1F80D

Holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
74
structure length
73
Chain Sequence
b'SADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOLO-(ACYL CARRIER PROTEIN) SYNTHASE
publication title Crystal structures of substrate binding to Bacillus subtilis holo-(acyl carrier protein) synthase reveal a novel trimeric arrangement of molecules resulting in three active sites.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 23
structure length 73
sequence length 74
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2000-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1f80D00
2N5IA 4HKGA 2FVAA 4DG9A 4IZ6A 1T8KA 2KGDA 4R0MA 2DNWA 2MVVA 2FAEA 2K93A 1VKUA 4BPGA 2KG8A 2KGEA 1NQ4A 2N5HA 5KP7B 2AVAA 4MRTC 2L9FA 2GDYA 2AFEA 2K2QA 2K94A 2MVUA 1DNYA 2KGCA 2KOQA 2GDXA 2EHTA 2AFDA 4H2YC 2KOOA 2LIWA 2FADA 1ACPA 2MY5A 1X3OA 3RG2A 1HQBA 2FQ1A 1L0IA 3EJDA 5CZDB 2MR8A 2GDWA 2LTEA 2MR7A 4H2WC 5KP6B 2ROQA 2CGQA 2CG5B 2KORA 2LPKA 2K0YA 2N6YA 3EJBA 4PXHB 2N6ZA 2JQ4A 2M5RA 3NY7B 1DV5A 2KGAA 2X2BA 2KWLA 2K0XA 3GZLA 4H2XC 1OR5A 2MF4A 2XZ1C 2FVEA 2FQ0A 1KLPA 2L4BA 2VSQA 2CNRA 2L22A 2CQ8A 2N98A 3LMOA 5HVCA 2FQ2A 2KOSA 1HY8A 2QNWA 4NEOA 2MD9A 3CE7A 2LIUA 5HV8A 2N50A 4BPHA 2LKIA 2LL8A 2K92A 4CA3A 5EJDA 2KG6A 3GZMA 1L0HA 2LMLA 3EJEA 2JGPA 2KR5A 1F80D 2EHSA 2PNGA 2AF8A 2FACA 2KG9A 2JU2A 2KOPA 2KW2A 2FHSC 5KP8B 2FVFA 4PWVB 4BPFA 1AF8A 2LOLA 2XZ0D 2L0QA 2JU1A
chains in the Genus database with same CATH superfamily
2GZGA 2N5IA 3CD6P 4GR2A 3DPHA 2PEQA 2FAEA 3DS1A 4BPGA 2KG8A 2N5HA 4MRTC 2L9FA 2AFEA 1RNIA 2K94A 1DNYA 2GDXA 2EHTA 1BXIA 4H2YC 1ACPA 1YJ9P 1VQ8P 3CCMP 4XFXA 1L0IA 3DTJA 5HGOA 3E2DA 1M74A 2M8LA 2LTEA 2JO0A 5F2OA 3G4SP 2PENA 2CGQA 2GYKA 5BS2A 1Q81Q 4U0CA 3B4QA 1OR5A 2FVEA 5EW5E 1VHNA 1KLPA 1A43A 2VLQA 3DS0A 5HGMA 2P9XA 2N98A 5HVCA 1GPJA 2FQ2A 1QVFO 1GXGA 1VQ6P 1Q82Q 2VLNA 3CE7A 1AUMA 2LIUA 3G26A 1Q86Q 1QVGO 2LL8A 2GZEA 5JPAA 3CC4P 2PEMA 1L0HA 5BS1A 2LMLA 5DCKA 2DGYA 1F80D 4M0IA 1YI2P 2AF8A 5HGLA 2FACA 1NJIQ 1KQSO 4COCA 4PH0A 1Q7YQ 2JU2A 2ERHA 2KW2A 1K73Q 4GR6A 2XXMA 2PEIA 2PEOA 