1RNIA

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
210
Chain Sequence
SSERIRYAKWFLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGLVILDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
molecule keywords ORF904
total genus 68
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1rniA01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1rniA03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1rniA02
1RO0A 1RNIA 3M1MA 1RO2A
chains in the Genus database with same CATH superfamily
3CXCZ 3I56P 2AKLA 1VQPZ 3CC4Z 3G71P 2Z44A 1UJZA 1NQ4A 2VPYA 4PH0A 1K8A1 2XXMA 4U0EA 2V8JA 3P5JB 1WJ2A 1D1DA 2K5XA 1GPJA 2I3CA 3JAMf 5T64A 4Y52I 1Q7Y1 2GDXA 3G711 1NP6A 3DS3A 3GKQA 1Q7Y2 3S2HI 1I50I 1VQ91 2K92A 4H2WC 2VPWA 3MONA 1VLAA 3WBHA 2JB0A 5AN9F 2PM9A 5IT9b 5I4TG 4NBHA 1YJN1 1S7MA 5F2KA 5KP6B 3LUSA 1Z02A 4F37A 4MD9A 2RT9A 2LL8A 1Q7YQ 3M1MA 1YJ9Z 5HV8A 3DS4A 2JUBA 3RG2A 2O4HA 2OZKA 3IF8A 3CCSP 4HKGA 4XFXA 2VPXA 2JU1A 2L9FA 2AYDA 3K7AI 1E0HA 1YJNP 1USPB 2M48A 1ZMBA 1VQ7P 2M8PA 3CCMP 1VQK1 2EGTA 2P9XA 1WZNA 4BY1I 3HOWI 3B5IA 3MZLB 2LTEA 2LPKA 2M8NA 2GTIA 3EJBA 2JBGA 3VTNA 4XFYA 2ONTA 4MONA 1Q821 3KIHA 1VQN1 3GTQI 3S14I 2N5IA 1VQ8P 3CCJP 2P28A 3IX0A 3GJNA 2XZ0D 2AFEA 3CC7P 3NDJA 3S15I 3GTOI 5D1PA 1VQ51 3J81f 1QVGO 2QA4Z 3P05A 3FQMA 3CCMZ 2KG9A 1YIJ1 1AF8A 4A3FI 4PXHB 3J80b 3D2LA 1AA6A 3H4EA 1KC81 3EJEA 3S1NI 3RG6C 3G28A 2GDYA 3EEDA 2VUGA 2L6EA 1K8AQ 3CCQZ 2YU9I 7CEIA 1UNKA 2MVUA 1QF8A 2QRDB 4TNUA 1YJ9P 1KC8Q 1YIT1 2N6ZA 2KI7B 1QVFZ 2JS4A 2R7ZI 1Q86Q 1Y8CA 1Q81Q 2W04A 2EHTA 4NFRA 1EMVA 5DCKA 2WAQA 5C3EI 3S1RI 3I07A 1YI2P 3IFUA 3VB9A 2QEXZ 3J81b 3CCM1 1Q82Q 2MVVA 4WYMA 2QA41 1NJI1 4MD8A 1K9M1 2Z46A 4GR2A 1VQOP 2QEX1 3OW2Y 1YJNZ 3NH5A 5EW5E 2LOLA 2LKIA 1YHQZ 1IUQA 1JWHC 1M6EX 1LQLA 2ROQA 2OTLP 2QLVB 4U0DA 4E32A 2JIMA 1W2BZ 1Q822 2JYLA 4U0CA 2L4BA 4A3JI 3CCRZ 2E2JI 2JR6A 2JU2A 1VQ5P 3HOZI 2JQ4A 2QEXP 3G4SP 4CL1A 1Q16A 2FQ1A 4MRIA 3H0GI 2FVEA 5LL6f 1JJ2O 2JA6I 2OTL1 2V3VA 3GZLA 3G26A 3QWUA 1QVFO 1N8R1 3CXCO 3U50C 2PY8A 1VQ6Z 2JO0A 3KIFA 1OR5A 5D1OB 1TWAI 1K83I 3CD6Z 2NO8A 1WIIA 3CCV1 2KOOA 2JAZA 4MXUA 4COCA 4DGLA 2FAEA 3G4SZ 2VLQA 4DG9A 2QR1B 2JA5I 2P3YA 2QREB 3CD61 1Z03A 3CCQP 2KWLA 3I551 4XFZA 2V8IA 1VQNZ 3NDIA 1SIWA 4QTUA 4XRQA 1ACPA 2OOYB 2CG5B 2QNWA 3DS2A 3CCEZ 3G1IA 1DNYA 3CCS1 3CQZI 5F2NA 2W03A 2MR8A 3B4QA 2KGEA 3CD6P 3GCFA 3CPWZ 2KPIA 4R0MA 1DV5A 2QA4P 5BS2A 4A3LI 3GTMS 3NH8A 2ERHA 1FDIA 2YADA 4X6AI 1M1KQ 2JGPA 3LMOA 2LF4A 1YUKA 1RLYA 2M5RA 2MD9A 2PEIA 1VQLZ 2XZ1C 4E33A 3E2DA 2QRCB 5T67A 2EHSA 2VLOA 2KGDA 1P9NA 2KODA 2M8LA 4NBCA 4Y7NI 2KGAA 1RO4A 4RVHA 2RHBA 1RO0A 1FR2A 4M0IA 1Y1VI 2X2BA 1Z6MA 4IPYA 2IZ4A 2JYGA 1VQ9P 1KC82 1TWFI 1DL6A 5EJDA 3GTKI 1GXGA 1Y1WI 2E2HI 2VF1A 1YI2Z 1ZB8A 3DTJA 2OTJ1 3FKII 4RVGA 2LIUA 2EIAA 3J7A4 1N2FA 1VQ6P 2FVFA 3PO2I 4COPA 5HGLA 2PMZA 4E2ZA 2F4MA 3CCQ1 3CC41 3TE5B 3CE7A 1N8RQ 1GXHA 2MF4A 3S2DI 3I4NI 3G29A 1CEIA 3CMA1 1Y1VS 1VQ7Z 2Q4ZA 