1RNIA

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
210
Chain Sequence
SSERIRYAKWFLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGLVILDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
molecule keywords ORF904
total genus 68
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1rniA01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1rniA03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1rniA02
1RNIA 1RO2A 3M1MA 1RO0A
chains in the Genus database with same CATH superfamily
1YHQZ 2KR5A 3CCJZ 1YIJZ 1WW9A 2NVTI 3M3YI 2R92I 3NTEA 2DE5A 3S1MI 2P9XA 3GZMA 1ZB9A 1TWHI 2VLOA 2E2HI 4NBGA 2OZKA 4DG9A 4A3EI 2JO0A 2B63I 2FADA 3RG6C 4A3GI 1JJ2Y 1FR2A 5IP7I 2PMZA 5FLXf 3BG1B 2W03A 1X3WA 1YJ91 2E1MA 4NB9A 3HOVI 2RIQA 5C3EI 4BPGA 1TWGI 1X3OA 1EMVA 4QTUA 4COCA 5KP6B 3DS5A 5IP9I 3I551 1Z02A 2AYDA 3GCFA 5KP7B 4NH1C 1QXFA 2O53A 2JIOA 1RQFA 1Z6MA 4WYMA 5T64A 3GTQI 1K9MQ 2K5XA 2KWLA 4PWVB 1NUIA 2VPWA 3G1IA 2K2QA 1YITP 2L9FA 4U0DA 3QWUA 5C44I 1VQMZ 5HGNA 3CCRP 2JYLA 4PXHB 2OOYB 7CEIA 2N98A 2N50A 2XV6A 4DK1A 3CCQ1 2PNGA 3HZQA 4XRQA 3TDHB 4A3JI 4QTTA 2QA4Z 1YI2P 2F4MA 3I4MI 2DE7A 3CXCY 5FLMI 1Y1VS 3I55P 4E2WA 5EW5E 1VQL1 4DQYB 1FDOA 5F2OA 5F2KA 1X0TA 3CD61 2GZGA 4A3BI 4E2ZA 1E0HA 1F80D 1T8KA 3LMOA 2O4HA 3KIFA 2PEIA 3JAMb 1P9NA 3J7A4 2EGTA 3CQZI 1K9M2 4A3FI 5T67A 1YJWZ 2NVQI 5C4JI 3GZLA 1S7MA 4COPA 4F37A 1VQ51 2FAEA 3CE7A 1VQ9Z 3CCRZ 3B5IA 1YJN1 3S2HI 1QVGO 1L0HA 2GDWA 4RVDA 5FLXb 3NH4A 2PM9A 2OARA 3CPWY 2EHTA 4BY7I 3VMGA 3CPWO 2I3CA 2JGPA 3G1GA 4H2YC 2PEOA 1KRLA 2F4OA 4NBAA 1AYIA 1N8R2 2V8KA 4E2XA 2JIQA 2KOOA 3CCE1 2JBGA 3RZDI 3TE5B 1KLPA 1VQPP 2N5HA 3CCS1 2NVYI 2AF8A 2KOSA 2VPYA 1KD12 3CCMP 2FQ1A 3CC71 3CCQP 1M902 3CC4P 2PENA 1JJ2Z 3I07A 1GXHA 2CQ8A 1M1K2 3NFZA 3S14I 2QEXP 1Q82Q 1DV5A 3VRLC 4XROA 5D1OA 5LL6f 1IMQA 4RVFA 1OR5A 3I561 1USPA 2OTJP 1YJ9Z 1SFOI 3S15I 2JA8I 2Y0SA 2GZEA 4NOZA 1VQ91 1VQ5Z 2CG5B 3NH5A 3EJEA 3CCR1 1DNYA 3VMHA 1YJNZ 2PEJA 2AKLA 2PK7A 3DS2A 2M8LA 1USPB 1TWAI 3IF8A 4AYBA 3CCLP 1YUAA 3JAMf 5CM2M 2KGDA 3G711 1VQ4P 2VLPA 1UJZA 3IX0A 3CXCO 3VTNA 2IZ4A 2E9HA 3F3PC 2LMLA 2XXMA 1K73Q 2H85A 4NFRA 2VUMI 1K8AQ 2V8IA 3LRYA 2HU9A 4MRIA 1N8R1 3HOZI 2EIAA 1VQO1 1QRJA 2BUOA 3GKQA 1YUKA 2KGEA 3CMEZ 1Q861 3H0DA 4UHPB 1HQBA 5A2Qb 3HYBA 1N2FA 2K93A 2GTHA 2KG6A 2W04A 2M8PA 1K83I 3MZLB 1AF8A 1Q811 4RVHA 5BS1A 1X3ZA 2QRDB 3CCEP 1QVFZ 2K0YA 2QNWA 3CPWZ 4U0AA 2DE6A 4MXUA 1VQOZ 3G21A 2OTLZ 1VQ8P 2LIYA 4A3II 4TNUA 2AVAA 3P05A 2JUBA 4XX2A 1KQSY 2KORA 3WBHA 1KQSO 5KP8B 1ZH1A 3DPHA 3GTPI 4NBCA 2VSQA 2Z46A 3FQMA 1BXIA 3OW2O 1WZNA 1K9M1 3M1MA 3D2LA 3S1NI 4BBSI 1KC82 1K8A2 4MRTC 2LOLA 2MY5A 1VQ7P 2M5RA 4R0MA 3MONA 2V45A 4A3DI 3EEDA 3HOWI 2FVEA 3RZOI 3E2DA 1ACPA 3U50C 1VQLP 3I55Z 2X2BA 5I4TG 2PEKA 4U0EA 4X6AI 3DS0A 1VQ8Z 5D1PA 1E6JP 2FVAA 1HY8A 3G6EP 1YHQP 2K3RA 3CCJP 1YIJP 4CL1A 2AFDA 5HV8A 2ONTA 2L6EA 2CNRA 2HF1A 1Y8CA 3CCQZ 1M6EX 1L1OC 1VQ41 1JJ2O 3CCV1 3CMA1 4BPHA 2L4BA 