4BPFA 1VQ4P 2LOLA 3CCRP 2ONTA 4QKOA 2QEXP 1AYIA 2FVAA 4IZ6A 2XV6A 2K93A 3I56P 3CCVP 2KGEA 3CMAP 1EOQA 2OARA 1QRJA 7CEIA 3RG6C 2MVUA 2KGCA 2JYGA 2KOOA 2LIWA 2EFJA 4WYMA 1IMPA 2MY5A 3RG2A 2KODA 2JAZA 4XFYA 1S72P 2MR8A 3H47A 3H0DA 2GDWA 4H2WC 5KP6B 2CG5B 2LPKA 2N6YA 3EJBA 1RO0A 4F37A 2M5RA 3NY7B 2KGAA 2PEKA 3DS4A 1BAJA 1ZNVA 2JBGA 3GZLA 4H2XC 2XZ1C 1VQPP 1Z6MA 3LMOA 2NO8A 4NEOA 5HGNA 5HV8A 2VLOA 1W2BO 2N50A 1IUQA 2LKIA 2EG5A 4CA3A 2JYLA 2KG6A 4UHPB 3CCQP 1KD1Q 3CCUP 2KR5A 2PNGA 1RO2A 4PH1A 2EIAA 1GXHA 1CEIA 2GZJA 1VQLP 1YHQP 3G6EP 1A8OA 2FVFA 4PWVB 1AF8A 3CMEP 2XZ0D 2L0QA 1D1DA 4U0AA 4DG9A 3CPWO 2VLPA 1T8KA 2KGDA 4R0MA 2DNWA 1K9MQ 2L6EA 1M6NA 1VQOP 5KP7B 3G1IA 2GDYA 2BHVA 3CXCO 3NTEA 2OTLP 2KOQA 2AFDA 1EMVA 3DS2A 1HQBA 2FQ1A 5CZDB 3DS5A 2XT1A 2OTJP 2PY8A 3M1MA 3MGEA 4U0EA 4U0DA 3G71P 2K0YA 1VQKP 1VQ7P 2CWOA 3G28A 4PXHB 3H4EA 3OW2O 3G21A 1DV5A 2X2BA 3HYBA 2MF4A 3U43A 2FQ0A 1VQMP 2L4BA 1VQ5P 1UJZA 3CC2P 2E1MA 2CNRA 2L22A 2CQ8A 1E0HA 1HY8A 1YIJP 3WBHA 1N8RQ 3CCLP 4BPHA 3G0VA 1YJNP 2M8NA 2K92A 1VQNP 3EJEA 3CCJP 2EHSA 4U0FA 5F2NA 2KOPA 2K5XA 1M1KQ 5KP8B 3DS3A 3G29A 2GZIA 5I4TG 4HKGA 2Z44A 1EIAA 1FR2A 2WPTA 2MVVA 1VKUA 2Z46A 3CCEP 1NQ4A 1YITP 5F2KA 2AVAA 1MZ8A 3Q20A 4XROA 2K2QA 3B5IA 3CCSP 2M8PA 2QA4P 2K0DX 1IMQA 2FADA 1X3OA 3EJDA 4U0BA 4XRQA 1ZMBA 2MR7A 3HZQA 2ROQA 2BUOA 3G1GA 1VQ9P 2KORA 4IPYA 2N6ZA 2JQ4A 2Z45A 1K8AQ 2KWLA 1M6EX 1M90Q 2K0XA 1YJWP 3P05A 3GJNA 2VSQA 4COPA 4XFZA 2KOSA 2JB0A 2QNWA 3LRYA 2MD9A 2LF4A 2PEJA 2GZFA 1KC8Q 5EJDA 3GZMA 1UNKA 4QNBA 3GKLC 2JGPA 3CC7P 3VRLC 3I55P 1JJ2O 2KG9A 1E6JP 2FHSC 1K30A 2JU1A
chains in the Genus database with same CATH topology
2N5IA 4HKGA 2FVAA 4DG9A 4IZ6A 1T8KA 2KGDA 4R0MA 2DNWA 2MVVA 2FAEA 2K93A 1VKUA 4BPGA 2KG8A 2KGEA 1NQ4A 2N5HA 5KP7B 2AVAA 4MRTC 2L9FA 2GDYA 2AFEA 2K2QA 2K94A 2MVUA 1DNYA 2KGCA 2KOQA 2GDXA 2EHTA 2AFDA 4H2YC 2KOOA 2LIWA 2FADA 1ACPA 2MY5A 1X3OA 3RG2A 1HQBA 2FQ1A 1L0IA 3EJDA 5CZDB 2MR8A 2GDWA 2LTEA 2MR7A 4H2WC 5KP6B 2ROQA 2CGQA 2CG5B 2KORA 2LPKA 2K0YA 2N6YA 3EJBA 4PXHB 2N6ZA 2JQ4A 2M5RA 3NY7B 1DV5A 2KGAA 2X2BA 2KWLA 2K0XA 