1F80D

Holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
74
structure length
73
Chain Sequence
SADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HOLO-(ACYL CARRIER PROTEIN) SYNTHASE
publication title Crystal structures of substrate binding to Bacillus subtilis holo-(acyl carrier protein) synthase reveal a novel trimeric arrangement of molecules resulting in three active sites.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 23
structure length 73
sequence length 74
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2000-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1f80D00
2MF4A 2CG5B 2ROQA 2L9FA 2JGPA 1HY8A 2LKIA 2MVVA 2X2BA 4BPFA 5HVCA 2DNWA 1KLPA 3GZLA 2LL8A 2FVFA 2AF8A 2L4BA 2KG8A 2KOPA 3NY7B 2L22A 2LMLA 2N98A 2CGQA 2FVEA 2LOLA 5CZDB 5KP6B 2CQ8A 2KORA 2MY5A 2N6YA 1T8KA 4MRTC 3EJDA 2MVUA 2CNRA 1DNYA 1AF8A 2MD9A 2KOOA 4BPGA 5KP8B 1NQ4A 2LIWA 2N5HA 1F80D 2FADA 2FAEA 2FQ0A 2KOSA 2KOQA 2QNWA 5EJDA 2K0XA 1OR5A 3EJEA 2N5IA 2K0YA 1ACPA 2GDXA 3LMOA 2FHSC 2MR7A 2AVAA 4H2YC 1L0HA 2N6ZA 4HKGA 2N50A 2KWLA 2JU2A 1VKUA 4DG9A 2EHSA 2KGEA 2KGDA 1X3OA 2L0QA 2GDWA 3RG2A 2K94A 2JU1A 2KGCA 4NEOA 2LPKA 4H2XC 2XZ1C 2AFEA 2EHTA 4CA3A 2K2QA 4PWVB 2KW2A 2AFDA 2GDYA 4PXHB 5KP7B 4R0MA 5HV8A 3GZMA 2XZ0D 2FQ2A 1DV5A 2KR5A 2KGAA 2KG9A 2KG6A 2PNGA 3CE7A 2JQ4A 2FACA 4IZ6A 2K92A 3EJBA 4BPHA 2FVAA 2VSQA 2LTEA 2FQ1A 2M5RA 1HQBA 2MR8A 4H2WC 2LIUA 1L0IA 2K93A
chains in the Genus database with same CATH superfamily
3CCUP 3CC7P 3DS1A 4U0AA 1HY8A 1VQ9P 1IMPA 1E0HA 3LRYA 2MVVA 1KLPA 3CCRP 1VQNP 5F2KA 5HGMA 1EIAA 3B5IA 3NY7B 2PENA 5CZDB 5KP6B 2MY5A 4MRTC 2JYGA 1DNYA 3MGEA 2CWOA 2XT1A 2ERHA 3CCLP 5EW5E 5KP8B 1NQ4A 2N5HA 2FAEA 3OW2O 2KOQA 2NO8A 3CXCO 1OR5A 3CCVP 1ZNVA 3H0DA 3LMOA 2FHSC 2MR7A 2OTLP 4HKGA 5BS1A 1YJ9P 2N50A 2JU2A 4DG9A 3CD6P 2GZIA 2LPKA 2PEQA 2XZ1C 4XFZA 1EOQA 1KQSO 1Q7YQ 1AUMA 3CC2P 4M0IA 2M8PA 3DS3A 2QA4P 2FQ2A 1CEIA 3CE7A 2JQ4A 1MZ8A 4BPHA 3G26A 1VQPP 2LTEA 1RO2A 2VLNA 3CC4P 2M5RA 3DS5A 2MR8A 2LIUA 1BXIA 1ZMBA 1FR2A 2MF4A 3RG6C 1KD1Q 3G0VA 3GZLA 4XFXA 2AF8A 2JBGA 5I4TG 3E2DA 2KG8A 1K30A 4F37A 1VQ4P 1M90Q 2LOLA 5JPAA 5F2OA 3EJDA 5HGLA 1AF8A 4GR2A 2JB0A 3B4QA 