCQ P;  3CC2 P;  1Y1V I;  4NB9 A;  2QR1 B;  5IT9 b;  4MD9 A;  4NOZ A;  2EGT A;  3G4S 1;  3HKZ A;  3J80 f;  1M1K 2;  1K73 Q;  4MRI A;  5F2K A;  1JJ2 O;  1YIJ 1;  3GTM I;  4A3I I;  3CPW O;  1KC8 Q;  1A8O A;  3EED A;  2IZ4 A;  1Q86 1;  2R93 I;  2JS4 A;  1X3W A;  4A3F I;  1PFT A;  4U0F A;  4E2W A;  2WB1 A;  3DS1 A;  3CMA Z;  2HU9 A;  3NDI A;  1VQP P;  2R6M A;  1N2F A;  3MZL B;  1VQ6 Z;  2K5R A;  2R92 I;  3DS2 A;  3CCM Z;  4NBD A;  3CC7 Z;  1VQ5 1;  3HOU I;  3HOY I;  3MON A;  3CC2 1;  1RO4 A;  3I07 A;  1YI2 1;  1Q7Y 2;  2Z45 A;  4U0B A;  1VQ9 1;  1YUK A;  3M4O I;  2QLV B;  4A3B I;  4U0A A;  5F2N A;  3VMI A;  3K7A I;  3P5J B;  5C4X I;  3OW2 O;  2KOD A;  4BY7 I;  1R9T I;  4COP A;  5C3E I;  4QTT A;  2KPI A;  4XFZ A;  2JR6 A;  1VQM Z;  2QA4 Z;  1K73 1;  2QRE B;  2VF1 A;  1W2B Z;  3CCL Z;  4RVG A;  4DGL A;  3CCU 1;  2OTJ Z;  4MD8 A;  1S72 P;  3DPH A;  1TWC I;  3P05 A;  2R7Z I;  2OTL Z;  4GR6 A;  3GKQ A;  1EOQ A;  3I55 P;  2E2I I;  4HGY A;  4E2Y A;  1YJ9 P;  2JUB A;  4NBH A;  2CWO A;  1M74 A;  2QEX Z;  3LUS A;  4A3K I;  5HGN A;  5IT9 f;  4RV9 A;  2E2H I;  1I50 I;  3CC4 Z;  1SFO I;  1Q86 2;  1K83 I;  3VTN A;  1YJW P;  4BXX I;  3G71 Z;  4MD7 A;  1AUM A;  2QA4 P;  1A43 A;  1VQ7 Z;  2B63 I;  2P28 A;  3G4S P;  3CMA 1;  2F4M A;  1TWH I;  2K3R A;  2PEJ A;  1N8R Q;  4RVF A;  3I56 Z;  2Z46 A;  2W04 A;  1KQS Z;  1K30 A;  2F4O A;  3CCJ Z;  1TWF I;  4E2X A;  3S16 I;  2Q51 A;  1VQ6 1;  3GTM S;  3B5I A;  1YJ9 1;  4A3E I;  1QVF O;  4RVH A;  3EER A;  3TDH B;  3Q87 A;  4NBC A;  3RG6 C;  4HH4 A;  5AN9 F;  3G26 A;  5D1O A;  4A3M I;  3E2D A;  3DS5 A;  4AYB A;  3G6E Z;  1YJW 1;  5HGL A;  2OTL 1;  4E33 A;  2OAR A;  2M8L A;  5HGM A;  1VQ5 P;  1K9M 1;  5DCK A;  1YI2 P;  2QA4 1;  4NBE A;  1VQ9 P;  1VQO Z;  2GU2 A;  1JJ2 Z;  1VQ4 Z;  3NH4 A;  1KC8 2;  1VQL P;  3CPW Z;  3CCL 1;  2NVT I;  3PO3 S;  2OTJ 1;  2QRD B;  2JA6 I;  4QNB A;  1QVG Y;  1VQK Z;  2NVX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...