1F80D

Holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
74
structure length
73
Chain Sequence
SADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of substrate binding to Bacillus subtilis holo-(acyl carrier protein) synthase reveal a novel trimeric arrangement of molecules resulting in three active sites.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords HOLO-(ACYL CARRIER PROTEIN) SYNTHASE
total genus 23
structure length 73
sequence length 74
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2000-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1f80D00
2K94A 3NY7B 2PNGA 1DNYA 2KORA 2K2QA 2MVVA 1L0HA 1F80D 2FVEA 2JU2A 2MF4A 2AVAA 2KGCA 3EJEA 4H2YC 3CE7A 4MRTC 2VSQA 2XZ1C 2L4BA 2KR5A 2N50A 5KP8B 2X2BA 2FVAA 1HY8A 2KOPA 2MVUA 4CA3A 2N5IA 2MR7A 2KG6A 2GDWA 4H2XC 2LMLA 4HKGA 4H2WC 2MY5A 4BPFA 3EJBA 5CZDB 5KP6B 3LMOA 2CNRA 3EJDA 2FACA 2KW2A 1ACPA 3RG2A 2JGPA 5HV8A 2FHSC 2N98A 2EHSA 1DV5A 4DG9A 2LOLA 2KWLA 2XZ0D 2N6ZA 4IZ6A 2N6YA 2GDXA 2L22A 2M5RA 2AF8A 2QNWA 1AF8A 2CGQA 2FQ0A 1NQ4A 2KOSA 2LPKA 2KG8A 2KOOA 2JQ4A 2LTEA 2KOQA 2GDYA 2FQ1A 1OR5A 2L0QA 1X3OA 2JU1A 2KGDA 3GZLA 1KLPA 2ROQA 2DNWA 2CG5B 2CQ8A 2LIWA 2K0YA 4R0MA 4BPHA 2LL8A 2AFEA 2MD9A 2EHTA 2L9FA 2FVFA 4BPGA 1HQBA 2K93A 2AFDA 2KG9A 1VKUA 2MR8A 2N5HA 5HVCA 2FADA 5EJDA 4PXHB 2KGEA 4NEOA 5KP7B 2LKIA 3GZMA 2K0XA 1T8KA 2KGAA 2FAEA 2LIUA 2FQ2A 2K92A 4PWVB 1L0IA
chains in the Genus database with same CATH superfamily
3G71P 1IMQA 2L6EA 1AUMA 4IPYA 2K2QA 4PH1A 2K5XA 2VLPA 1L0HA 1F80D 2JU2A 2MF4A 2AVAA 2KGCA 3CCLP 1YI2P 4XRQA 1AYIA 2Z45A 3CCSP 2L4BA 4U0BA 2KR5A 5KP8B 2PENA 4UHPB 3U43A 4M0IA 1BXIA 2KG6A 4XROA 3H4EA 2QEXP 2MY5A 2M8LA 2QA4P 2PEJA 1EMVA 2BHVA 1EIAA 3CCRP 5HGNA 3Q20A 4PH0A 3CMAP 5F2KA 2BUOA 2KWLA 3H47A 2GZEA 2N6YA 2GDXA 1UJZA 2AF8A 2CGQA 1M74A 1NQ4A 2K0DX 2KOOA 2GZGA 3G1IA 3RG6C 3NTEA 2M8PA 3OW2O 1VQMP 1VQLP 3CCMP 4R0MA 1VQ8P 1E6JP 1RNIA 3DS3A 2L9FA 1VQ7P 2PEQA 1HQBA 2DGYA 2GZJA 4U0EA 2OTJP 1YITP 3G29A 2KGEA 2PEIA 2KGAA 1MZ8A 3EJBA 2LIUA 2K94A 3B5IA 1DNYA 3DS1A 4XFZA 3HYBA 2MVVA 2FVEA 1KC8Q 3CXCO 