3CCJP 1Q81Q 1F80D 2FADA 2FQ0A 2PY8A 1A43A 5EJDA 2K0XA 7CEIA 3Q20A 3GKLC 3DS2A 1K9MQ 1M74A 2QEXP 2PEJA 2M8LA 2OARA 3DTJA 1EMVA 3DPHA 4U0BA 4H2XC 3I56P 2AFEA 2Z45A 2GZGA 4XROA 1VQ6P 2EHTA 2PEIA 2K2QA 4PWVB 5HGNA 1M6NA 2GDYA 3M1MA 5KP7B 3G28A 1K8AQ 1JJ2O 4GR6A 1DV5A 4U0FA 2KG9A 1N8RQ 2P9XA 2FACA 4IZ6A 3EJBA 1VHNA 2FQ1A 3G1GA 2LF4A 1HQBA 2GYKA 2CG5B 2L9FA 2JGPA 3G1IA 1KC8Q 2LKIA 3VRLC 1D1DA 5HVCA 2DNWA 2LL8A 1QVGO 2L4BA 2KOPA 3H47A 1RO0A 2GZFA 2L22A 2CQ8A 2KORA 2N6YA 2XV6A 1T8KA 1VQOP 2Z44A 1M1KQ 4COPA 2MVUA 2CNRA 3I55P 2MD9A 2LIWA 1VQ8P 2KOSA 2Z46A 3CCEP 3G6EP 1UJZA 2N5IA 1ACPA 2GZEA 1VQKP 5BS2A 2AVAA 4H2YC 1L0HA 2N6ZA 1VQ5P 1K73Q 2KWLA 3U43A 2BUOA 4IPYA 2EHSA 4PH0A 2KGDA 1X3OA 3RG2A 1AYIA 4NEOA 3H4EA 2VLPA 2OTJP 1YHQP 4CA3A 3DS4A 1A8OA 4PXHB 4R0MA 5HV8A 1IUQA 4U0DA 1Q86Q 2ONTA 1NJIQ 2EFJA 2KR5A 1GPJA 2KGAA 1YITP 4U0EA 2PEMA 2PNGA 2E1MA 1RNIA 3CPWO 2FVAA 2BHVA 1GXHA 4H2WC 2K93A 2JYLA 3NTEA 2ROQA 4COCA 1Q82Q 4U0CA 2X2BA 4BPFA 1UNKA 1VQMP 1QVFO 1E6JP 2FVFA 1YI2P 5DCKA 2LMLA 3HZQA 2N98A 2CGQA 2FVEA 2JAZA 2VLOA 3G21A 4XRQA 3CCSP 3CCMP 1YIJP 2KOOA 3WBHA 2PEKA 3GJNA 4BPGA 3CMAP 2K0DX 1IMQA 4XFYA 2QNWA 1BAJA 4QKOA 3EJEA 2K0YA 2GDXA 3G4SP 2DGYA 1W2BO 2WPTA 2EIAA 1GXGA 2K5XA 1VKUA 1Z6MA 1YJWP 3HYBA 1S72P 2KGEA 2KODA 3CCQP 2L0QA 3DS0A 2GDWA 2K94A 1VQLP 2JU1A 4WYMA 2KGCA 3P05A 1VQ7P 5HGOA 4QNBA 5F2NA 2KW2A 3G29A 2AFDA 4PH1A 4UHPB 3GZMA 1QRJA 2XZ0D 2EG5A 2M8NA 3G71P 2L6EA 2KG6A 1YJNP 2VLQA 2PEOA 2JO0A 2K92A 2VSQA 1M6EX 2GZJA 3CMEP 2XXMA 1L0IA
chains in the Genus database with same CATH topology
2MF4A 2CG5B 2ROQA 2L9FA 2JGPA 1HY8A 2LKIA 2MVVA 2X2BA 4BPFA 5HVCA 2DNWA 1KLPA 3GZLA 2LL8A 2FVFA 2AF8A 2L4BA 2KG8A 2KOPA 3NY7B 2L22A 2LMLA 2N98A 2CGQA 2FVEA 2LOLA 5CZDB 5KP6B 2CQ8A 2KORA 2MY5A 2N6YA 1T8KA 4MRTC 3EJDA 2MVUA 2CNRA 1DNYA 1AF8A 2MD9A 2KOOA 4BPGA 5KP8B 1NQ4A 2LIWA 2N5HA 1F80D 2FADA 2FAEA 2FQ0A 2KOSA 2KOQA 2QNWA 5EJDA 2K0XA 1OR5A 3EJEA 2N5IA 2K0YA 1ACPA 2GDXA 3LMOA 2FHSC 2MR7A 2AVAA 4H2YC 1L0HA 2N6ZA 4HKGA 2N50A 2KWLA 2JU2A 1VKUA 4DG9A 2EHSA 2KGEA 2KGDA 1X3OA 2L0QA 2GDWA 3RG2A 2K94A 2JU1A 2KGCA 4NEOA 2LPKA 4H2XC 2XZ1C 2AFEA 2EHTA 4CA3A 2K2QA 4PWVB 2KW2A 2AFDA 2GDYA 4PXHB 