1A43A 2Q51A 4IZ6A 1AUMA 1VQM1 2GDXA 1KD11 2P28A 2LIWA 3GTMI 1YIT1 1W2BY 5DCKA 3Q87A 4GR2A 1VQNP 2QA4P 4HKGA 4NBHA 1LQLA 2E2JI 2OOXB 1M74A 3I56P 1M1K1 5C4XI 1VQN1 4MD8A 3CCEZ 3H3VJ 1QF8A 1UNKA 3MZKB 4DGLA 4S1TA 2L22A 2QEX1 4PH0A 2Z44A 3NDIA 3G4SP 3PO3I 1PFTA 3NH8A 3CCLZ 3CCUP 3EJDA 2Q4ZA 4E32A 1VLAA 3CCMZ 2VPXA 4MH4A 1VKUA 1VQKP 2KG8A 3G6E1 3CME1 4XFZA 2QKDA 1FDIA 2RT9A 3S1QI 2K0XA 1Y1WI 1Q86Q 2CWOA 1EOQA 2FVFA 1KQSZ 2VLNA 3GTOI 4EWCA 5HVCA 2JIPA 1WJ2A 5CZDB 1QVFY 1NQ4A 2GZFA 2MD9A 1S721 3OW2Z 2R7ZI 1VQ71 2PEMA 2VUGA 3Q20A 2FQ0A 3CCSZ 3GJNA 2RBLA 3J80b 5BS2A 2JB0A 1RO0A 2OTLP 1ZB8A 2BJOA 2R93I 2VLQA 3CC2P 1VQ5P 2GZIA 1EIAA 2E7ZA 3J81f 1ML8A 3NDJA 2R6MA 3J81b 1VQ6Z 3GTGI 2FHSC 2BHVA 1WIIA 5HGOA 3LUSA 4MD9A 3J80f 2QEXZ 3S1RI 1NJI2 4GR6A 2JU2A 1MZ8A 3G4S1 2M48A 3GTMS 3EERA 2MVVA 3CMEP 1VQNZ 2JIRA 2EG5A 2KGAA 1TFIA 3DTJA 3FQQA 4HGYA 1YI21 1RNIA 2GYKA 1DL6A 2ERHA 2IZ3A 2KODA 1VQ61 1KD1Q 2M8NA 3CCL1 2JA5I 4RS4A 1W2BZ 2N6ZA 1YI2Z 1JWHC 4MD7A 1BAJA 2XZ1C 2GU2A 1VQOP 3HOYI 4BXXI 2N6YA 3CC2Z 1VQ4Z 5F2NA 1YJW1 1ZNVA 4HH4A 3S17I 2LF4A 2P3YA 2GDYA 1Z03A 1R9TI 2OTJ1 4HGZA 3HOUI 2EFJA 5IT9b 1VQ6P 3H0GI 3PO2I 3G26A 3G71P 2XZ0D 2KI7B 1Q821 4M0IA 3HOXI 1QVGZ 1SIWA 4H2WC 1YJWP 2K5RA 4NBFA 3CMAP 3CCVP 1IMPA 3S2DI 4QKOA 1VQ9P 1Q7YQ 3CC41 2PY8A 1RLYA 5HGMA 3NY7B 3CC7Z 4Y7NI 2KGCA 2KOQA 2KPIA 2WPTA 3I56Z 3GTKI 1IUQA 2K0DX 2JIMA 3CCSP 3FKII 2MF4A 2KG9A 2QRCB 4NB8A 4NBBA 1W2BO 1Q7Y2 1I6HI 2LFUA 3CD6Z 1Y1VI 3D6WA 3G4SZ 3H4EA 4A93I 1NJIQ 1Q81Q 2VF1A 3G0VA 2J6AA 1KC81 1K8A1 3S16I 3I4NI 1ZMBA 3GKLC 1VQLZ 3G29A 3EJBA 1Q7Y1 1K30A 4IPYA 3GTJI 3F3FC 4BPFA 1NP6A 3G6EZ 2QR1B 4U0BA 1YITZ 2E2II 1QYPA 2AFEA 3HKZA 2QREB 2KW2A 3CC21 4A3LI 2ZAEB 3BG0B 2N5IA 1K732 3M4OI 4H2XC 1TWFI 2JQ4A 2EHSA 1VQK1 2VPZA 2GTIA 1S72P 1S72Z 1RO2A 1QVFO 2CGQA 1Q16A 4A3MI 1VQ81 3CCU1 2K92A 2V3VA 5HGLA 2G2KA 3CD6P 3ESWA 3H47A 1GXGA 2M6NA 3IR7A 4BBRI 4E33A 1Q862 2JNYA 3MGEA 2QLVB 3CCUZ 3P5JB 1L0IA 4NEOA 3G71Z 4CA3A 1VQPZ 2NVXI 2RHBA 2LEXA 3D9XA 2JMOA 2V8JA 4E30A 2PEQA 3CMAZ 3CCVZ 1Q812 2DGYA 2KOPA 1Z01A 1VQMP 3VB9A 2K94A 4QNBA 4E31A 1VQ7Z 2FACA 1QVGY 5A2Qf 5AN9F 2JAZA 1NJI1 3RG2A 3CCJ1 2ROQA 2QA41 1YHQ1 1YIJ1 2RPRA 1GPJA 1M6NA 4RVGA 3B4QA 4U0FA 4RV9A 2NO8A 5D1OB 2LL8A 1N8RQ 5T6BA 3CXCZ 2GZJA 1VHNA 1D1DA 1VQKZ 1K731 2LPKA 4A3CI 1WCMI 2JA6I 3GTLI 3CC4Z 3T4NB 3K7AI 2LKIA 2XT1A 3CCM1 2MR8A 3VMIA 4XFXA 3DS1A 1I50I 4PH1A 2WB1A 2YADA 5EJDA 3CC7P 2IV2X 3DS3A 4MONA 4A3KI 2NAPA 2YU9I 2OTJZ 1YJ9P 2JYGA 2Z45A 1A8OA 2L0QA 2LTEA 2MR7A 1VQP1 1M901 2JR6A 3DS4A 2JU1A 1KC8Q 4NBEA 1Q822 1I3QI 3KIHA 3OW2Y 3IFUA 2OTL1 5IT9f 4U0CA 2JA7I 4XFYA 1M1KQ 1YJNP 2FQ2A 1TWCI 3U43A 2LIUA 1M90Q 1CEIA 3G28A 4NBDA 1AA6A 2JS4A 1RO4A 2MVUA 3PO3S 4Y52I 2WAQA 5JPAA 2DNWA 4E2YA 4BY1I
chains in the Genus database with same CATH topology