5HGMA 1RO2A 1K73Q 1FDOA 2B63I 3CCJ1 3TDHB 3CCU1 1QVGZ 2NVXI 2K0DX 3RZDI 4PH1A 1NJI2 1F80D 2CWOA 2BUOA 5T6BA 3CC7Z 1Z01A 2OTJZ 1ML8A 2J6AA 5F2OA 1YIJP 1IMPA 3H47A 3G1GA 4H2YC 3OW2O 4QNBA 2K2QA 4S1TA 5C4JI 3M3YI 1I6HI 3G21A 1ZH1A 4NB8A 4IZ6A 3ESWA 3CCJZ 2KR5A 1KQSY 3HOXI 3NTEA 5FLMI 2M6NA 2DE5A 2XT1A 2NAPA 1YJ91 3RZOI 2F4OA 1M90Q 1W2BO 2E1MA 2OTJP 1L1OC 1USPA 3J80f 2GZJA 4CA3A 4E2XA 3GKLC 2K5RA 3CCRP 3EERA 3CCVP 1VQPP 2R6MA 3CC4P 4A3DI 2AF8A 2N5HA 1L0IA 1TFIA 2RIQA 4HH4A 3HOVI 2EFJA 3DS5A 2ZAEB 5KP7B 1K9MQ 3CXCY 2GZGA 3GTLI 1IMQA 2KOPA 3I55P 1M901 2K3RA 4A3GI 2QKDA 2KG6A 2VSQA 3HKZA 2MR7A 2V45A 4MH4A 3EJDA 1QRJA 3HOYI 2PEJA 1BXIA 1MZ8A 3GTGI 1E6JP 2L22A 2DGYA 5JPAA 1KRLA 4XX2A 2PEKA 4DQYB 3H3VJ 1YIJZ 2RPRA 4H2XC 3S17I 2JNYA 4NBDA 3G4S1 3CCLZ 1S72P 3FQQA 4RS4A 1QXFA 1YJWZ 3I56Z 4A3BI 1K30A 1VQ5Z 4NBFA 4HGZA 3PO3S 2LIWA 2FVAA 3NH4A 1KQSO 1KLPA 3CPWO 2E9HA 2PEQA 2K93A 2LIYA 3NFZA 2CQ8A 3CC2Z 1YHQP 2LEXA 1VQMP 5IT9f 2O53A 2PK7A 3S1MI 3VMGA 2PNGA 4DK1A 2FQ0A 2XV6A 5FLXb 1A8OA 2L0QA 4BY7I 2GZFA 3HOUI 3HYBA 1T8KA 4AYBA 3CCE1 2BJOA 4NOZA 3JAMb 4A93I 2WPTA 2OARA 5A2Qb 5CZDB 2FACA 3I55Z 2AFDA 1SFOI 1X0TA 3Q20A 2EG5A 1EIAA 2KGCA 3CCEP 2V8KA 3BG1B 4E30A 3CCVZ 4E2YA 1NUIA 2K0YA 3MGEA 4EWCA 2LMLA 1YJWP 1S72Z 1RNIA 5C44I 1HY8A 2IV2X 2E2II 3CCSZ 4MD7A 4A3MI 1M1K2 1YITZ 1S721 1AUMA 1VHNA 1JJ2Z 1QVGY 1VQ8Z 4BPHA 1VKUA 3CC21 4RVDA 4E31A 2K0XA 3D9XA 1WW9A 2VUMI 2GYKA 2G2KA 2Y0SA 2R93I 1M6NA 5IP9I 2WB1A 3I561 1YHQ1 4A3KI 3T4NB 4QTTA 4RVFA 3F3FC 1VQM1 5KP8B 3CMEZ 3NY7B 3F3PC 3S16I 3HZQA 5HGNA 4E2WA 2NVQI 1VQ61 3S1QI 1X3OA 5BS1A 3GZMA 5C4XI 2HU9A 2K94A 2GZIA 2JA8I 1Q812 2OTLZ 2BHVA 3OW2Z 2MY5A 1YUAA 2H85A 4NBGA 3D6WA 3CMAP 1KD11 4NB9A 1X3WA 2IZ3A 3CCR1 2FQ2A 4BBRI 1W2BY 3VRLC 3CCLP 1A43A 3H0DA 2JA7I 4MRTC 1X3ZA 5FLXf 4U0BA 3CCUP 2DE6A 2HF1A 3U43A 1M1K1 4U0FA 2VPZA 1YITP 4BBSI 3LRYA 1YJW1 3CCL1 2OOXB 4HGYA 4BPGA 2R92I 3CME1 1VQ71 1RQFA 5D1OA 3CMAZ 1VQKP 4A3CI 5IP7I 2JIRA 4NBEA 5CM2M 4RV9A 2KG8A 4NH1C 3DS0A 1TWGI 1HQBA 2VLPA 5HGOA 1K731 2KOSA 3G0VA 4UHPB 1L0HA 3G6EZ 1VQNP 1K732 2KW2A 3CMEP 3G71Z 1VQ81 1R9TI 1WCMI 3CC71 2GDWA 4NBBA 4QKOA 1N8R2 1I3QI 3G6E1 1NJIQ 2GZEA 4BPFA 2Q51A 3GTPI 1PFTA 3DS1A 1VQKZ 4PWVB 3VMHA 3BG0B 2E7ZA 3GTMI 5HVCA 3CPWY 4NEOA 1KD1Q 1TWCI 1VQP1 2PENA 4U0AA 1Q861 3GTJI 2VLNA 4A3EI 3G6EP 2Z45A 1K8A2 1Q811 2FHSC 1VQ4P 3Q87A 2JIPA 2AVAA 2JIQA 1KD12 3I4MI 2N98A 1ZNVA 4GR6A 1ZB9A 1VQOZ 2CGQA 1Q862 1QVFY 2GTHA 3MZKB 5A2Qf 1VQ9Z 3IR7A 1M902 2FADA 1VQ41 2RBLA 1BAJA 4BXXI 3DPHA 3VMIA 1YI21 2JMOA 2LFUA 2N50A 2NVYI 1KQSZ 2PEMA 2DE7A 1VQ4Z 4NBAA 3CCUZ 3M4OI 2GU2A 1K9M2 1TWHI 1VQLP 3PO3I 1VQO1 2PEOA 1M74A 1JJ2Y 2N6YA 2NVTI 3CC2P 2JIOA 2KOQA 1VQMZ 4A3II 1EOQA 4XROA 1QYPA 2CNRA 2DNWA 1VQL1 1AYIA 2KORA
chains in the Genus database with same CATH topology