4H2YC 1M6EX 3DS4A 4U0FA 2XZ1C 2EIAA 1GXHA 2XXMA 2N50A 2X2BA 5F2OA 2EG5A 1Q82Q 1YJ9P 2MVUA 2Z46A 4GR2A 3DTJA 4COCA 5BS1A 4H2XC 1RO2A 7CEIA 5I4TG 5KP6B 1Z6MA 4GR6A 1RO0A 3CC7P 2EHSA 2VLQA 2E1MA 1NJIQ 2LF4A 1EOQA 2LOLA 2VLNA 1BAJA 2N6ZA 2L22A 2M5RA 2QNWA 2FQ0A 2KOQA 2GDYA 1D1DA 2VLOA 1E0HA 1KD1Q 1X3OA 3G6EP 1S72P 1KLPA 2GZFA 5DCKA 2K0YA 1JJ2O 1IMPA 1K73Q 1YJWP 2MD9A 3DS5A 3HZQA 2EHTA 4QKOA 3G26A 2FVFA 4BPGA 1Q81Q 5F2NA 2MR8A 1KQSO 1YIJP 3CCJP 2JAZA 2ERHA 3M1MA 1VQNP 4NEOA 3G0VA 3GKLC 1ZNVA 2PY8A 1A43A 2MR7A 2XT1A 1VQ5P 1L0IA 3E2DA 3CMEP 2JO0A 3NY7B 3LRYA 1IUQA 2M8NA 3DPHA 5HGOA 3EJEA 4U0DA 3CE7A 1M90Q 1HY8A 3VRLC 2KOPA 2N5IA 1FR2A 1A8OA 2LMLA 2EFJA 1K30A 2JYLA 1CEIA 3G28A 4WYMA 5CZDB 1VQ9P 2FACA 3CC2P 2KODA 2KW2A 1ACPA 3G1GA 2JGPA 2FHSC 1DV5A 1Q7YQ 4XFYA 1VQPP 3CD6P 2KOSA 2LPKA 2KG8A 3DS2A 2JQ4A 2LTEA 1OR5A 1M1KQ 3GJNA 2WPTA 2JU1A 2ROQA 2GZIA 3I55P 2CQ8A 3CCEP 4BPHA 2LL8A 2OARA 2AFEA 4U0CA 1W2BO 2K93A 5JPAA 2AFDA 1VKUA 2FADA 1VQOP 5BS2A 2PEKA 2JB0A 5HGLA 3CPWO 2LKIA 3GZMA 1YHQP 2K0XA 4U0AA 2FAEA 2JYGA 1K8AQ 2K92A 4PWVB 3I56P 2PNGA 5HGMA 2KORA 3MGEA 1YJNP 2XV6A 1K9MQ 4MRTC 1VQKP 2VSQA 1VQ4P 2FVAA 3P05A 2PEMA 4CA3A 2GDWA 2Z44A 4HKGA 1ZMBA 2ONTA 4H2WC 1GXGA 4BPFA 1VQ6P 3WBHA 2CNRA 3EJDA 3G21A 1QRJA 4XFXA 3RG2A 5HV8A 2N98A 4DG9A 1QVFO 3CCVP 1GPJA 2P9XA 3CC4P 3CCUP 1QVGO 2XZ0D 2GYKA 4IZ6A 1AF8A 2JBGA 3B4QA 1M6NA 5EW5E 4QNBA 2FQ1A 1N8RQ 2NO8A 2L0QA 2KGDA 3GZLA 3CCQP 2DNWA 2CG5B 2CWOA 2LIWA 2OTLP 4COPA 3DS0A 2KG9A 2N5HA 5HVCA 4F37A 3H0DA 5EJDA 1UNKA 4PXHB 1Q86Q 5KP7B 2PEOA 1T8KA 1VHNA 3G4SP 2FQ2A 3LMOA
chains in the Genus database with same CATH topology
2K94A 3NY7B 2PNGA 1DNYA 2KORA 2K2QA 2MVVA 1L0HA 1F80D 2FVEA 2JU2A 2MF4A 2AVAA 2KGCA 3EJEA 4H2YC 3CE7A 4MRTC 2VSQA 2XZ1C 2L4BA 2KR5A 2N50A 5KP8B 2X2BA 2FVAA 1HY8A 2KOPA 2MVUA 4CA3A 2N5IA 2MR7A 2KG6A 2GDWA 4H2XC 2LMLA 4HKGA 4H2WC 2MY5A 4BPFA 3EJBA 5CZDB 5KP6B 3LMOA 2CNRA 3EJDA 2FACA 2KW2A 1ACPA 3RG2A 2JGPA 5HV8A 2FHSC 2N98A 2EHSA 1DV5A 4DG9A 2LOLA 2KWLA 2XZ0D 2N6ZA 4IZ6A 2N6YA 2GDXA 2L22A 2M5RA 2AF8A 2QNWA 1AF8A 2CGQA 2FQ0A 1NQ4A 