1YHQZ 3CCJZ 1YIJZ 1WW9A 2NVTI 3M3YI 2R92I 3NTEA 2DE5A 3S1MI 2P9XA 1ZB9A 1TWHI 2E2HI 4NBGA 2OZKA 4A3EI 2JO0A 2B63I 3RG6C 4A3GI 1JJ2Y 5IP7I 2PMZA 5FLXf 3BG1B 2W03A 1X3WA 1YJ91 2E1MA 4NB9A 3HOVI 2RIQA 5C3EI 1TWGI 4QTUA 4COCA 3DS5A 5IP9I 3I551 1Z02A 3GCFA 4NH1C 2O53A 1RQFA 5T64A 4WYMA 3GTQI 1K9MQ 1NUIA 3G1IA 1YITP 4U0DA 3QWUA 5C44I 1VQMZ 5HGNA 3CCRP 2JYLA 2OOYB 4DK1A 2XV6A 3CCQ1 3HZQA 4XRQA 3TDHB 4A3JI 4QTTA 2QA4Z 1YI2P 2F4MA 3I4MI 2DE7A 3CXCY 5FLMI 1Y1VS 3I55P 4E2WA 1VQL1 4DQYB 5F2OA 5F2KA 1X0TA 3CD61 4A3BI 4E2ZA 2O4HA 3KIFA 2PEIA 3JAMb 1P9NA 3J7A4 2EGTA 3CQZI 1K9M2 4A3FI 5T67A 1YJWZ 2NVQI 5C4JI 1S7MA 4COPA 1VQ51 1VQ9Z 3CCRZ 3B5IA 1YJN1 3S2HI 1QVGO 4RVDA 5FLXb 3NH4A 2PM9A 2OARA 3CPWY 4BY7I 3VMGA 3CPWO 2I3CA 3G1GA 1KRLA 2PEOA 2F4OA 4NBAA 1N8R2 2V8KA 4E2XA 3CCE1 3RZDI 3TE5B 1VQPP 3CCS1 2NVYI 1KD12 3CCMP 3CC71 3CCQP 1M902 3CC4P 2PENA 1JJ2Z 3I07A 1M1K2 3S14I 3NFZA 2QEXP 1Q82Q 3VRLC 4XROA 5D1OA 5LL6f 4RVFA 3I561 1USPA 2OTJP 1YJ9Z 1SFOI 3S15I 2JA8I 2Y0SA 4NOZA 1VQ91 1VQ5Z 3NH5A 3CCR1 1YJNZ 3VMHA 2PEJA 2AKLA 2PK7A 3DS2A 2M8LA 1USPB 1TWAI 3IF8A 4AYBA 3CCLP 1YUAA 3JAMf 5CM2M 3G711 1VQ4P 3IX0A 3CXCO 3VTNA 2IZ4A 2E9HA 3F3PC 2XXMA 1K73Q 2H85A 4NFRA 2VUMI 1K8AQ 2V8IA 3LRYA 2HU9A 4MRIA 1N8R1 3HOZI 2EIAA 1VQO1 1QRJA 2BUOA 3GKQA 1YUKA 3CMEZ 1Q861 3H0DA 5A2Qb 3HYBA 1N2FA 2GTHA 2W04A 2M8PA 1K83I 3MZLB 1Q811 4RVHA 5BS1A 1X3ZA 2QRDB 3CCEP 1QVFZ 3CPWZ 4U0AA 2DE6A 4MXUA 1VQOZ 3G21A 2OTLZ 1VQ8P 2LIYA 4A3II 4TNUA 3P05A 2JUBA 4XX2A 1KQSY 3WBHA 1KQSO 1ZH1A 3DPHA 3GTPI 4NBCA 2Z46A 3FQMA 3OW2O 1K9M1 3M1MA 3S1NI 4BBSI 1KC82 1K8A2 1VQ7P 3MONA 4A3DI 3EEDA 3HOWI 3RZOI 3E2DA 3U50C 3I55Z 1VQLP 5I4TG 2PEKA 4U0EA 4X6AI 3DS0A 1VQ8Z 5D1PA 1E6JP 3G6EP 1YHQP 2K3RA 3CCJP 1YIJP 4CL1A 2ONTA 2L6EA 2HF1A 3CCQZ 1M6EX 1L1OC 1VQ41 1JJ2O 3CCV1 3CMA1 1A43A 2Q51A 1AUMA 1VQM1 1KD11 2P28A 3GTMI 1YIT1 1W2BY 5DCKA 3Q87A 4GR2A 1VQNP 2QA4P 4NBHA 1LQLA 2E2JI 2OOXB 1M74A 3I56P 1M1K1 5C4XI 1VQN1 4MD8A 3CCEZ 3H3VJ 1QF8A 3MZKB 4DGLA 4S1TA 2QEX1 4PH0A 2Z44A 3NDIA 3G4SP 3PO3I 1PFTA 3NH8A 3CCLZ 3CCUP 2Q4ZA 4E32A 1VLAA 3CCMZ 4MH4A 1VQKP 3G6E1 3CME1 2RT9A 4XFZA 2QKDA 3S1QI 1Y1WI 1Q86Q 2CWOA 1EOQA 1KQSZ 3GTOI 4EWCA 1QVFY 1S721 3OW2Z 2R7ZI 1VQ71 2PEMA 2VUGA 3Q20A 3CCSZ 2RBLA 3J80b 5BS2A 1RO0A 2OTLP 1ZB8A 2BJOA 2R93I 3CC2P 1VQ5P 1EIAA 3J81f 1ML8A 3NDJA 2R6MA 3J81b 1VQ6Z 3GTGI 2BHVA 1WIIA 5HGOA 3LUSA 4MD9A 3J80f 2QEXZ 3S1RI 1NJI2 4GR6A 3G4S1 2M48A 3GTMS 3EERA 1VQNZ 3CMEP 2EG5A 1TFIA 3DTJA 3FQQA 4HGYA 1YI21 1RNIA 1DL6A 2IZ3A 1VQ61 2KODA 1KD1Q 2M8NA 3CCL1 2JA5I 4RS4A 1W2BZ 1YI2Z 1JWHC 4MD7A 1BAJA 2GU2A 1VQOP 3HOYI 4BXXI 3CC2Z 1VQ4Z 5F2NA 1YJW1 4HH4A 3S17I 2LF4A 2P3YA 1Z03A 1R9TI 2OTJ1 4HGZA 3HOUI 2EFJA 5IT9b 1VQ6P 3H0GI 3PO2I 3G26A 3G71P 1Q821 2KI7B 4M0IA 3HOXI 1QVGZ 1YJWP 2K5RA 4NBFA 3CMAP 3CCVP 3S2DI 3CC41 1Q7YQ 1VQ9P 2PY8A 1RLYA 5HGMA 3CC7Z 4Y7NI 2KPIA 3I56Z 3GTKI 1IUQA 3CCSP 3FKII 2QRCB 4NB8A 4NBBA 1W2BO 1Q7Y2 1I6HI 2LFUA 3CD6Z 1Y1VI 3D6WA 3G4SZ 3H4EA 4A93I 1NJIQ 1Q81Q 2VF1A 3G0VA 2J6AA 1KC81 1K8A1 3S16I 3I4NI 1ZMBA 1VQLZ 3G29A 1Q7Y1 1K30A 4IPYA 3GTJI 3F3FC 1NP6A 