1F80D

Holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
74
structure length
73
Chain Sequence
SADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOLO-(ACYL CARRIER PROTEIN) SYNTHASE
publication title Crystal structures of substrate binding to Bacillus subtilis holo-(acyl carrier protein) synthase reveal a novel trimeric arrangement of molecules resulting in three active sites.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 23
structure length 73
sequence length 74
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2000-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1f80D00
5KP7B 3NY7B 2AVAA 2CNRA 2N50A 2N98A 2KG9A 2EHSA 2KG8A 2KGDA 3LMOA 4BPHA 1L0HA 2MY5A 2AF8A 2LMLA 1NQ4A 2JU1A 3GZLA 2FADA 2LOLA 4IZ6A 4NEOA 2FQ2A 3EJDA 2KOOA 2XZ1C 2N5HA 5CZDB 1HQBA 2K92A 3GZMA 2JGPA 2L0QA 2MR7A 3EJEA 2KWLA 4H2WC 4HKGA 2K93A 2KGAA 3RG2A 1VKUA 4H2YC 2PNGA 1KLPA 2KGCA 2VSQA 2K0YA 4R0MA 2K0XA 2CQ8A 2MF4A 2GDYA 2FQ0A 1DNYA 2EHTA 4MRTC 2KOQA 2X2BA 2GDXA 2N6YA 2KW2A 2LIWA 2FHSC 2AFEA 2KOSA 1X3OA 1AF8A 2KR5A 2K94A 2JU2A 2L22A 2GDWA 4PWVB 2K2QA 4CA3A 2LKIA 2KOPA 2LIUA 1L0IA 4DG9A 4BPFA 2FAEA 2FQ1A 5HVCA 2FVAA 2MD9A 2MR8A 1T8KA 2CGQA 3EJBA 5EJDA 2FVFA 2KGEA 2N5IA 2FACA 5KP8B 4H2XC 2QNWA 2N6ZA 2MVUA 2AFDA 2FVEA 2LPKA 5HV8A 2M5RA 1F80D 2XZ0D 2CG5B 5KP6B 2ROQA 1DV5A 1ACPA 3CE7A 2LL8A 2DNWA 2JQ4A 4BPGA 2KORA 1OR5A 2MVVA 4PXHB 2L4BA 2L9FA 2LTEA 1HY8A 2KG6A
chains in the Genus database with same CATH superfamily
1VQKP 1GPJA 1A8OA 2PEKA 1K8AQ 5BS2A 3CCJP 4PH0A 1L0HA 3WBHA 3LRYA 2FADA 2WPTA 1GXHA 3G1IA 2FQ2A 5F2OA 3VRLC 3GZMA 3G29A 3GKLC 4H2WC 3DS2A 2PEOA 4H2YC 3CC7P 3RG6C 1AYIA 1KD1Q 3G6EP 1M74A 3P05A 4MRTC 2GZIA 2K0DX 2FHSC 1CEIA 2KOSA 2EG5A 4XROA 2GDWA 4CA3A 2CWOA 2LKIA 4GR6A 2LIUA 1L0IA 1K9MQ 2L6EA 2FAEA 2FQ1A 1UJZA 2MR8A 1T8KA 3EJBA 3E2DA 2N5IA 1VQ4P 1K73Q 2QNWA 2N6ZA 2M8NA 1D1DA 5HV8A 1F80D 2Z45A 2DNWA 2M8PA 2VLQA 3GJNA 1OR5A 3I56P 3OW2O 2GYKA 3DS0A 5HGOA 1M6NA 3B5IA 2KG6A 5KP7B 1EOQA 2N50A 2KG9A 2EHSA 2KG8A 3LMOA 4BPHA 2JBGA 1YJ9P 3GZLA 2LOLA 4IZ6A 2JYLA 1GXGA 1RO2A 2KOOA 5CZDB 