3CXCZ 3I56P 2AKLA 1VQPZ 3CC4Z 3G71P 2Z44A 4PH0A 1K8A1 2XXMA 4U0EA 2V8JA 3P5JB 1D1DA 2I3CA 3JAMf 5T64A 4Y52I 1Q7Y1 3G711 1NP6A 3DS3A 3GKQA 1Q7Y2 3S2HI 1I50I 1VQ91 3MONA 1VLAA 3WBHA 5AN9F 2PM9A 5IT9b 5I4TG 4NBHA 1YJN1 1S7MA 5F2KA 3LUSA 1Z02A 4MD9A 2RT9A 1Q7YQ 3M1MA 1YJ9Z 3DS4A 2JUBA 2O4HA 2OZKA 3IF8A 3CCSP 4XFXA 3K7AI 1YJNP 1USPB 2M48A 1ZMBA 1VQ7P 2M8PA 3CCMP 1VQK1 2EGTA 2P9XA 4BY1I 3HOWI 3B5IA 3MZLB 2M8NA 2GTIA 3VTNA 4XFYA 2ONTA 4MONA 1Q821 3KIHA 1VQN1 3GTQI 3S14I 2P28A 1VQ8P 3CCJP 3IX0A 3CC7P 3S15I 3NDJA 3GTOI 5D1PA 1VQ51 3J81f 1QVGO 2QA4Z 3P05A 3FQMA 3CCMZ 1YIJ1 4A3FI 3J80b 3H4EA 1KC81 3S1NI 3RG6C 3G28A 3EEDA 2VUGA 2L6EA 1K8AQ 3CCQZ 2YU9I 1QF8A 2QRDB 4TNUA 1YJ9P 1KC8Q 1YIT1 2KI7B 1QVFZ 2JS4A 2R7ZI 1Q86Q 1Q81Q 2W04A 4NFRA 5DCKA 2WAQA 5C3EI 3S1RI 3I07A 1YI2P 3IFUA 3VB9A 2QEXZ 3J81b 3CCM1 1Q82Q 4WYMA 1NJI1 2QA41 4MD8A 1K9M1 2Z46A 4GR2A 1VQOP 2QEX1 3OW2Y 1YJNZ 3NH5A 1YHQZ 1IUQA 1JWHC 1M6EX 1LQLA 2OTLP 2QLVB 4U0DA 4E32A 1W2BZ 1Q822 2JYLA 4U0CA 4A3JI 3CCRZ 2E2JI 2JR6A 3HOZI 1VQ5P 2QEXP 3G4SP 4CL1A 4MRIA 3H0GI 5LL6f 1JJ2O 2JA6I 2OTL1 3G26A 3QWUA 1QVFO 1N8R1 3CXCO 3U50C 2PY8A 1VQ6Z 2JO0A 3KIFA 5D1OB 1TWAI 1K83I 3CD6Z 1WIIA 3CCV1 4MXUA 4COCA 4DGLA 3G4SZ 2QR1B 2JA5I 2P3YA 2QREB 3CD61 1Z03A 3CCQP 3I551 4XFZA 2V8IA 1VQNZ 3NDIA 4QTUA 4XRQA 2OOYB 3DS2A 3CCEZ 3G1IA 3CCS1 3CQZI 5F2NA 2W03A 3CD6P 3GCFA 3CPWZ 2KPIA 2QA4P 5BS2A 4A3LI 3GTMS 3NH8A 2YADA 4X6AI 1M1KQ 1YUKA 2LF4A 1RLYA 2PEIA 1VQLZ 4E33A 3E2DA 2QRCB 5T67A 1P9NA 2KODA 2M8LA 4NBCA 4Y7NI 1RO4A 4RVHA 2RHBA 1RO0A 4M0IA 1Y1VI 4IPYA 2IZ4A 2JYGA 1VQ9P 1KC82 1TWFI 1DL6A 3GTKI 1Y1WI 2E2HI 2VF1A 1YI2Z 1ZB8A 3DTJA 2OTJ1 3FKII 4RVGA 2EIAA 3J7A4 1N2FA 1VQ6P 3PO2I 4COPA 5HGLA 2PMZA 4E2ZA 2F4MA 3CCQ1 3CC41 3TE5B 1N8RQ 3S2DI 3I4NI 3G29A 3CMA1 1Y1VS 1VQ7Z 2Q4ZA 5HGMA 1RO2A 1K73Q 2B63I 3CCJ1 3TDHB 3CCU1 1QVGZ 2NVXI 3RZDI 4PH1A 1NJI2 2CWOA 2BUOA 5T6BA 3CC7Z 1Z01A 2OTJZ 1ML8A 2J6AA 5F2OA 1YIJP 3H47A 3G1GA 3OW2O 4QNBA 4S1TA 5C4JI 3M3YI 1I6HI 3G21A 1ZH1A 4NB8A 3CCJZ 3ESWA 1KQSY 3HOXI 3NTEA 5FLMI 2M6NA 2DE5A 2XT1A 1YJ91 3RZOI 2F4OA 1M90Q 1W2BO 2E1MA 2OTJP 1L1OC 1USPA 3J80f 4E2XA 2K5RA 3CCRP 3EERA 3CCVP 1VQPP 2R6MA 3CC4P 4A3DI 1TFIA 2RIQA 4HH4A 3HOVI 3DS5A 2EFJA 2ZAEB 3CXCY 1K9MQ 3GTLI 3I55P 1M901 2K3RA 4A3GI 2QKDA 3HKZA 4MH4A 1QRJA 3HOYI 2PEJA 3GTGI 1E6JP 5JPAA 2DGYA 1KRLA 4XX2A 4DQYB 2PEKA 3H3VJ 1YIJZ 2RPRA 3S17I 2JNYA 4NBDA 3G4S1 3CCLZ 1S72P 3FQQA 4RS4A 1YJWZ 3I56Z 4A3BI 1K30A 1VQ5Z 4NBFA 4HGZA 3PO3S 3NH4A 1KQSO 3CPWO 2E9HA 2PEQA 2LIYA 3NFZA 3CC2Z 1YHQP 1VQMP 5IT9f 2O53A 2PK7A 3S1MI 3VMGA 4DK1A 2XV6A 5FLXb 1A8OA 4BY7I 3HOUI 3HYBA 4AYBA 3CCE1 2BJOA 4NOZA 3JAMb 4A93I 2OARA 5A2Qb 3I55Z 1SFOI 1X0TA 3Q20A 2EG5A 1EIAA 3CCEP 2V8KA 3BG1B 4E30A 3CCVZ 4E2YA 1NUIA 3MGEA 4EWCA 1YJWP 1S72Z 1RNIA 5C44I 2E2II 3CCSZ 4MD7A 4A3MI 1M1K2 1YITZ 1S721 1AUMA 1JJ2Z 1QVGY 1VQ8Z 3CC21 4RVDA 4E31A 3D9XA 1WW9A 2VUMI 2G2KA 2Y0SA 2R93I 1M6NA 5IP9I 2WB1A 3I561 1YHQ1 4A3KI 3T4NB 4QTTA 4RVFA 3F3FC 1VQM1 3CMEZ 3F3PC 3S16I 3HZQA 5HGNA 4E2WA 2NVQI 1VQ61 3S1QI 5BS1A 5C4XI 2HU9A 2JA8I 1Q812 2OTLZ 2BHVA 3OW2Z 