3G6EZ 2QR1B 4U0BA 1YITZ 2E2II 1QYPA 3HKZA 2QREB 3CC21 4A3LI 2ZAEB 3BG0B 1K732 3M4OI 1TWFI 1VQK1 2GTIA 1S72P 1S72Z 1RO2A 1QVFO 4A3MI 1VQ81 3CCU1 5HGLA 2G2KA 3CD6P 3ESWA 3H47A 2M6NA 4BBRI 4E33A 1Q862 2JNYA 3MGEA 2QLVB 3CCUZ 3P5JB 3G71Z 1VQPZ 2NVXI 2RHBA 3D9XA 2JMOA 2V8JA 4E30A 2PEQA 3CMAZ 3CCVZ 1Q812 2DGYA 1Z01A 1VQMP 3VB9A 4QNBA 4E31A 1VQ7Z 1QVGY 5A2Qf 5AN9F 1NJI1 3CCJ1 1YIJ1 2QA41 1YHQ1 2RPRA 1M6NA 4RVGA 4U0FA 4RV9A 5D1OB 1N8RQ 5T6BA 3CXCZ 1D1DA 1VQKZ 1K731 4A3CI 1WCMI 2JA6I 3GTLI 3CC4Z 3T4NB 3K7AI 2XT1A 3CCM1 3VMIA 4XFXA 3DS1A 1I50I 4PH1A 2WB1A 2YADA 3CC7P 4A3KI 3DS3A 4MONA 2YU9I 2OTJZ 1YJ9P 2JYGA 2Z45A 1A8OA 1VQP1 1M901 2JR6A 3DS4A 1KC8Q 4NBEA 1Q822 1I3QI 3KIHA 3OW2Y 3IFUA 2OTL1 5IT9f 4U0CA 2JA7I 4XFYA 1M1KQ 1YJNP 1TWCI 1M90Q 3G28A 4NBDA 2JS4A 1RO4A 3PO3S 4Y52I 2WAQA 5JPAA 4E2YA 4BY1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RNI A;  1RO2 A;  3M1M A;  1RO0 A; 
#chains in the Genus database with same CATH topology
 1YHQ Z;  2KR5 A;  3CCJ Z;  1YIJ Z;  1WW9 A;  2NVT I;  3M3Y I;  2R92 I;  3NTE A;  2DE5 A;  3S1M I;  2P9X A;  3GZM A;  1ZB9 A;  1TWH I;  2VLO A;  2E2H I;  4NBG A;  2OZK A;  4DG9 A;  4A3E I;  2JO0 A;  2B63 I;  2FAD A;  3RG6 C;  4A3G I;  1JJ2 Y;  1FR2 A;  5IP7 I;  2PMZ A;  5FLX f;  3BG1 B;  2W03 A;  1X3W A;  1YJ9 1;  2E1M A;  4NB9 A;  3HOV I;  2RIQ A;  5C3E I;  4BPG A;  1TWG I;  1X3O A;  1EMV A;  4QTU A;  4COC A;  5KP6 B;  3DS5 A;  5IP9 I;  3I55 1;  1Z02 A;  2AYD A;  3GCF A;  5KP7 B;  4NH1 C;  1QXF A;  2O53 A;  2JIO A;  1RQF A;  1Z6M A;  4WYM A;  5T64 A;  3GTQ I;  1K9M Q;  2K5X A;  2KWL A;  4PWV B;  1NUI A;  2VPW A;  3G1I A;  2K2Q A;  1YIT P;  2L9F A;  4U0D A;  3QWU A;  5C44 I;  1VQM Z;  5HGN A;  3CCR P;  2JYL A;  4PXH B;  2OOY B;  7CEI A;  2N98 A;  2N50 A;  2XV6 A;  4DK1 A;  3CCQ 1;  2PNG A;  3HZQ A;  4XRQ A;  3TDH B;  4A3J I;  4QTT A;  2QA4 Z;  1YI2 P;  2F4M A;  3I4M I;  2DE7 A;  3CXC Y;  5FLM I;  1Y1V S;  3I55 P;  4E2W A;  5EW5 E;  1VQL 1;  4DQY B;  1FDO A;  5F2O A;  5F2K A;  1X0T A;  3CD6 1;  2GZG A;  4A3B I;  4E2Z A;  1E0H A;  1F80 D;  1T8K A;  3LMO A;  2O4H A;  3KIF A;  2PEI A;  3JAM b;  1P9N A;  3J7A 4;  2EGT A;  3CQZ I;  1K9M 2;  4A3F I;  5T67 A;  1YJW Z;  2NVQ I;  5C4J I;  3GZL A;  1S7M A;  4COP A;  4F37 A;  1VQ5 1;  2FAE A;  3CE7 A;  1VQ9 Z;  3CCR Z;  3B5I A;  1YJN 1;  3S2H I;  1QVG O;  1L0H A;  2GDW A;  4RVD A;  5FLX b;  3NH4 A;  2PM9 A;  2OAR A;  3CPW Y;  2EHT A;  4BY7 I;  3VMG A;  3CPW O;  2I3C A;  2JGP A;  3G1G A;  4H2Y C;  2PEO A;  1KRL A;  2F4O A;  4NBA A;  1AYI A;  1N8R 2;  2V8K A;  4E2X A;  2JIQ A;  2KOO A;  3CCE 1;  2JBG A;  3RZD I;  3TE5 B;  1KLP A;  1VQP P;  2N5H A;  3CCS 1;  2NVY I;  2AF8 A;  2KOS A;  2VPY A;  1KD1 2;  3CCM P;  2FQ1 A;  3CC7 1;  3CCQ P;  1M90 2;  3CC4 P;  2PEN A;  1JJ2 Z;  3I07 A;  1GXH A;  2CQ8 A;  1M1K 2;  3NFZ A;  3S14 I;  2QEX P;  1Q82 Q;  1DV5 A;  3VRL C;  4XRO A;  5D1O A;  5LL6 f;  1IMQ A;  4RVF A;  