1VQPP 5I4TG 2JGPA 3EJEA 1YIJP 2GZGA 2M8LA 4COPA 1NJIQ 2PNGA 2OARA 1YI2P 5F2KA 2K0YA 4R0MA 1ZNVA 2K0XA 2MF4A 2GDYA 2FQ0A 2EHTA 2KOQA 1VQNP 2JB0A 3MGEA 5EW5E 1X3OA 2KR5A 2BUOA 2K94A 4PH1A 3CCUP 4WYMA 5HGLA 2JO0A 4GR2A 4DG9A 1M1KQ 2DGYA 1BAJA 5HVCA 2FVAA 1W2BO 2CGQA 5EJDA 3DS5A 3CCMP 1QRJA 2AFDA 2GZEA 3G4SP 2QEXP 2XZ0D 3CE7A 4U0DA 4U0EA 2JQ4A 2KORA 4PXHB 3CCVP 2L4BA 3DS1A 4F37A 1HY8A 5F2NA 3DS3A 1Q86Q 2KGDA 1KQSO 3H4EA 1VQLP 2MY5A 2AF8A 3CMEP 2JAZA 2JU1A 1E6JP 2E1MA 1VQ6P 2XXMA 3EJDA 1YITP 2LF4A 2XZ1C 2N5HA 4XFYA 3U43A 4U0AA 1RO0A 2PEJA 4HKGA 1VKUA 1KLPA 2KGCA 1A43A 5JPAA 2PY8A 2XV6A 3CC2P 2CQ8A 2PEQA 3I55P 2X2BA 2XT1A 1YHQP 2GDXA 2Z44A 1RNIA 2LIWA 2QA4P 2OTJP 3G0VA 4COCA 1EIAA 1AUMA 3G28A 2JU2A 2L22A 1VQ9P 2K2QA 2KOPA 1N8RQ 3CCSP 3G26A 3CCRP 3DTJA 3H47A 1IMQA 2KGEA 2FACA 3CCQP 3CXCO 2GZJA 1FR2A 3M1MA 5BS1A 4U0CA 4UHPB 3G21A 2M5RA 5KP6B 2ROQA 1VQOP 2K5XA 3CC4P 1ZMBA 2ERHA 4BPGA 2MVVA 4QNBA 1M90Q 1VQ8P 1BXIA 4XRQA 3NY7B 2AVAA 2CNRA 1QVGO 2N98A 1QVFO 2P9XA 1K30A 4M0IA 2LMLA 7CEIA 1NQ4A 2NO8A 1Q7YQ 1S72P 3CPWO 4NEOA 2JYGA 4U0FA 4XFXA 1JJ2O 1HQBA 2OTLP 2K92A 2L0QA 2MR7A 2KWLA 2K93A 2KGAA 3RG2A 5HGNA 1YJNP 2EFJA 3CD6P 3DS4A 2VSQA 5DCKA 1DNYA 2VLOA 5HGMA 1VQ7P 2N6YA 2KW2A 1VHNA 2AFEA 1AF8A 1Z6MA 3G1GA 1MZ8A 2Z46A 1VQ5P 2PEMA 4U0BA 3Q20A 4PWVB 2VLNA 3CCLP 3NTEA 2BHVA 4BPFA 2KODA 2MD9A 3HZQA 3HYBA 3CMAP 2FVFA 5KP8B 4H2XC 2EIAA 4XFZA 1IMPA 2VLPA 4QKOA 1VQMP 2MVUA 1E0HA 2PEIA 1M6EX 2FVEA 3G71P 1IUQA 2LPKA 3DPHA 1Q81Q 1UNKA 2CG5B 1DV5A 2PENA 1ACPA 1Q82Q 2GZFA 3CCEP 3H0DA 2LL8A 4IPYA 1EMVA 1KC8Q 1YJWP 2L9FA 2LTEA 2ONTA 3B4QA
chains in the Genus database with same CATH topology
5KP7B 3NY7B 2AVAA 2CNRA 2N50A 2N98A 2KG9A 2EHSA 2KG8A 2KGDA 3LMOA 4BPHA 1L0HA 2MY5A 2AF8A 2LMLA 1NQ4A 2JU1A 3GZLA 2FADA 2LOLA 4IZ6A 4NEOA 2FQ2A 3EJDA 2KOOA 2XZ1C 2N5HA 5CZDB 1HQBA 2K92A 3GZMA 2JGPA 2L0QA 2MR7A 3EJEA 2KWLA 4H2WC 4HKGA 2K93A 2KGAA 3RG2A 1VKUA 4H2YC 2PNGA 1KLPA 2KGCA 2VSQA 2K0YA 4R0MA 2K0XA 2CQ8A 2MF4A 2GDYA 2FQ0A 1DNYA 2EHTA 4MRTC 2KOQA 2X2BA 2GDXA 2N6YA 2KW2A 2LIWA 2FHSC 2AFEA 2KOSA 1X3OA 1AF8A 2KR5A 