2KOSA 2LPKA 2KG8A 2KOOA 2JQ4A 2LTEA 2KOQA 2GDYA 2FQ1A 1OR5A 2L0QA 1X3OA 2JU1A 2KGDA 3GZLA 1KLPA 2ROQA 2DNWA 2CG5B 2CQ8A 2LIWA 2K0YA 4R0MA 4BPHA 2LL8A 2AFEA 2MD9A 2EHTA 2L9FA 2FVFA 4BPGA 1HQBA 2K93A 2AFDA 2KG9A 1VKUA 2MR8A 2N5HA 5HVCA 2FADA 5EJDA 4PXHB 2KGEA 4NEOA 5KP7B 2LKIA 3GZMA 2K0XA 1T8KA 2KGAA 2FAEA 2LIUA 2FQ2A 2K92A 4PWVB 1L0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K94 A;  3NY7 B;  2PNG A;  1DNY A;  2KOR A;  2K2Q A;  2MVV A;  1L0H A;  1F80 D;  2FVE A;  2JU2 A;  2MF4 A;  2AVA A;  2KGC A;  3EJE A;  4H2Y C;  3CE7 A;  4MRT C;  2VSQ A;  2XZ1 C;  2L4B A;  2KR5 A;  2N50 A;  5KP8 B;  2X2B A;  2FVA A;  1HY8 A;  2KOP A;  2MVU A;  4CA3 A;  2N5I A;  2MR7 A;  2KG6 A;  2GDW A;  4H2X C;  2LML A;  4HKG A;  4H2W C;  2MY5 A;  4BPF A;  3EJB A;  5CZD B;  5KP6 B;  3LMO A;  2CNR A;  3EJD A;  2FAC A;  2KW2 A;  1ACP A;  3RG2 A;  2JGP A;  5HV8 A;  2FHS C;  2N98 A;  2EHS A;  1DV5 A;  4DG9 A;  2LOL A;  2KWL A;  2XZ0 D;  2N6Z A;  4IZ6 A;  2N6Y A;  2GDX A;  2L22 A;  2M5R A;  2AF8 A;  2QNW A;  1AF8 A;  2CGQ A;  2FQ0 A;  1NQ4 A;  2KOS A;  2LPK A;  2KG8 A;  2KOO A;  2JQ4 A;  2LTE A;  2KOQ A;  2GDY A;  2FQ1 A;  1OR5 A;  2L0Q A;  1X3O A;  2JU1 A;  2KGD A;  3GZL A;  1KLP A;  2ROQ A;  2DNW A;  2CG5 B;  2CQ8 A;  2LIW A;  2K0Y A;  4R0M A;  4BPH A;  2LL8 A;  2AFE A;  2MD9 A;  2EHT A;  2L9F A;  2FVF A;  4BPG A;  1HQB A;  2K93 A;  2AFD A;  2KG9 A;  1VKU A;  2MR8 A;  2N5H A;  5HVC A;  2FAD A;  5EJD A;  4PXH B;  2KGE A;  4NEO A;  5KP7 B;  2LKI A;  3GZM A;  2K0X A;  1T8K A;  2KGA A;  2FAE A;  2LIU A;  2FQ2 A;  2K92 A;  4PWV B;  1L0I A; 
#chains in the Genus database with same CATH topology
 3G71 P;  1IMQ A;  2L6E A;  1AUM A;  4IPY A;  2K2Q A;  4PH1 A;  2K5X A;  2VLP A;  1L0H A;  1F80 D;  2JU2 A;  2MF4 A;  2AVA A;  2KGC A;  3CCL P;  1YI2 P;  4XRQ A;  1AYI A;  2Z45 A;  3CCS P;  2L4B A;  4U0B A;  2KR5 A;  5KP8 B;  2PEN A;  4UHP B;  3U43 A;  4M0I A;  1BXI A;  2KG6 A;  4XRO A;  3H4E A;  2QEX P;  2MY5 A;  2M8L A;  2QA4 P;  2PEJ A;  1EMV A;  2BHV A;  1EIA A;  3CCR P;  5HGN A;  3Q20 A;  4PH0 A;  3CMA P;  5F2K