1OR5 A;  3I56 1;  1USP A;  2OTJ P;  1YJ9 Z;  1SFO I;  3S15 I;  2JA8 I;  2Y0S A;  2GZE A;  4NOZ A;  1VQ9 1;  1VQ5 Z;  2CG5 B;  3NH5 A;  3EJE A;  3CCR 1;  1DNY A;  3VMH A;  1YJN Z;  2PEJ A;  2AKL A;  2PK7 A;  3DS2 A;  2M8L A;  1USP B;  1TWA I;  3IF8 A;  4AYB A;  3CCL P;  1YUA A;  3JAM f;  5CM2 M;  2KGD A;  3G71 1;  1VQ4 P;  2VLP A;  1UJZ A;  3IX0 A;  3CXC O;  3VTN A;  2IZ4 A;  2E9H A;  3F3P C;  2LML A;  2XXM A;  1K73 Q;  2H85 A;  4NFR A;  2VUM I;  1K8A Q;  2V8I A;  3LRY A;  2HU9 A;  4MRI A;  1N8R 1;  3HOZ I;  2EIA A;  1VQO 1;  1QRJ A;  2BUO A;  3GKQ A;  1YUK A;  2KGE A;  3CME Z;  1Q86 1;  3H0D A;  4UHP B;  1HQB A;  5A2Q b;  3HYB A;  1N2F A;  2K93 A;  2GTH A;  2KG6 A;  2W04 A;  2M8P A;  1K83 I;  3MZL B;  1AF8 A;  1Q81 1;  4RVH A;  5BS1 A;  1X3Z A;  2QRD B;  3CCE P;  1QVF Z;  2K0Y A;  2QNW A;  3CPW Z;  4U0A A;  2DE6 A;  4MXU A;  1VQO Z;  3G21 A;  2OTL Z;  1VQ8 P;  2LIY A;  4A3I I;  4TNU A;  2AVA A;  3P05 A;  2JUB A;  4XX2 A;  1KQS Y;  2KOR A;  3WBH A;  1KQS O;  5KP8 B;  1ZH1 A;  3DPH A;  3GTP I;  4NBC A;  2VSQ A;  2Z46 A;  3FQM A;  1BXI A;  3OW2 O;  1WZN A;  1K9M 1;  3M1M A;  3D2L A;  3S1N I;  4BBS I;  1KC8 2;  1K8A 2;  4MRT C;  2LOL A;  2MY5 A;  1VQ7 P;  2M5R A;  4R0M A;  3MON A;  2V45 A;  4A3D I;  3EED A;  3HOW I;  2FVE A;  3RZO I;  3E2D A;  1ACP A;  3U50 C;  1VQL P;  3I55 Z;  2X2B A;  5I4T G;  2PEK A;  4U0E A;  4X6A I;  3DS0 A;  1VQ8 Z;  5D1P A;  1E6J P;  2FVA A;  1HY8 A;  3G6E P;  1YHQ P;  2K3R A;  3CCJ P;  1YIJ P;  4CL1 A;  2AFD A;  5HV8 A;  2ONT A;  2L6E A;  2CNR A;  2HF1 A;  1Y8C A;  3CCQ Z;  1M6E X;  1L1O C;  1VQ4 1;  1JJ2 O;  3CCV 1;  3CMA 1;  4BPH A;  2L4B A;  1A43 A;  2Q51 A;  4IZ6 A;  1AUM A;  1VQM 1;  2GDX A;  1KD1 1;  2P28 A;  2LIW A;  3GTM I;  1YIT 1;  1W2B Y;  5DCK A;  3Q87 A;  4GR2 A;  1VQN P;  2QA4 P;  4HKG A;  4NBH A;  1LQL A;  2E2J I;  2OOX B;  1M74 A;  3I56 P;  1M1K 1;  5C4X I;  1VQN 1;  4MD8 A;  3CCE Z;  3H3V J;  1QF8 A;  1UNK A;  3MZK B;  4DGL A;  4S1T A;  2L22 A;  2QEX 1;  4PH0 A;  2Z44 A;  3NDI A;  3G4S P;  3PO3 I;  1PFT A;  3NH8 A;  3CCL Z;  3CCU P;  3EJD A;  2Q4Z A;  4E32 A;  1VLA A;  3CCM Z;  2VPX A;  4MH4 A;  1VKU A;  1VQK P;  2KG8 A;  3G6E 1;  3CME 1;  4XFZ A;  2QKD A;  1FDI A;  2RT9 A;  3S1Q I;  2K0X A;  1Y1W I;  1Q86 Q;  2CWO A;  1EOQ A;  2FVF A;  1KQS Z;  2VLN A;  3GTO I;  4EWC A;  5HVC A;  2JIP A;  1WJ2 A;  5CZD B;  1QVF Y;  1NQ4 A;  2GZF A;  2MD9 A;  1S72 1;  3OW2 Z;  2R7Z I;  1VQ7 1;  2PEM A;  2VUG A;  3Q20 A;  2FQ0 A;  3CCS Z;  3GJN A;  2RBL A;  3J80 b;  5BS2 A;  2JB0 A;  1RO0 A;  2OTL P;  1ZB8 A;  2BJO A;  2R93 I;  2VLQ A;  3CC2 P;  1VQ5 P;  2GZI A;  1EIA A;  2E7Z A;  3J81 f;  1ML8 A;  3NDJ A;  2R6M A;  3J81 b;  1VQ6 Z;  3GTG I;  2FHS C;  2BHV A;  1WII A;  5HGO A;  3LUS A;  4MD9 A;  3J80 f;  2QEX Z;  3S1R I;  1NJI 2;  4GR6 A;  2JU2 A;  1MZ8 A;  3G4S 1;  2M48 A;  3GTM S;  3EER A;  2MVV A;  3CME P;  1VQN Z;  2JIR A;  2EG5 A;  2KGA A;  