2K94A 2JU2A 2L22A 2GDWA 4PWVB 2K2QA 4CA3A 2LKIA 2KOPA 2LIUA 1L0IA 4DG9A 4BPFA 2FAEA 2FQ1A 5HVCA 2FVAA 2MD9A 2MR8A 1T8KA 2CGQA 3EJBA 5EJDA 2FVFA 2KGEA 2N5IA 2FACA 5KP8B 4H2XC 2QNWA 2N6ZA 2MVUA 2AFDA 2FVEA 2LPKA 5HV8A 2M5RA 1F80D 2XZ0D 2CG5B 5KP6B 2ROQA 1DV5A 1ACPA 3CE7A 2LL8A 2DNWA 2JQ4A 4BPGA 2KORA 1OR5A 2MVVA 4PXHB 2L4BA 2L9FA 2LTEA 1HY8A 2KG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KP7 B;  3NY7 B;  2AVA A;  2CNR A;  2N50 A;  2N98 A;  2KG9 A;  2EHS A;  2KG8 A;  2KGD A;  3LMO A;  4BPH A;  1L0H A;  2MY5 A;  2AF8 A;  2LML A;  1NQ4 A;  2JU1 A;  3GZL A;  2FAD A;  2LOL A;  4IZ6 A;  4NEO A;  2FQ2 A;  3EJD A;  2KOO A;  2XZ1 C;  2N5H A;  5CZD B;  1HQB A;  2K92 A;  3GZM A;  2JGP A;  2L0Q A;  2MR7 A;  3EJE A;  2KWL A;  4H2W C;  4HKG A;  2K93 A;  2KGA A;  3RG2 A;  1VKU A;  4H2Y C;  2PNG A;  1KLP A;  2KGC A;  2VSQ A;  2K0Y A;  4R0M A;  2K0X A;  2CQ8 A;  2MF4 A;  2GDY A;  2FQ0 A;  1DNY A;  2EHT A;  4MRT C;  2KOQ A;  2X2B A;  2GDX A;  2N6Y A;  2KW2 A;  2LIW A;  2FHS C;  2AFE A;  2KOS A;  1X3O A;  1AF8 A;  2KR5 A;  2K94 A;  2JU2 A;  2L22 A;  2GDW A;  4PWV B;  2K2Q A;  4CA3 A;  2LKI A;  2KOP A;  2LIU A;  1L0I A;  4DG9 A;  4BPF A;  2FAE A;  2FQ1 A;  5HVC A;  2FVA A;  2MD9 A;  2MR8 A;  1T8K A;  2CGQ A;  3EJB A;  5EJD A;  2FVF A;  2KGE A;  2N5I A;  2FAC A;  5KP8 B;  4H2X C;  2QNW A;  2N6Z A;  2MVU A;  2AFD A;  2FVE A;  2LPK A;  5HV8 A;  2M5R A;  1F80 D;  2XZ0 D;  2CG5 B;  5KP6 B;  2ROQ A;  1DV5 A;  1ACP A;  3CE7 A;  2LL8 A;  2DNW A;  2JQ4 A;  4BPG A;  2KOR A;  1OR5 A;  2MVV A;  4PXH B;  2L4B A;  2L9F A;  2LTE A;  1HY8 A;  2KG6 A; 
#chains in the Genus database with same CATH topology
 1VQK P;  1GPJ A;  1A8O A;  2PEK A;  1K8A Q;  5BS2 A;  3CCJ P;  4PH0 A;  1L0H A;  3WBH A;  3LRY A;  2FAD A;  2WPT A;  1GXH A;  3G1I A;  2FQ2 A;  5F2O A;  3VRL C;  3GZM A;  3G29 A;  3GKL C;  4H2W C;  3DS2 A;  2PEO A;  4H2Y C;  3CC7 P;  3RG6 C;  1AYI A;  1KD1 Q;  3G6E P;  1M74 A;  3P05 A;  4MRT C;  2GZI A;  2K0D X;  2FHS C;  1CEI A;  2KOS A;  2EG5 A;  4XRO A;  2GDW A;  4CA3 A;  2CWO A;  2LKI A;  4GR6 A;  2LIU