1YUAA 2H85A 4NBGA 3D6WA 3CMAP 1KD11 4NB9A 1X3WA 2IZ3A 3CCR1 4BBRI 1W2BY 3VRLC 3CCLP 1A43A 3H0DA 2JA7I 1X3ZA 5FLXf 4U0BA 3CCUP 2DE6A 2HF1A 1M1K1 4U0FA 1YITP 4BBSI 3LRYA 1YJW1 3CCL1 2OOXB 4HGYA 2R92I 3CME1 1VQ71 1RQFA 5D1OA 3CMAZ 1VQKP 4A3CI 5IP7I 4NBEA 5CM2M 4RV9A 4NH1C 3DS0A 1TWGI 5HGOA 1K731 3G0VA 3G6EZ 1VQNP 1K732 3CMEP 3G71Z 1VQ81 1R9TI 1WCMI 3CC71 4NBBA 1N8R2 1I3QI 3G6E1 1NJIQ 3GTPI 2Q51A 1PFTA 3DS1A 1VQKZ 3VMHA 3BG0B 3GTMI 3CPWY 1KD1Q 1TWCI 1VQP1 2PENA 4U0AA 1Q861 3GTJI 4A3EI 3G6EP 2Z45A 1K8A2 1Q811 1VQ4P 3Q87A 1KD12 3I4MI 4GR6A 1ZB9A 1VQOZ 1Q862 1QVFY 2GTHA 3MZKB 5A2Qf 1VQ9Z 1M902 1VQ41 2RBLA 1BAJA 4BXXI 3DPHA 3VMIA 1YI21 2JMOA 2LFUA 2NVYI 1KQSZ 2PEMA 2DE7A 1VQ4Z 4NBAA 3CCUZ 3M4OI 2GU2A 1K9M2 1TWHI 1VQLP 3PO3I 1VQO1 2PEOA 1M74A 1JJ2Y 2NVTI 3CC2P 1VQMZ 4A3II 1EOQA 4XROA 1QYPA 1VQL1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RO0 A;  1RNI A;  3M1M A;  1RO2 A; 
#chains in the Genus database with same CATH topology
 3CXC Z;  3I56 P;  2AKL A;  1VQP Z;  3CC4 Z;  3G71 P;  2Z44 A;  1UJZ A;  1NQ4 A;  2VPY A;  4PH0 A;  1K8A 1;  2XXM A;  4U0E A;  2V8J A;  3P5J B;  1WJ2 A;  1D1D A;  2K5X A;  1GPJ A;  2I3C A;  3JAM f;  5T64 A;  4Y52 I;  1Q7Y 1;  2GDX A;  3G71 1;  1NP6 A;  3DS3 A;  3GKQ A;  1Q7Y 2;  3S2H I;  1I50 I;  1VQ9 1;  2K92 A;  4H2W C;  2VPW A;  3MON A;  1VLA A;  3WBH A;  2JB0 A;  5AN9 F;  2PM9 A;  5IT9 b;  5I4T G;  4NBH A;  1YJN 1;  1S7M A;  5F2K A;  5KP6 B;  3LUS A;  1Z02 A;  4F37 A;  4MD9 A;  2RT9 A;  2LL8 A;  1Q7Y Q;  3M1M A;  1YJ9 Z;  5HV8 A;  3DS4 A;  2JUB A;  3RG2 A;  2O4H A;  2OZK A;  3IF8 A;  3CCS P;  4HKG A;  4XFX A;  2VPX A;  2JU1 A;  2L9F A;  2AYD A;  3K7A I;  1E0H A;  1YJN P;  1USP B;  2M48 A;  1ZMB A;  1VQ7 P;  2M8P A;  3CCM P;  1VQK 1;  2EGT A;  2P9X A;  1WZN A;  4BY1 I;  3HOW I;  3B5I A;  3MZL B;  2LTE A;  2LPK A;  2M8N A;  2GTI A;  3EJB A;  2JBG A;  3VTN A;  4XFY A;  2ONT A;  4MON A;  1Q82 1;  3KIH A;  1VQN 1;  3GTQ I;  3S14 I;  2N5I A;  1VQ8 P;  3CCJ P;  2P28 A;  3IX0 A;  3GJN A;  2XZ0 D;  2AFE A;  3CC7 P;  3NDJ A;  3S15 I;  3GTO I;  5D1P A;  1VQ5 1;  3J81 f;  1QVG O;  2QA4 Z;  3P05 A;  3FQM A;  3CCM Z;  2KG9 A;  1YIJ 1;  1AF8 A;  4A3F I;  4PXH B;  3J80 b;  3D2L A;  1AA6 A;  3H4E A;  1KC8 1;  3EJE A;  3S1N I;  3RG6 C;  3G28 A;  2GDY A;  3EED A;  2VUG A;  2L6E A;  1K8A Q;  3CCQ Z;  2YU9 I;  7CEI A;  1UNK A;  2MVU A;  1QF8 A;  2QRD B;  4TNU A;  1YJ9 P;  1KC8 Q;  1YIT 1;  2N6Z A;  2KI7 B;  1QVF Z;  2JS4 A;  2R7Z I;  1Q86 Q;  1Y8C A;  1Q81 Q;  2W04 A;  2EHT A;  4NFR A;  1EMV A;  5DCK A;  2WAQ A;  5C3E I;  3S1R I;  3I07 A;  1YI2 P;  3IFU A;  3VB9 A;  2QEX Z;  3J81 b;  3CCM 1;  1Q82 Q;  2MVV A;  4WYM A;  2QA4 1;  1NJI 1;  4MD8 A;  1K9M 1;  2Z46 A;  4GR2 A;  1VQO P;  2QEX 1;  3OW2 Y;  1YJN Z;  3NH5 A;  5EW5 E;  2LOL A;  2LKI A;  1YHQ Z;  1IUQ A;  1JWH C;  1M6E X;  1LQL A;  2ROQ A;  2OTL P;  2QLV B;  4U0D A;  4E32 A;  2JIM A;  1W2B Z;  1Q82 2;  