3GZLA 4H2XC 1OR5A 2MF4A 2XZ1C 2FVEA 2FQ0A 1KLPA 2L4BA 2VSQA 2CNRA 2L22A 2CQ8A 2N98A 3LMOA 5HVCA 2FQ2A 2KOSA 1HY8A 2QNWA 4NEOA 2MD9A 3CE7A 2LIUA 5HV8A 2N50A 4BPHA 2LKIA 2LL8A 2K92A 4CA3A 5EJDA 2KG6A 3GZMA 1L0HA 2LMLA 3EJEA 2JGPA 2KR5A 1F80D 2EHSA 2PNGA 2AF8A 2FACA 2KG9A 2JU2A 2KOPA 2KW2A 2FHSC 5KP8B 2FVFA 4PWVB 4BPFA 1AF8A 2LOLA 2XZ0D 2L0QA 2JU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N5I A;  4HKG A;  2FVA A;  4DG9 A;  4IZ6 A;  1T8K A;  2KGD A;  4R0M A;  2DNW A;  2MVV A;  2FAE A;  2K93 A;  1VKU A;  4BPG A;  2KG8 A;  2KGE A;  1NQ4 A;  2N5H A;  5KP7 B;  2AVA A;  4MRT C;  2L9F A;  2GDY A;  2AFE A;  2K2Q A;  2K94 A;  2MVU A;  1DNY A;  2KGC A;  2KOQ A;  2GDX A;  2EHT A;  2AFD A;  4H2Y C;  2KOO A;  2LIW A;  2FAD A;  1ACP A;  2MY5 A;  1X3O A;  3RG2 A;  1HQB A;  2FQ1 A;  1L0I A;  3EJD A;  5CZD B;  2MR8 A;  2GDW A;  2LTE A;  2MR7 A;  4H2W C;  5KP6 B;  2ROQ A;  2CGQ A;  2CG5 B;  2KOR A;  2LPK A;  2K0Y A;  2N6Y A;  3EJB A;  4PXH B;  2N6Z A;  2JQ4 A;  2M5R A;  3NY7 B;  1DV5 A;  2KGA A;  2X2B A;  2KWL A;  2K0X A;  3GZL A;  4H2X C;  1OR5 A;  2MF4 A;  2XZ1 C;  2FVE A;  2FQ0 A;  1KLP A;  2L4B A;  2VSQ A;  2CNR A;  2L22 A;  2CQ8 A;  2N98 A;  3LMO A;  5HVC A;  2FQ2 A;  2KOS A;  1HY8 A;  2QNW A;  4NEO A;  2MD9 A;  3CE7 A;  2LIU A;  5HV8 A;  2N50 A;  4BPH A;  2LKI A;  2LL8 A;  2K92 A;  4CA3 A;  5EJD A;  2KG6 A;  3GZM A;  1L0H A;  2LML A;  3EJE A;  2JGP A;  2KR5 A;  1F80 D;  2EHS A;  2PNG A;  2AF8 A;  2FAC A;  2KG9 A;  2JU2 A;  2KOP A;  2KW2 A;  2FHS C;  5KP8 B;  2FVF A;  4PWV B;  4BPF A;  1AF8 A;  2LOL A;  2XZ0 D;  2L0Q A;  2JU1 A; 
#chains in the Genus database with same CATH topology
 2GZG A;  2N5I A;  3CD6 P;  4GR2 A;  3DPH A;  2PEQ A;  2FAE A;  3DS1 A;  4BPG A;  2KG8 A;  2N5H A;  4MRT C;  2L9F A;  2AFE A;  1RNI A;  2K94 A;  1DNY A;  2GDX A;  2EHT A;  1BXI A;  4H2Y C;  1ACP A;  1YJ9 P;  1VQ8 P;  3CCM P;  4XFX A;  1L0I A;  3DTJ A;  5HGO A;  3E2D A;  1M74 A;  2M8L A;  2LTE A;  2JO0 A;  5F2O A;  3G4S P;  2PEN A;  2CGQ A;  2GYK A;  5BS2 A;  1Q81 Q;  4U0C A;  3B4Q A;  1OR5 A;  2FVE A;  5EW5 