A;  2BUO A;  2KWL A;  3H47 A;  2GZE A;  2N6Y A;  2GDX A;  1UJZ A;  2AF8 A;  2CGQ A;  1M74 A;  1NQ4 A;  2K0D X;  2KOO A;  2GZG A;  3G1I A;  3RG6 C;  3NTE A;  2M8P A;  3OW2 O;  1VQM P;  1VQL P;  3CCM P;  4R0M A;  1VQ8 P;  1E6J P;  1RNI A;  3DS3 A;  2L9F A;  1VQ7 P;  2PEQ A;  1HQB A;  2DGY A;  2GZJ A;  4U0E A;  2OTJ P;  1YIT P;  3G29 A;  2KGE A;  2PEI A;  2KGA A;  1MZ8 A;  3EJB A;  2LIU A;  2K94 A;  3B5I A;  1DNY A;  3DS1 A;  4XFZ A;  3HYB A;  2MVV A;  2FVE A;  1KC8 Q;  3CXC O;  4H2Y C;  1M6E X;  3DS4 A;  4U0F A;  2XZ1 C;  2EIA A;  1GXH A;  2XXM A;  2N50 A;  2X2B A;  5F2O A;  2EG5 A;  1Q82 Q;  1YJ9 P;  2MVU A;  2Z46 A;  4GR2 A;  3DTJ A;  4COC A;  5BS1 A;  4H2X C;  1RO2 A;  7CEI A;  5I4T G;  5KP6 B;  1Z6M A;  4GR6 A;  1RO0 A;  3CC7 P;  2EHS A;  2VLQ A;  2E1M A;  1NJI Q;  2LF4 A;  1EOQ A;  2LOL A;  2VLN A;  1BAJ A;  2N6Z A;  2L22 A;  2M5R A;  2QNW A;  2FQ0 A;  2KOQ A;  2GDY A;  1D1D A;  2VLO A;  1E0H A;  1KD1 Q;  1X3O A;  3G6E P;  1S72 P;  1KLP A;  2GZF A;  5DCK A;  2K0Y A;  1JJ2 O;  1IMP A;  1K73 Q;  1YJW P;  2MD9 A;  3DS5 A;  3HZQ A;  2EHT A;  4QKO A;  3G26 A;  2FVF A;  4BPG A;  1Q81 Q;  5F2N A;  2MR8 A;  1KQS O;  1YIJ P;  3CCJ P;  2JAZ A;  2ERH A;  3M1M A;  1VQN P;  4NEO A;  3G0V A;  3GKL C;  1ZNV A;  2PY8 A;  1A43 A;  2MR7 A;  2XT1 A;  1VQ5 P;  1L0I A;  3E2D A;  3CME P;  2JO0 A;  3NY7 B;  3LRY A;  1IUQ A;  2M8N A;  3DPH A;  5HGO A;  3EJE A;  4U0D A;  3CE7 A;  1M90 Q;  1HY8 A;  3VRL C;  2KOP A;  2N5I A;  1FR2 A;  1A8O A;  2LML A;  2EFJ A;  1K30 A;  2JYL A;  1CEI A;  3G28 A;  4WYM A;  5CZD B;  1VQ9 P;  2FAC A;  3CC2 P;  2KOD A;  2KW2 A;  1ACP A;  3G1G A;  2JGP A;  2FHS C;  1DV5 A;  1Q7Y Q;  4XFY A;  1VQP P;  3CD6 P;  2KOS A;  2LPK A;  2KG8 A;  3DS2 A;  2JQ4 A;  2LTE A;  1OR5 A;  1M1K Q;  3GJN A;  2WPT A;  2JU1 A;  2ROQ A;  2GZI A;  3I55 P;  2CQ8 A;  3CCE P;  4BPH A;  2LL8 A;  2OAR A;  2AFE A;  4U0C A;  1W2B O;  2K93 A;  5JPA A;  2AFD A;  1VKU A;  2FAD A;  1VQO P;  5BS2 A;  2PEK A;  2JB0 A;  5HGL A;  3CPW O;  2LKI A;  3GZM A;  1YHQ P;  2K0X A;  4U0A A;  2FAE A;  2JYG A;  1K8A