2JYL A;  4U0C A;  2L4B A;  4A3J I;  3CCR Z;  2E2J I;  2JR6 A;  2JU2 A;  1VQ5 P;  3HOZ I;  2JQ4 A;  2QEX P;  3G4S P;  4CL1 A;  1Q16 A;  2FQ1 A;  4MRI A;  3H0G I;  2FVE A;  5LL6 f;  1JJ2 O;  2JA6 I;  2OTL 1;  2V3V A;  3GZL A;  3G26 A;  3QWU A;  1QVF O;  1N8R 1;  3CXC O;  3U50 C;  2PY8 A;  1VQ6 Z;  2JO0 A;  3KIF A;  1OR5 A;  5D1O B;  1TWA I;  1K83 I;  3CD6 Z;  2NO8 A;  1WII A;  3CCV 1;  2KOO A;  2JAZ A;  4MXU A;  4COC A;  4DGL A;  2FAE A;  3G4S Z;  2VLQ A;  4DG9 A;  2QR1 B;  2JA5 I;  2P3Y A;  2QRE B;  3CD6 1;  1Z03 A;  3CCQ P;  2KWL A;  3I55 1;  4XFZ A;  2V8I A;  1VQN Z;  3NDI A;  1SIW A;  4QTU A;  4XRQ A;  1ACP A;  2OOY B;  2CG5 B;  2QNW A;  3DS2 A;  3CCE Z;  3G1I A;  1DNY A;  3CCS 1;  3CQZ I;  5F2N A;  2W03 A;  2MR8 A;  3B4Q A;  2KGE A;  3CD6 P;  3GCF A;  3CPW Z;  2KPI A;  4R0M A;  1DV5 A;  2QA4 P;  5BS2 A;  4A3L I;  3GTM S;  3NH8 A;  2ERH A;  1FDI A;  2YAD A;  4X6A I;  1M1K Q;  2JGP A;  3LMO A;  2LF4 A;  1YUK A;  1RLY A;  2M5R A;  2MD9 A;  2PEI A;  1VQL Z;  2XZ1 C;  4E33 A;  3E2D A;  2QRC B;  5T67 A;  2EHS A;  2VLO A;  2KGD A;  1P9N A;  2KOD A;  2M8L A;  4NBC A;  4Y7N I;  2KGA A;  1RO4 A;  4RVH A;  2RHB A;  1RO0 A;  1FR2 A;  4M0I A;  1Y1V I;  2X2B A;  1Z6M A;  4IPY A;  2IZ4 A;  2JYG A;  1VQ9 P;  1KC8 2;  1TWF I;  1DL6 A;  5EJD A;  3GTK I;  1GXG A;  1Y1W I;  2E2H I;  2VF1 A;  1YI2 Z;  1ZB8 A;  3DTJ A;  2OTJ 1;  3FKI I;  4RVG A;  2LIU A;  2EIA A;  3J7A 4;  1N2F A;  1VQ6 P;  2FVF A;  3PO2 I;  4COP A;  5HGL A;  2PMZ A;  4E2Z A;  2F4M A;  3CCQ 1;  3CC4 1;  3TE5 B;  3CE7 A;  1N8R Q;  1GXH A;  2MF4 A;  3S2D I;  3I4N I;  3G29 A;  1CEI A;  3CMA 1;  1Y1V S;  1VQ7 Z;  2Q4Z A;  5HGM A;  1RO2 A;  1K73 Q;  1FDO A;  2B63 I;  3CCJ 1;  3TDH B;  3CCU 1;  1QVG Z;  2NVX I;  2K0D X;  3RZD I;  4PH1 A;  1NJI 2;  1F80 D;  2CWO A;  2BUO A;  5T6B A;  3CC7 Z;  1Z01 A;  2OTJ Z;  1ML8 A;  2J6A A;  5F2O A;  1YIJ P;  1IMP A;  3H47 A;  3G1G A;  4H2Y C;  3OW2 O;  4QNB A;  2K2Q A;  4S1T A;  5C4J I;  3M3Y I;  1I6H I;  3G21 A;  1ZH1 A;  4NB8 A;  4IZ6 A;  3ESW A;  3CCJ Z;  2KR5 A;  1KQS Y;  3HOX I;  3NTE A;  5FLM I;  2M6N A;  2DE5 A;  2XT1 A;  2NAP A;  1YJ9 1;  3RZO I;  2F4O A;  1M90 Q;  1W2B O;  2E1M A;  2OTJ P;  1L1O C;  1USP A;  3J80 f;  2GZJ A;  4CA3 A;  4E2X A;  3GKL C;  2K5R A;  3CCR P;  3EER A;  3CCV P;  1VQP P;  2R6M A;  3CC4 P;  4A3D I;  2AF8 A;  2N5H A;  1L0I A;  1TFI A;  2RIQ A;  4HH4 A;  3HOV I;  2EFJ A;  3DS5 A;  2ZAE B;  5KP7 B;  1K9M Q;  3CXC Y;  2GZG A;  3GTL I;  1IMQ A;  2KOP A;  3I55 P;  1M90 1;  2K3R A;  4A3G I;  2QKD A;  2KG6 A;  2VSQ A;  3HKZ A;  2MR7 A;  2V45 A;  4MH4 A;  3EJD A;  1QRJ A;  3HOY I;  2PEJ A;  1BXI A;  1MZ8 A;  3GTG I;  1E6J P;  2L22 A;  2DGY A;  5JPA A;  1KRL A;  4XX2 A;  2PEK A;  4DQY B;  3H3V J;  1YIJ Z;  2RPR A;  4H2X C;  3S17 I;  2JNY A;  4NBD A;  3G4S 1;  3CCL Z;  1S72 P;  3FQQ A;  4RS4 A;  1QXF A;  1YJW Z;  3I56 Z;  4A3B I;  1K30 A;  1VQ5 Z;  4NBF A;  4HGZ A;  