E;  1VHN A;  1KLP A;  1A43 A;  2VLQ A;  3DS0 A;  5HGM A;  2P9X A;  2N98 A;  5HVC A;  1GPJ A;  2FQ2 A;  1QVF O;  1GXG A;  1VQ6 P;  1Q82 Q;  2VLN A;  3CE7 A;  1AUM A;  2LIU A;  3G26 A;  1Q86 Q;  1QVG O;  2LL8 A;  2GZE A;  5JPA A;  3CC4 P;  2PEM A;  1L0H A;  5BS1 A;  2LML A;  5DCK A;  2DGY A;  1F80 D;  4M0I A;  1YI2 P;  2AF8 A;  5HGL A;  2FAC A;  1NJI Q;  1KQS O;  4COC A;  4PH0 A;  1Q7Y Q;  2JU2 A;  2ERH A;  2KW2 A;  1K73 Q;  4GR6 A;  2XXM A;  2PEI A;  2PEO A;  4BPF A;  1VQ4 P;  2LOL A;  3CCR P;  2ONT A;  4QKO A;  2QEX P;  1AYI A;  2FVA A;  4IZ6 A;  2XV6 A;  2K93 A;  3I56 P;  3CCV P;  2KGE A;  3CMA P;  1EOQ A;  2OAR A;  1QRJ A;  7CEI A;  3RG6 C;  2MVU A;  2KGC A;  2JYG A;  2KOO A;  2LIW A;  2EFJ A;  4WYM A;  1IMP A;  2MY5 A;  3RG2 A;  2KOD A;  2JAZ A;  4XFY A;  1S72 P;  2MR8 A;  3H47 A;  3H0D A;  2GDW A;  4H2W C;  5KP6 B;  2CG5 B;  2LPK A;  2N6Y A;  3EJB A;  1RO0 A;  4F37 A;  2M5R A;  3NY7 B;  2KGA A;  2PEK A;  3DS4 A;  1BAJ A;  1ZNV A;  2JBG A;  3GZL A;  4H2X C;  2XZ1 C;  1VQP P;  1Z6M A;  3LMO A;  2NO8 A;  4NEO A;  5HGN A;  5HV8 A;  2VLO A;  1W2B O;  2N50 A;  1IUQ A;  2LKI A;  2EG5 A;  4CA3 A;  2JYL A;  2KG6 A;  4UHP B;  3CCQ P;  1KD1 Q;  3CCU P;  2KR5 A;  2PNG A;  1RO2 A;  4PH1 A;  2EIA A;  1GXH A;  1CEI A;  2GZJ A;  1VQL P;  1YHQ P;  3G6E P;  1A8O A;  2FVF A;  4PWV B;  1AF8 A;  3CME P;  2XZ0 D;  2L0Q A;  1D1D A;  4U0A A;  4DG9 A;  3CPW O;  2VLP A;  1T8K A;  2KGD A;  4R0M A;  2DNW A;  1K9M Q;  2L6E A;  1M6N A;  1VQO P;  5KP7 B;  3G1I A;  2GDY A;  2BHV A;  3CXC O;  3NTE A;  2OTL P;  2KOQ A;  2AFD A;  1EMV A;  3DS2 A;  1HQB A;  2FQ1 A;  5CZD B;  3DS5 A;  2XT1 A;  2OTJ P;  2PY8 A;  3M1M A;  3MGE A;  4U0E A;  4U0D A;  3G71 P;  2K0Y A;  1VQK P;  1VQ7 P;  2CWO A;  3G28 A;  4PXH B;  3H4E A;  3OW2 O;  3G21 A;  1DV5 A;  2X2B A;  3HYB A;  2MF4 A;  3U43 A;  2FQ0 A;  1VQM P;  2L4B A;  1VQ5 P;  1UJZ A;  3CC2 P;  2E1M A;  2CNR A;  2L22 A;  2CQ8 A;  1E0H A;  1HY8 A;  1YIJ P;  3WBH A;  1N8R Q;  3CCL P;  4BPH A;  3G0V A;  1YJN P;  2M8N A;  2K92 A;  1VQN P;  3EJE A;  3CCJ P;  2EHS A;  4U0F A;  