Q;  2K92 A;  4PWV B;  3I56 P;  2PNG A;  5HGM A;  2KOR A;  3MGE A;  1YJN P;  2XV6 A;  1K9M Q;  4MRT C;  1VQK P;  2VSQ A;  1VQ4 P;  2FVA A;  3P05 A;  2PEM A;  4CA3 A;  2GDW A;  2Z44 A;  4HKG A;  1ZMB A;  2ONT A;  4H2W C;  1GXG A;  4BPF A;  1VQ6 P;  3WBH A;  2CNR A;  3EJD A;  3G21 A;  1QRJ A;  4XFX A;  3RG2 A;  5HV8 A;  2N98 A;  4DG9 A;  1QVF O;  3CCV P;  1GPJ A;  2P9X A;  3CC4 P;  3CCU P;  1QVG O;  2XZ0 D;  2GYK A;  4IZ6 A;  1AF8 A;  2JBG A;  3B4Q A;  1M6N A;  5EW5 E;  4QNB A;  2FQ1 A;  1N8R Q;  2NO8 A;  2L0Q A;  2KGD A;  3GZL A;  3CCQ P;  2DNW A;  2CG5 B;  2CWO A;  2LIW A;  2OTL P;  4COP A;  3DS0 A;  2KG9 A;  2N5H A;  5HVC A;  4F37 A;  3H0D A;  5EJD A;  1UNK A;  4PXH B;  1Q86 Q;  5KP7 B;  2PEO A;  1T8K A;  1VHN A;  3G4S P;  2FQ2 A;  3LMO A; 
#chains in the Genus database with same CATH homology
 2K94 A;  3NY7 B;  2PNG A;  1DNY A;  2KOR A;  2K2Q A;  2MVV A;  1L0H A;  1F80 D;  2FVE A;  2JU2 A;  2MF4 A;  2AVA A;  2KGC A;  3EJE A;  4H2Y C;  3CE7 A;  4MRT C;  2VSQ A;  2XZ1 C;  2L4B A;  2KR5 A;  2N50 A;  5KP8 B;  2X2B A;  2FVA A;  1HY8 A;  2KOP A;  2MVU A;  4CA3 A;  2N5I A;  2MR7 A;  2KG6 A;  2GDW A;  4H2X C;  2LML A;  4HKG A;  4H2W C;  2MY5 A;  4BPF A;  3EJB A;  5CZD B;  5KP6 B;  3LMO A;  2CNR A;  3EJD A;  2FAC A;  2KW2 A;  1ACP A;  3RG2 A;  2JGP A;  5HV8 A;  2FHS C;  2N98 A;  2EHS A;  1DV5 A;  4DG9 A;  2LOL A;  2KWL A;  2XZ0 D;  2N6Z A;  4IZ6 A;  2N6Y A;  2GDX A;  2L22 A;  2M5R A;  2AF8 A;  2QNW A;  1AF8 A;  2CGQ A;  2FQ0 A;  1NQ4 A;  2KOS A;  2LPK A;  2KG8 A;  2KOO A;  2JQ4 A;  2LTE A;  2KOQ A;  2GDY A;  2FQ1 A;  1OR5 A;  2L0Q A;  1X3O A;  2JU1 A;  2KGD A;  3GZL A;  1KLP A;  2ROQ A;  2DNW A;  2CG5 B;  2CQ8 A;  2LIW A;  2K0Y A;  4R0M A;  4BPH A;  2LL8 A;  2AFE A;  2MD9 A;  2EHT A;  2L9F A;  2FVF A;  4BPG A;  1HQB A;  2K93 A;  2AFD A;  2KG9 A;  1VKU A;  2MR8 A;  2N5H A;  5HVC A;  2FAD A;  5EJD A;  4PXH B;  2KGE A;  4NEO A;  5KP7 B;  2LKI A;  3GZM A;  2K0X A;  1T8K A;  2KGA A;  2FAE A;  2LIU A;  2FQ2 A;  2K92 A;  4PWV B;  1L0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...