A;  1L0I A;  1K9M Q;  2L6E A;  2FAE A;  2FQ1 A;  1UJZ A;  2MR8 A;  1T8K A;  3EJB A;  3E2D A;  2N5I A;  1VQ4 P;  1K73 Q;  2QNW A;  2N6Z A;  2M8N A;  1D1D A;  5HV8 A;  1F80 D;  2Z45 A;  2DNW A;  2M8P A;  2VLQ A;  3GJN A;  1OR5 A;  3I56 P;  3OW2 O;  2GYK A;  3DS0 A;  5HGO A;  1M6N A;  3B5I A;  2KG6 A;  5KP7 B;  1EOQ A;  2N50 A;  2KG9 A;  2EHS A;  2KG8 A;  3LMO A;  4BPH A;  2JBG A;  1YJ9 P;  3GZL A;  2LOL A;  4IZ6 A;  2JYL A;  1GXG A;  1RO2 A;  2KOO A;  5CZD B;  1VQP P;  5I4T G;  2JGP A;  3EJE A;  1YIJ P;  2GZG A;  2M8L A;  4COP A;  1NJI Q;  2PNG A;  2OAR A;  1YI2 P;  5F2K A;  2K0Y A;  4R0M A;  1ZNV A;  2K0X A;  2MF4 A;  2GDY A;  2FQ0 A;  2EHT A;  2KOQ A;  1VQN P;  2JB0 A;  3MGE A;  5EW5 E;  1X3O A;  2KR5 A;  2BUO A;  2K94 A;  4PH1 A;  3CCU P;  4WYM A;  5HGL A;  2JO0 A;  4GR2 A;  4DG9 A;  1M1K Q;  2DGY A;  1BAJ A;  5HVC A;  2FVA A;  1W2B O;  2CGQ A;  5EJD A;  3DS5 A;  3CCM P;  1QRJ A;  2AFD A;  2GZE A;  3G4S P;  2QEX P;  2XZ0 D;  3CE7 A;  4U0D A;  4U0E A;  2JQ4 A;  2KOR A;  4PXH B;  3CCV P;  2L4B A;  3DS1 A;  4F37 A;  1HY8 A;  5F2N A;  3DS3 A;  1Q86 Q;  2KGD A;  1KQS O;  3H4E A;  1VQL P;  2MY5 A;  2AF8 A;  3CME P;  2JAZ A;  2JU1 A;  1E6J P;  2E1M A;  1VQ6 P;  2XXM A;  3EJD A;  1YIT P;  2LF4 A;  2XZ1 C;  2N5H A;  4XFY A;  3U43 A;  4U0A A;  1RO0 A;  2PEJ A;  4HKG A;  1VKU A;  1KLP A;  2KGC A;  1A43 A;  5JPA A;  2PY8 A;  2XV6 A;  3CC2 P;  2CQ8 A;  2PEQ A;  3I55 P;  2X2B A;  2XT1 A;  1YHQ P;  2GDX A;  2Z44 A;  1RNI A;  2LIW A;  2QA4 P;  2OTJ P;  3G0V A;  4COC A;  1EIA A;  1AUM A;  3G28 A;  2JU2 A;  2L22 A;  1VQ9 P;  2K2Q A;  2KOP A;  1N8R Q;  3CCS P;  3G26 A;  3CCR P;  3DTJ A;  3H47 A;  1IMQ A;  2KGE A;  2FAC A;  3CCQ P;  3CXC O;  2GZJ A;  1FR2 A;  3M1M A;  5BS1 A;  4U0C A;  4UHP B;  3G21 A;  2M5R A;  5KP6 B;  2ROQ A;  1VQO P;  2K5X A;  3CC4 P;  1ZMB A;  2ERH A;  4BPG A;  2MVV A;  4QNB A;  1M90 Q;  1VQ8 P;  1BXI A;  4XRQ A;  3NY7 B;  2AVA A;  2CNR A;  1QVG O;  2N98 A;  1QVF O;  2P9X A;  1K30 A;  4M0I A;  2LML A;  7CEI A;  1NQ4 A;  2NO8 A;  1Q7Y Q;  1S72 P;  3CPW O;  4NEO A;  2JYG A;  