3PO3 S;  2LIW A;  2FVA A;  3NH4 A;  1KQS O;  1KLP A;  3CPW O;  2E9H A;  2PEQ A;  2K93 A;  2LIY A;  3NFZ A;  2CQ8 A;  3CC2 Z;  1YHQ P;  2LEX A;  1VQM P;  5IT9 f;  2O53 A;  2PK7 A;  3S1M I;  3VMG A;  2PNG A;  4DK1 A;  2FQ0 A;  2XV6 A;  5FLX b;  1A8O A;  2L0Q A;  4BY7 I;  2GZF A;  3HOU I;  3HYB A;  1T8K A;  4AYB A;  3CCE 1;  2BJO A;  4NOZ A;  3JAM b;  4A93 I;  2WPT A;  2OAR A;  5A2Q b;  5CZD B;  2FAC A;  3I55 Z;  2AFD A;  1SFO I;  1X0T A;  3Q20 A;  2EG5 A;  1EIA A;  2KGC A;  3CCE P;  2V8K A;  3BG1 B;  4E30 A;  3CCV Z;  4E2Y A;  1NUI A;  2K0Y A;  3MGE A;  4EWC A;  2LML A;  1YJW P;  1S72 Z;  1RNI A;  5C44 I;  1HY8 A;  2IV2 X;  2E2I I;  3CCS Z;  4MD7 A;  4A3M I;  1M1K 2;  1YIT Z;  1S72 1;  1AUM A;  1VHN A;  1JJ2 Z;  1QVG Y;  1VQ8 Z;  4BPH A;  1VKU A;  3CC2 1;  4RVD A;  4E31 A;  2K0X A;  3D9X A;  1WW9 A;  2VUM I;  2GYK A;  2G2K A;  2Y0S A;  2R93 I;  1M6N A;  5IP9 I;  2WB1 A;  3I56 1;  1YHQ 1;  4A3K I;  3T4N B;  4QTT A;  4RVF A;  3F3F C;  1VQM 1;  5KP8 B;  3CME Z;  3NY7 B;  3F3P C;  3S16 I;  3HZQ A;  5HGN A;  4E2W A;  2NVQ I;  1VQ6 1;  3S1Q I;  1X3O A;  5BS1 A;  3GZM A;  5C4X I;  2HU9 A;  2K94 A;  2GZI A;  2JA8 I;  1Q81 2;  2OTL Z;  2BHV A;  3OW2 Z;  2MY5 A;  1YUA A;  2H85 A;  4NBG A;  3D6W A;  3CMA P;  1KD1 1;  4NB9 A;  1X3W A;  2IZ3 A;  3CCR 1;  2FQ2 A;  4BBR I;  1W2B Y;  3VRL C;  3CCL P;  1A43 A;  3H0D A;  2JA7 I;  4MRT C;  1X3Z A;  5FLX f;  4U0B A;  3CCU P;  2DE6 A;  2HF1 A;  3U43 A;  1M1K 1;  4U0F A;  2VPZ A;  1YIT P;  4BBS I;  3LRY A;  1YJW 1;  3CCL 1;  2OOX B;  4HGY A;  4BPG A;  2R92 I;  3CME 1;  1VQ7 1;  1RQF A;  5D1O A;  3CMA Z;  1VQK P;  4A3C I;  5IP7 I;  2JIR A;  4NBE A;  5CM2 M;  4RV9 A;  2KG8 A;  4NH1 C;  3DS0 A;  1TWG I;  1HQB A;  2VLP A;  5HGO A;  1K73 1;  2KOS A;  3G0V A;  4UHP B;  1L0H A;  3G6E Z;  1VQN P;  1K73 2;  2KW2 A;  3CME P;  3G71 Z;  1VQ8 1;  1R9T I;  1WCM I;  3CC7 1;  2GDW A;  4NBB A;  4QKO A;  1N8R 2;  1I3Q I;  3G6E 1;  1NJI Q;  2GZE A;  4BPF A;  2Q51 A;  3GTP I;  1PFT A;  3DS1 A;  1VQK Z;  4PWV B;  3VMH A;  3BG0 B;  2E7Z A;  3GTM I;  5HVC A;  3CPW Y;  4NEO A;  1KD1 Q;  1TWC I;  1VQP 1;  2PEN A;  4U0A A;  1Q86 1;  3GTJ I;  2VLN A;  4A3E I;  3G6E P;  2Z45 A;  1K8A 2;  1Q81 1;  2FHS C;  1VQ4 P;  3Q87 A;  2JIP A;  2AVA A;  2JIQ A;  1KD1 2;  3I4M I;  2N98 A;  1ZNV A;  4GR6 A;  1ZB9 A;  1VQO Z;  2CGQ A;  1Q86 2;  1QVF Y;  2GTH A;  3MZK B;  5A2Q f;  1VQ9 Z;  3IR7 A;  1M90 2;  2FAD A;  1VQ4 1;  2RBL A;  1BAJ A;  4BXX I;  3DPH A;  3VMI A;  1YI2 1;  2JMO A;  2LFU A;  2N50 A;  2NVY I;  1KQS Z;  2PEM A;  2DE7 A;  1VQ4 Z;  4NBA A;  3CCU Z;  3M4O I;  2GU2 A;  1K9M 2;  1TWH I;  1VQL P;  3PO3 I;  1VQO 1;  2PEO A;  1M74 A;  1JJ2 Y;  2N6Y A;  2NVT I;  3CC2 P;  2JIO A;  2KOQ A;  1VQM Z;  4A3I I;  1EOQ A;  4XRO A;  1QYP A;  2CNR A;  2DNW A;  1VQL 1;  1AYI A;  2KOR A; 
#chains in the Genus database with same CATH homology