1TFI A;  3DTJ A;  3FQQ A;  4HGY A;  1YI2 1;  1RNI A;  2GYK A;  1DL6 A;  2ERH A;  2IZ3 A;  2KOD A;  1VQ6 1;  1KD1 Q;  2M8N A;  3CCL 1;  2JA5 I;  4RS4 A;  1W2B Z;  2N6Z A;  1YI2 Z;  1JWH C;  4MD7 A;  1BAJ A;  2XZ1 C;  2GU2 A;  1VQO P;  3HOY I;  4BXX I;  2N6Y A;  3CC2 Z;  1VQ4 Z;  5F2N A;  1YJW 1;  1ZNV A;  4HH4 A;  3S17 I;  2LF4 A;  2P3Y A;  2GDY A;  1Z03 A;  1R9T I;  2OTJ 1;  4HGZ A;  3HOU I;  2EFJ A;  5IT9 b;  1VQ6 P;  3H0G I;  3PO2 I;  3G26 A;  3G71 P;  2XZ0 D;  2KI7 B;  1Q82 1;  4M0I A;  3HOX I;  1QVG Z;  1SIW A;  4H2W C;  1YJW P;  2K5R A;  4NBF A;  3CMA P;  3CCV P;  1IMP A;  3S2D I;  4QKO A;  1VQ9 P;  1Q7Y Q;  3CC4 1;  2PY8 A;  1RLY A;  5HGM A;  3NY7 B;  3CC7 Z;  4Y7N I;  2KGC A;  2KOQ A;  2KPI A;  2WPT A;  3I56 Z;  3GTK I;  1IUQ A;  2K0D X;  2JIM A;  3CCS P;  3FKI I;  2MF4 A;  2KG9 A;  2QRC B;  4NB8 A;  4NBB A;  1W2B O;  1Q7Y 2;  1I6H I;  2LFU A;  3CD6 Z;  1Y1V I;  3D6W A;  3G4S Z;  3H4E A;  4A93 I;  1NJI Q;  1Q81 Q;  2VF1 A;  3G0V A;  2J6A A;  1KC8 1;  1K8A 1;  3S16 I;  3I4N I;  1ZMB A;  3GKL C;  1VQL Z;  3G29 A;  3EJB A;  1Q7Y 1;  1K30 A;  4IPY A;  3GTJ I;  3F3F C;  4BPF A;  1NP6 A;  3G6E Z;  2QR1 B;  4U0B A;  1YIT Z;  2E2I I;  1QYP A;  2AFE A;  3HKZ A;  2QRE B;  2KW2 A;  3CC2 1;  4A3L I;  2ZAE B;  3BG0 B;  2N5I A;  1K73 2;  3M4O I;  4H2X C;  1TWF I;  2JQ4 A;  2EHS A;  1VQK 1;  2VPZ A;  2GTI A;  1S72 P;  1S72 Z;  1RO2 A;  1QVF O;  2CGQ A;  1Q16 A;  4A3M I;  1VQ8 1;  3CCU 1;  2K92 A;  2V3V A;  5HGL A;  2G2K A;  3CD6 P;  3ESW A;  3H47 A;  1GXG A;  2M6N A;  3IR7 A;  4BBR I;  4E33 A;  1Q86 2;  2JNY A;  3MGE A;  2QLV B;  3CCU Z;  3P5J B;  1L0I A;  4NEO A;  3G71 Z;  4CA3 A;  1VQP Z;  2NVX I;  2RHB A;  2LEX A;  3D9X A;  2JMO A;  2V8J A;  4E30 A;  2PEQ A;  3CMA Z;  3CCV Z;  1Q81 2;  2DGY A;  2KOP A;  1Z01 A;  1VQM P;  3VB9 A;  2K94 A;  4QNB A;  4E31 A;  1VQ7 Z;  2FAC A;  1QVG Y;  5A2Q f;  5AN9 F;  2JAZ A;  1NJI 1;  3RG2 A;  3CCJ 1;  2ROQ A;  2QA4 1;  1YHQ 1;  1YIJ 1;  2RPR A;  1GPJ A;  1M6N A;  4RVG A;  3B4Q A;  4U0F A;  4RV9 A;  2NO8 A;  5D1O B;  2LL8 A;  1N8R Q;  5T6B A;  3CXC Z;  2GZJ A;  1VHN A;  1D1D A;  1VQK Z;  1K73 1;  2LPK A;  4A3C I;  1WCM I;  2JA6 I;  3GTL I;  3CC4 Z;  3T4N B;  3K7A I;  2LKI A;  2XT1 A;  3CCM 1;  2MR8 A;  3VMI A;  4XFX A;  3DS1 A;  1I50 I;  4PH1 A;  2WB1 A;  2YAD A;  5EJD A;  3CC7 P;  2IV2 X;  3DS3 A;  4MON A;  4A3K I;  2NAP A;  2YU9 I;  2OTJ Z;  1YJ9 P;  2JYG A;  2Z45 A;  1A8O A;  2L0Q A;  2LTE A;  2MR7 A;  1VQP 1;  1M90 1;  2JR6 A;  3DS4 A;  2JU1 A;  1KC8 Q;  4NBE A;  1Q82 2;  1I3Q I;  3KIH A;  3OW2 Y;  3IFU A;  2OTL 1;  5IT9 f;  4U0C A;  2JA7 I;  4XFY A;  1M1K Q;  1YJN P;  2FQ2 A;  1TWC I;  3U43 A;  2LIU A;  1M90 Q;  1CEI A;  3G28 A;  4NBD A;  1AA6 A;  2JS4 A;  1RO4 A;  2MVU A;  3PO3 S;  4Y52 I;  2WAQ A;  5JPA A;  2DNW A;  4E2Y A;  4BY1 I; 
#chains in the Genus database with same CATH homology