4U0F A;  4XFX A;  1JJ2 O;  1HQB A;  2OTL P;  2K92 A;  2L0Q A;  2MR7 A;  2KWL A;  2K93 A;  2KGA A;  3RG2 A;  5HGN A;  1YJN P;  2EFJ A;  3CD6 P;  3DS4 A;  2VSQ A;  5DCK A;  1DNY A;  2VLO A;  5HGM A;  1VQ7 P;  2N6Y A;  2KW2 A;  1VHN A;  2AFE A;  1AF8 A;  1Z6M A;  3G1G A;  1MZ8 A;  2Z46 A;  1VQ5 P;  2PEM A;  4U0B A;  3Q20 A;  4PWV B;  2VLN A;  3CCL P;  3NTE A;  2BHV A;  4BPF A;  2KOD A;  2MD9 A;  3HZQ A;  3HYB A;  3CMA P;  2FVF A;  5KP8 B;  4H2X C;  2EIA A;  4XFZ A;  1IMP A;  2VLP A;  4QKO A;  1VQM P;  2MVU A;  1E0H A;  2PEI A;  1M6E X;  2FVE A;  3G71 P;  1IUQ A;  2LPK A;  3DPH A;  1Q81 Q;  1UNK A;  2CG5 B;  1DV5 A;  2PEN A;  1ACP A;  1Q82 Q;  2GZF A;  3CCE P;  3H0D A;  2LL8 A;  4IPY A;  1EMV A;  1KC8 Q;  1YJW P;  2L9F A;  2LTE A;  2ONT A;  3B4Q A; 
#chains in the Genus database with same CATH homology
 5KP7 B;  3NY7 B;  2AVA A;  2CNR A;  2N50 A;  2N98 A;  2KG9 A;  2EHS A;  2KG8 A;  2KGD A;  3LMO A;  4BPH A;  1L0H A;  2MY5 A;  2AF8 A;  2LML A;  1NQ4 A;  2JU1 A;  3GZL A;  2FAD A;  2LOL A;  4IZ6 A;  4NEO A;  2FQ2 A;  3EJD A;  2KOO A;  2XZ1 C;  2N5H A;  5CZD B;  1HQB A;  2K92 A;  3GZM A;  2JGP A;  2L0Q A;  2MR7 A;  3EJE A;  2KWL A;  4H2W C;  4HKG A;  2K93 A;  2KGA A;  3RG2 A;  1VKU A;  4H2Y C;  2PNG A;  1KLP A;  2KGC A;  2VSQ A;  2K0Y A;  4R0M A;  2K0X A;  2CQ8 A;  2MF4 A;  2GDY A;  2FQ0 A;  1DNY A;  2EHT A;  4MRT C;  2KOQ A;  2X2B A;  2GDX A;  2N6Y A;  2KW2 A;  2LIW A;  2FHS C;  2AFE A;  2KOS A;  1X3O A;  1AF8 A;  2KR5 A;  2K94 A;  2JU2 A;  2L22 A;  2GDW A;  4PWV B;  2K2Q A;  4CA3 A;  2LKI A;  2KOP A;  2LIU A;  1L0I A;  4DG9 A;  4BPF A;  2FAE A;  2FQ1 A;  5HVC A;  2FVA A;  2MD9 A;  2MR8 A;  1T8K A;  2CGQ A;  3EJB A;  5EJD A;  2FVF A;  2KGE A;  2N5I A;  2FAC A;  5KP8 B;  4H2X C;  2QNW A;  2N6Z A;  2MVU A;  2AFD A;  2FVE A;  2LPK A;  5HV8 A;  2M5R A;  1F80 D;  2XZ0 D;  2CG5 B;  5KP6 B;  2ROQ A;  1DV5 A;  1ACP A;  3CE7 A;  2LL8 A;  2DNW A;  2JQ4 A;  4BPG A;  2KOR A;  1OR5 A;  2MVV A;  4PXH B;  2L4B A;  2L9F A;  2LTE A;  1HY8 A;  2KG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...