 3CXC Z;  3I56 P;  2AKL A;  1VQP Z;  3CC4 Z;  3G71 P;  2Z44 A;  4PH0 A;  1K8A 1;  2XXM A;  4U0E A;  2V8J A;  3P5J B;  1D1D A;  2I3C A;  3JAM f;  5T64 A;  4Y52 I;  1Q7Y 1;  3G71 1;  1NP6 A;  3DS3 A;  3GKQ A;  1Q7Y 2;  3S2H I;  1I50 I;  1VQ9 1;  3MON A;  1VLA A;  3WBH A;  5AN9 F;  2PM9 A;  5IT9 b;  5I4T G;  4NBH A;  1YJN 1;  1S7M A;  5F2K A;  3LUS A;  1Z02 A;  4MD9 A;  2RT9 A;  1Q7Y Q;  3M1M A;  1YJ9 Z;  3DS4 A;  2JUB A;  2O4H A;  2OZK A;  3IF8 A;  3CCS P;  4XFX A;  3K7A I;  1YJN P;  1USP B;  2M48 A;  1ZMB A;  1VQ7 P;  2M8P A;  3CCM P;  1VQK 1;  2EGT A;  2P9X A;  4BY1 I;  3HOW I;  3B5I A;  3MZL B;  2M8N A;  2GTI A;  3VTN A;  4XFY A;  2ONT A;  4MON A;  1Q82 1;  3KIH A;  1VQN 1;  3GTQ I;  3S14 I;  2P28 A;  1VQ8 P;  3CCJ P;  3IX0 A;  3CC7 P;  3S15 I;  3NDJ A;  3GTO I;  5D1P A;  1VQ5 1;  3J81 f;  1QVG O;  2QA4 Z;  3P05 A;  3FQM A;  3CCM Z;  1YIJ 1;  4A3F I;  3J80 b;  3H4E A;  1KC8 1;  3S1N I;  3RG6 C;  3G28 A;  3EED A;  2VUG A;  2L6E A;  1K8A Q;  3CCQ Z;  2YU9 I;  1QF8 A;  2QRD B;  4TNU A;  1YJ9 P;  1KC8 Q;  1YIT 1;  2KI7 B;  1QVF Z;  2JS4 A;  2R7Z I;  1Q86 Q;  1Q81 Q;  2W04 A;  4NFR A;  5DCK A;  2WAQ A;  5C3E I;  3S1R I;  3I07 A;  1YI2 P;  3IFU A;  3VB9 A;  2QEX Z;  3J81 b;  3CCM 1;  1Q82 Q;  4WYM A;  1NJI 1;  2QA4 1;  4MD8 A;  1K9M 1;  2Z46 A;  4GR2 A;  1VQO P;  2QEX 1;  3OW2 Y;  1YJN Z;  3NH5 A;  1YHQ Z;  1IUQ A;  1JWH C;  1M6E X;  1LQL A;  2OTL P;  2QLV B;  4U0D A;  4E32 A;  1W2B Z;  1Q82 2;  2JYL A;  4U0C A;  4A3J I;  3CCR Z;  2E2J I;  2JR6 A;  3HOZ I;  1VQ5 P;  2QEX P;  3G4S P;  4CL1 A;  4MRI A;  3H0G I;  5LL6 f;  1JJ2 O;  2JA6 I;  2OTL 1;  3G26 A;  3QWU A;  1QVF O;  1N8R 1;  3CXC O;  3U50 C;  2PY8 A;  1VQ6 Z;  2JO0 A;  3KIF A;  5D1O B;  1TWA I;  1K83 I;  3CD6 Z;  1WII A;  3CCV 1;  4MXU A;  4COC A;  4DGL A;  3G4S Z;  2QR1 B;  2JA5 I;  2P3Y A;  2QRE B;  3CD6 1;  1Z03 A;  3CCQ P;  3I55 1;  4XFZ A;  2V8I A;  1VQN Z;  3NDI A;  4QTU A;  4XRQ A;  2OOY B;  3DS2 A;  3CCE Z;  3G1I A;  3CCS 1;  3CQZ I;  5F2N A;  2W03 A;  3CD6 P;  3GCF A;  3CPW Z;  2KPI A;  2QA4 P;  5BS2 A;  4A3L I;  3GTM S;  3NH8 A;  2YAD A;  4X6A I;  1M1K Q;  1YUK A;  2LF4 A;  1RLY A;  2PEI A;  1VQL Z;  4E33 A;  3E2D A;  2QRC B;  5T67 A;  1P9N A;  2KOD A;  2M8L A;  4NBC A;  4Y7N I;  1RO4 A;  4RVH A;  2RHB A;  1RO0 A;  4M0I A;  1Y1V I;  4IPY A;  2IZ4 A;  2JYG A;  1VQ9 P;  1KC8 2;  1TWF I;  1DL6 A;  3GTK I;  1Y1W I;  2E2H I;  2VF1 A;  1YI2 Z;  1ZB8 A;  3DTJ A;  2OTJ 1;  3FKI I;  4RVG A;  2EIA A;  3J7A 4;  1N2F A;  1VQ6 P;  3PO2 I;  4COP A;  5HGL A;  2PMZ A;  4E2Z A;  2F4M A;  3CCQ 1;  3CC4 1;  3TE5 B;  1N8R Q;  3S2D I;  3I4N I;  3G29 A;  3CMA 1;  1Y1V S;  1VQ7 Z;  2Q4Z A;  5HGM A;  1RO2 A;  1K73 Q;  2B63 I;  3CCJ 1;  3TDH B;  3CCU 1;  1QVG Z;  2NVX I;  3RZD I;  4PH1 A;  1NJI 2;  2CWO A;  2BUO A;  5T6B A;  3CC7 Z;  1Z01 A;  2OTJ Z;  1ML8 A;  2J6A A;  5F2O A;  1YIJ P;  3H47 A;  3G1G A;  3OW2 O;  4QNB A;  4S1T A;  5C4J I;  3M3Y I;  1I6H I;  3G21 A;  