 1YHQ Z;  3CCJ Z;  1YIJ Z;  1WW9 A;  2NVT I;  3M3Y I;  2R92 I;  3NTE A;  2DE5 A;  3S1M I;  2P9X A;  1ZB9 A;  1TWH I;  2E2H I;  4NBG A;  2OZK A;  4A3E I;  2JO0 A;  2B63 I;  3RG6 C;  4A3G I;  1JJ2 Y;  5IP7 I;  2PMZ A;  5FLX f;  3BG1 B;  2W03 A;  1X3W A;  1YJ9 1;  2E1M A;  4NB9 A;  3HOV I;  2RIQ A;  5C3E I;  1TWG I;  4QTU A;  4COC A;  3DS5 A;  5IP9 I;  3I55 1;  1Z02 A;  3GCF A;  4NH1 C;  2O53 A;  1RQF A;  5T64 A;  4WYM A;  3GTQ I;  1K9M Q;  1NUI A;  3G1I A;  1YIT P;  4U0D A;  3QWU A;  5C44 I;  1VQM Z;  5HGN A;  3CCR P;  2JYL A;  2OOY B;  4DK1 A;  2XV6 A;  3CCQ 1;  3HZQ A;  4XRQ A;  3TDH B;  4A3J I;  4QTT A;  2QA4 Z;  1YI2 P;  2F4M A;  3I4M I;  2DE7 A;  3CXC Y;  5FLM I;  1Y1V S;  3I55 P;  4E2W A;  1VQL 1;  4DQY B;  5F2O A;  5F2K A;  1X0T A;  3CD6 1;  4A3B I;  4E2Z A;  2O4H A;  3KIF A;  2PEI A;  3JAM b;  1P9N A;  3J7A 4;  2EGT A;  3CQZ I;  1K9M 2;  4A3F I;  5T67 A;  1YJW Z;  2NVQ I;  5C4J I;  1S7M A;  4COP A;  1VQ5 1;  1VQ9 Z;  3CCR Z;  3B5I A;  1YJN 1;  3S2H I;  1QVG O;  4RVD A;  5FLX b;  3NH4 A;  2PM9 A;  2OAR A;  3CPW Y;  4BY7 I;  3VMG A;  3CPW O;  2I3C A;  3G1G A;  1KRL A;  2PEO A;  2F4O A;  4NBA A;  1N8R 2;  2V8K A;  4E2X A;  3CCE 1;  3RZD I;  3TE5 B;  1VQP P;  3CCS 1;  2NVY I;  1KD1 2;  3CCM P;  3CC7 1;  3CCQ P;  1M90 2;  3CC4 P;  2PEN A;  1JJ2 Z;  3I07 A;  1M1K 2;  3S14 I;  3NFZ A;  2QEX P;  1Q82 Q;  3VRL C;  4XRO A;  5D1O A;  5LL6 f;  4RVF A;  3I56 1;  1USP A;  2OTJ P;  1YJ9 Z;  1SFO I;  3S15 I;  2JA8 I;  2Y0S A;  4NOZ A;  1VQ9 1;  1VQ5 Z;  3NH5 A;  3CCR 1;  1YJN Z;  3VMH A;  2PEJ A;  2AKL A;  2PK7 A;  3DS2 A;  2M8L A;  1USP B;  1TWA I;  3IF8 A;  4AYB A;  3CCL P;  1YUA A;  3JAM f;  5CM2 M;  3G71 1;  1VQ4 P;  3IX0 A;  3CXC O;  3VTN A;  2IZ4 A;  2E9H A;  3F3P C;  2XXM A;  1K73 Q;  2H85 A;  4NFR A;  2VUM I;  1K8A Q;  2V8I A;  3LRY A;  2HU9 A;  4MRI A;  1N8R 1;  3HOZ I;  2EIA A;  1VQO 1;  1QRJ A;  2BUO A;  3GKQ A;  1YUK A;  3CME Z;  1Q86 1;  3H0D A;  5A2Q b;  3HYB A;  1N2F A;  2GTH A;  2W04 A;  2M8P A;  1K83 I;  3MZL B;  1Q81 1;  4RVH A;  5BS1 A;  1X3Z A;  2QRD B;  3CCE P;  1QVF Z;  3CPW Z;  4U0A A;  2DE6 A;  4MXU A;  1VQO Z;  3G21 A;  2OTL Z;  1VQ8 P;  2LIY A;  4A3I I;  4TNU A;  3P05 A;  2JUB A;  4XX2 A;  1KQS Y;  3WBH A;  1KQS O;  1ZH1 A;  3DPH A;  3GTP I;  4NBC A;  2Z46 A;  3FQM A;  3OW2 O;  1K9M 1;  3M1M A;  3S1N I;  4BBS I;  1KC8 2;  1K8A 2;  1VQ7 P;  3MON A;  4A3D I;  3EED A;  3HOW I;  3RZO I;  3E2D A;  3U50 C;  3I55 Z;  1VQL P;  5I4T G;  2PEK A;  4U0E A;  4X6A I;  3DS0 A;  1VQ8 Z;  5D1P A;  1E6J P;  3G6E P;  1YHQ P;  2K3R A;  3CCJ P;  1YIJ P;  4CL1 A;  2ONT A;  2L6E A;  2HF1 A;  3CCQ Z;  1M6E X;  1L1O C;  1VQ4 1;  1JJ2 O;  3CCV 1;  3CMA 1;  1A43 A;  2Q51 A;  1AUM A;  1VQM 1;  1KD1 1;  2P28 A;  3GTM I;  1YIT 1;  1W2B Y;  5DCK A;  3Q87 A;  4GR2 A;  1VQN P;  2QA4 P;  4NBH A;  1LQL A;  2E2J I;  2OOX B;  1M74 A;  3I56 P;  1M1K 1;  5C4X I;  1VQN 1;  4MD8 A;  3CCE Z;  3H3V J;  1QF8 A;  3MZK B;  4DGL A;  