5F2N A;  2KOP A;  2K5X A;  1M1K Q;  5KP8 B;  3DS3 A;  3G29 A;  2GZI A;  5I4T G;  4HKG A;  2Z44 A;  1EIA A;  1FR2 A;  2WPT A;  2MVV A;  1VKU A;  2Z46 A;  3CCE P;  1NQ4 A;  1YIT P;  5F2K A;  2AVA A;  1MZ8 A;  3Q20 A;  4XRO A;  2K2Q A;  3B5I A;  3CCS P;  2M8P A;  2QA4 P;  2K0D X;  1IMQ A;  2FAD A;  1X3O A;  3EJD A;  4U0B A;  4XRQ A;  1ZMB A;  2MR7 A;  3HZQ A;  2ROQ A;  2BUO A;  3G1G A;  1VQ9 P;  2KOR A;  4IPY A;  2N6Z A;  2JQ4 A;  2Z45 A;  1K8A Q;  2KWL A;  1M6E X;  1M90 Q;  2K0X A;  1YJW P;  3P05 A;  3GJN A;  2VSQ A;  4COP A;  4XFZ A;  2KOS A;  2JB0 A;  2QNW A;  3LRY A;  2MD9 A;  2LF4 A;  2PEJ A;  2GZF A;  1KC8 Q;  5EJD A;  3GZM A;  1UNK A;  4QNB A;  3GKL C;  2JGP A;  3CC7 P;  3VRL C;  3I55 P;  1JJ2 O;  2KG9 A;  1E6J P;  2FHS C;  1K30 A;  2JU1 A; 
#chains in the Genus database with same CATH homology
 2N5I A;  4HKG A;  2FVA A;  4DG9 A;  4IZ6 A;  1T8K A;  2KGD A;  4R0M A;  2DNW A;  2MVV A;  2FAE A;  2K93 A;  1VKU A;  4BPG A;  2KG8 A;  2KGE A;  1NQ4 A;  2N5H A;  5KP7 B;  2AVA A;  4MRT C;  2L9F A;  2GDY A;  2AFE A;  2K2Q A;  2K94 A;  2MVU A;  1DNY A;  2KGC A;  2KOQ A;  2GDX A;  2EHT A;  2AFD A;  4H2Y C;  2KOO A;  2LIW A;  2FAD A;  1ACP A;  2MY5 A;  1X3O A;  3RG2 A;  1HQB A;  2FQ1 A;  1L0I A;  3EJD A;  5CZD B;  2MR8 A;  2GDW A;  2LTE A;  2MR7 A;  4H2W C;  5KP6 B;  2ROQ A;  2CGQ A;  2CG5 B;  2KOR A;  2LPK A;  2K0Y A;  2N6Y A;  3EJB A;  4PXH B;  2N6Z A;  2JQ4 A;  2M5R A;  3NY7 B;  1DV5 A;  2KGA A;  2X2B A;  2KWL A;  2K0X A;  3GZL A;  4H2X C;  1OR5 A;  2MF4 A;  2XZ1 C;  2FVE A;  2FQ0 A;  1KLP A;  2L4B A;  2VSQ A;  2CNR A;  2L22 A;  2CQ8 A;  2N98 A;  3LMO A;  5HVC A;  2FQ2 A;  2KOS A;  1HY8 A;  2QNW A;  4NEO A;  2MD9 A;  3CE7 A;  2LIU A;  5HV8 A;  2N50 A;  4BPH A;  2LKI A;  2LL8 A;  2K92 A;  4CA3 A;  5EJD A;  2KG6 A;  3GZM A;  1L0H A;  2LML A;  3EJE A;  2JGP A;  2KR5 A;  1F80 D;  2EHS A;  2PNG A;  2AF8 A;  2FAC A;  2KG9 A;  2JU2 A;  2KOP A;  2KW2 A;  2FHS C;  5KP8 B;  2FVF A;  4PWV B;  4BPF A;  1AF8 A;  2LOL A;  2XZ0 D;  2L0Q A;  2JU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...