1ZH1 A;  4NB8 A;  3CCJ Z;  3ESW A;  1KQS Y;  3HOX I;  3NTE A;  5FLM I;  2M6N A;  2DE5 A;  2XT1 A;  1YJ9 1;  3RZO I;  2F4O A;  1M90 Q;  1W2B O;  2E1M A;  2OTJ P;  1L1O C;  1USP A;  3J80 f;  4E2X A;  2K5R A;  3CCR P;  3EER A;  3CCV P;  1VQP P;  2R6M A;  3CC4 P;  4A3D I;  1TFI A;  2RIQ A;  4HH4 A;  3HOV I;  3DS5 A;  2EFJ A;  2ZAE B;  3CXC Y;  1K9M Q;  3GTL I;  3I55 P;  1M90 1;  2K3R A;  4A3G I;  2QKD A;  3HKZ A;  4MH4 A;  1QRJ A;  3HOY I;  2PEJ A;  3GTG I;  1E6J P;  5JPA A;  2DGY A;  1KRL A;  4XX2 A;  4DQY B;  2PEK A;  3H3V J;  1YIJ Z;  2RPR A;  3S17 I;  2JNY A;  4NBD A;  3G4S 1;  3CCL Z;  1S72 P;  3FQQ A;  4RS4 A;  1YJW Z;  3I56 Z;  4A3B I;  1K30 A;  1VQ5 Z;  4NBF A;  4HGZ A;  3PO3 S;  3NH4 A;  1KQS O;  3CPW O;  2E9H A;  2PEQ A;  2LIY A;  3NFZ A;  3CC2 Z;  1YHQ P;  1VQM P;  5IT9 f;  2O53 A;  2PK7 A;  3S1M I;  3VMG A;  4DK1 A;  2XV6 A;  5FLX b;  1A8O A;  4BY7 I;  3HOU I;  3HYB A;  4AYB A;  3CCE 1;  2BJO A;  4NOZ A;  3JAM b;  4A93 I;  2OAR A;  5A2Q b;  3I55 Z;  1SFO I;  1X0T A;  3Q20 A;  2EG5 A;  1EIA A;  3CCE P;  2V8K A;  3BG1 B;  4E30 A;  3CCV Z;  4E2Y A;  1NUI A;  3MGE A;  4EWC A;  1YJW P;  1S72 Z;  1RNI A;  5C44 I;  2E2I I;  3CCS Z;  4MD7 A;  4A3M I;  1M1K 2;  1YIT Z;  1S72 1;  1AUM A;  1JJ2 Z;  1QVG Y;  1VQ8 Z;  3CC2 1;  4RVD A;  4E31 A;  3D9X A;  1WW9 A;  2VUM I;  2G2K A;  2Y0S A;  2R93 I;  1M6N A;  5IP9 I;  2WB1 A;  3I56 1;  1YHQ 1;  4A3K I;  3T4N B;  4QTT A;  4RVF A;  3F3F C;  1VQM 1;  3CME Z;  3F3P C;  3S16 I;  3HZQ A;  5HGN A;  4E2W A;  2NVQ I;  1VQ6 1;  3S1Q I;  5BS1 A;  5C4X I;  2HU9 A;  2JA8 I;  1Q81 2;  2OTL Z;  2BHV A;  3OW2 Z;  1YUA A;  2H85 A;  4NBG A;  3D6W A;  3CMA P;  1KD1 1;  4NB9 A;  1X3W A;  2IZ3 A;  3CCR 1;  4BBR I;  1W2B Y;  3VRL C;  3CCL P;  1A43 A;  3H0D A;  2JA7 I;  1X3Z A;  5FLX f;  4U0B A;  3CCU P;  2DE6 A;  2HF1 A;  1M1K 1;  4U0F A;  1YIT P;  4BBS I;  3LRY A;  1YJW 1;  3CCL 1;  2OOX B;  4HGY A;  2R92 I;  3CME 1;  1VQ7 1;  1RQF A;  5D1O A;  3CMA Z;  1VQK P;  4A3C I;  5IP7 I;  4NBE A;  5CM2 M;  4RV9 A;  4NH1 C;  3DS0 A;  1TWG I;  5HGO A;  1K73 1;  3G0V A;  3G6E Z;  1VQN P;  1K73 2;  3CME P;  3G71 Z;  1VQ8 1;  1R9T I;  1WCM I;  3CC7 1;  4NBB A;  1N8R 2;  1I3Q I;  3G6E 1;  1NJI Q;  3GTP I;  2Q51 A;  1PFT A;  3DS1 A;  1VQK Z;  3VMH A;  3BG0 B;  3GTM I;  3CPW Y;  1KD1 Q;  1TWC I;  1VQP 1;  2PEN A;  4U0A A;  1Q86 1;  3GTJ I;  4A3E I;  3G6E P;  2Z45 A;  1K8A 2;  1Q81 1;  1VQ4 P;  3Q87 A;  1KD1 2;  3I4M I;  4GR6 A;  1ZB9 A;  1VQO Z;  1Q86 2;  1QVF Y;  2GTH A;  3MZK B;  5A2Q f;  1VQ9 Z;  1M90 2;  1VQ4 1;  2RBL A;  1BAJ A;  4BXX I;  3DPH A;  3VMI A;  1YI2 1;  2JMO A;  2LFU A;  2NVY I;  1KQS Z;  2PEM A;  2DE7 A;  1VQ4 Z;  4NBA A;  3CCU Z;  3M4O I;  2GU2 A;  1K9M 2;  1TWH I;  1VQL P;  3PO3 I;  1VQO 1;  2PEO A;  1M74 A;  1JJ2 Y;  2NVT I;  3CC2 P;  1VQM Z;  4A3I I;  1EOQ A;  4XRO A;  1QYP A;  1VQL 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...