4S1T A;  2QEX 1;  4PH0 A;  2Z44 A;  3NDI A;  3G4S P;  3PO3 I;  1PFT A;  3NH8 A;  3CCL Z;  3CCU P;  2Q4Z A;  4E32 A;  1VLA A;  3CCM Z;  4MH4 A;  1VQK P;  3G6E 1;  3CME 1;  2RT9 A;  4XFZ A;  2QKD A;  3S1Q I;  1Y1W I;  1Q86 Q;  2CWO A;  1EOQ A;  1KQS Z;  3GTO I;  4EWC A;  1QVF Y;  1S72 1;  3OW2 Z;  2R7Z I;  1VQ7 1;  2PEM A;  2VUG A;  3Q20 A;  3CCS Z;  2RBL A;  3J80 b;  5BS2 A;  1RO0 A;  2OTL P;  1ZB8 A;  2BJO A;  2R93 I;  3CC2 P;  1VQ5 P;  1EIA A;  3J81 f;  1ML8 A;  3NDJ A;  2R6M A;  3J81 b;  1VQ6 Z;  3GTG I;  2BHV A;  1WII A;  5HGO A;  3LUS A;  4MD9 A;  3J80 f;  2QEX Z;  3S1R I;  1NJI 2;  4GR6 A;  3G4S 1;  2M48 A;  3GTM S;  3EER A;  1VQN Z;  3CME P;  2EG5 A;  1TFI A;  3DTJ A;  3FQQ A;  4HGY A;  1YI2 1;  1RNI A;  1DL6 A;  2IZ3 A;  1VQ6 1;  2KOD A;  1KD1 Q;  2M8N A;  3CCL 1;  2JA5 I;  4RS4 A;  1W2B Z;  1YI2 Z;  1JWH C;  4MD7 A;  1BAJ A;  2GU2 A;  1VQO P;  3HOY I;  4BXX I;  3CC2 Z;  1VQ4 Z;  5F2N A;  1YJW 1;  4HH4 A;  3S17 I;  2LF4 A;  2P3Y A;  1Z03 A;  1R9T I;  2OTJ 1;  4HGZ A;  3HOU I;  2EFJ A;  5IT9 b;  1VQ6 P;  3H0G I;  3PO2 I;  3G26 A;  3G71 P;  1Q82 1;  2KI7 B;  4M0I A;  3HOX I;  1QVG Z;  1YJW P;  2K5R A;  4NBF A;  3CMA P;  3CCV P;  3S2D I;  3CC4 1;  1Q7Y Q;  1VQ9 P;  2PY8 A;  1RLY A;  5HGM A;  3CC7 Z;  4Y7N I;  2KPI A;  3I56 Z;  3GTK I;  1IUQ A;  3CCS P;  3FKI I;  2QRC B;  4NB8 A;  4NBB A;  1W2B O;  1Q7Y 2;  1I6H I;  2LFU A;  3CD6 Z;  1Y1V I;  3D6W A;  3G4S Z;  3H4E A;  4A93 I;  1NJI Q;  1Q81 Q;  2VF1 A;  3G0V A;  2J6A A;  1KC8 1;  1K8A 1;  3S16 I;  3I4N I;  1ZMB A;  1VQL Z;  3G29 A;  1Q7Y 1;  1K30 A;  4IPY A;  3GTJ I;  3F3F C;  1NP6 A;  3G6E Z;  2QR1 B;  4U0B A;  1YIT Z;  2E2I I;  1QYP A;  3HKZ A;  2QRE B;  3CC2 1;  4A3L I;  2ZAE B;  3BG0 B;  1K73 2;  3M4O I;  1TWF I;  1VQK 1;  2GTI A;  1S72 P;  1S72 Z;  1RO2 A;  1QVF O;  4A3M I;  1VQ8 1;  3CCU 1;  5HGL A;  2G2K A;  3CD6 P;  3ESW A;  3H47 A;  2M6N A;  4BBR I;  4E33 A;  1Q86 2;  2JNY A;  3MGE A;  2QLV B;  3CCU Z;  3P5J B;  3G71 Z;  1VQP Z;  2NVX I;  2RHB A;  3D9X A;  2JMO A;  2V8J A;  4E30 A;  2PEQ A;  3CMA Z;  3CCV Z;  1Q81 2;  2DGY A;  1Z01 A;  1VQM P;  3VB9 A;  4QNB A;  4E31 A;  1VQ7 Z;  1QVG Y;  5A2Q f;  5AN9 F;  1NJI 1;  3CCJ 1;  1YIJ 1;  2QA4 1;  1YHQ 1;  2RPR A;  1M6N A;  4RVG A;  4U0F A;  4RV9 A;  5D1O B;  1N8R Q;  5T6B A;  3CXC Z;  1D1D A;  1VQK Z;  1K73 1;  4A3C I;  1WCM I;  2JA6 I;  3GTL I;  3CC4 Z;  3T4N B;  3K7A I;  2XT1 A;  3CCM 1;  3VMI A;  4XFX A;  3DS1 A;  1I50 I;  4PH1 A;  2WB1 A;  2YAD A;  3CC7 P;  4A3K I;  3DS3 A;  4MON A;  2YU9 I;  2OTJ Z;  1YJ9 P;  2JYG A;  2Z45 A;  1A8O A;  1VQP 1;  1M90 1;  2JR6 A;  3DS4 A;  1KC8 Q;  4NBE A;  1Q82 2;  1I3Q I;  3KIH A;  3OW2 Y;  3IFU A;  2OTL 1;  5IT9 f;  4U0C A;  2JA7 I;  4XFY A;  1M1K Q;  1YJN P;  1TWC I;  1M90 Q;  3G28 A;  4NBD A;  2JS4 A;  1RO4 A;  3PO3 S;  4Y52 I;  2WAQ A;  5JPA A;  4E2Y A;  4BY1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...