5KP7B 4R0MA 5HV8A 3GZMA 2XZ0D 2FQ2A 1DV5A 2KR5A 2KGAA 2KG9A 2KG6A 2PNGA 3CE7A 2JQ4A 2FACA 4IZ6A 2K92A 3EJBA 4BPHA 2FVAA 2VSQA 2LTEA 2FQ1A 2M5RA 1HQBA 2MR8A 4H2WC 2LIUA 1L0IA 2K93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MF4 A;  2CG5 B;  2ROQ A;  2L9F A;  2JGP A;  1HY8 A;  2LKI A;  2MVV A;  2X2B A;  4BPF A;  5HVC A;  2DNW A;  1KLP A;  3GZL A;  2LL8 A;  2FVF A;  2AF8 A;  2L4B A;  2KG8 A;  2KOP A;  3NY7 B;  2L22 A;  2LML A;  2N98 A;  2CGQ A;  2FVE A;  2LOL A;  5CZD B;  5KP6 B;  2CQ8 A;  2KOR A;  2MY5 A;  2N6Y A;  1T8K A;  4MRT C;  3EJD A;  2MVU A;  2CNR A;  1DNY A;  1AF8 A;  2MD9 A;  2KOO A;  4BPG A;  5KP8 B;  1NQ4 A;  2LIW A;  2N5H A;  1F80 D;  2FAD A;  2FAE A;  2FQ0 A;  2KOS A;  2KOQ A;  2QNW A;  5EJD A;  2K0X A;  1OR5 A;  3EJE A;  2N5I A;  2K0Y A;  1ACP A;  2GDX A;  3LMO A;  2FHS C;  2MR7 A;  2AVA A;  4H2Y C;  1L0H A;  2N6Z A;  4HKG A;  2N50 A;  2KWL A;  2JU2 A;  1VKU A;  4DG9 A;  2EHS A;  2KGE A;  2KGD A;  1X3O A;  2L0Q A;  2GDW A;  3RG2 A;  2K94 A;  2JU1 A;  2KGC A;  4NEO A;  2LPK A;  4H2X C;  2XZ1 C;  2AFE A;  2EHT A;  4CA3 A;  2K2Q A;  4PWV B;  2KW2 A;  2AFD A;  2GDY A;  4PXH B;  5KP7 B;  4R0M A;  5HV8 A;  3GZM A;  2XZ0 D;  2FQ2 A;  1DV5 A;  2KR5 A;  2KGA A;  2KG9 A;  2KG6 A;  2PNG A;  3CE7 A;  2JQ4 A;  2FAC A;  4IZ6 A;  2K92 A;  3EJB A;  4BPH A;  2FVA A;  2VSQ A;  2LTE A;  2FQ1 A;  2M5R A;  1HQB A;  2MR8 A;  4H2W C;  2LIU A;  1L0I A;  2K93 A; 
#chains in the Genus database with same CATH topology
 3CCU P;  3CC7 P;  3DS1 A;  4U0A A;  1HY8 A;  1VQ9 P;  1IMP A;  1E0H A;  3LRY A;  2MVV A;  1KLP A;  3CCR P;  1VQN P;  5F2K A;  5HGM A;  1EIA A;  3B5I A;  3NY7 B;  2PEN A;  5CZD B;  5KP6 B;  2MY5 A;  4MRT C;  2JYG A;  1DNY A;  3MGE A;  2CWO A;  2XT1 A;  2ERH A;  3CCL P;  5EW5 E;  5KP8 B;  1NQ4 A;  2N5H A;  2FAE A;  3OW2 O;  2KOQ A;  2NO8 A;  3CXC O;  1OR5 A;  3CCV P;  1ZNV A;  3H0D A;  3LMO A;  2FHS C;  2MR7 A;  2OTL P;  4HKG A;  5BS1 A;  1YJ9 P;  2N50 A;  2JU2 A;  4DG9 A;  3CD6 P;  2GZI A;  2LPK A;  2PEQ A;  2XZ1 C;  4XFZ A;  1EOQ A;  1KQS O;  1Q7Y Q;  1AUM A;  3CC2 P;  4M0I A;  2M8P A;  3DS3 A;  2QA4 P;  2FQ2 A;  1CEI A;  3CE7 A;  2JQ4 A;  1MZ8 A;  4BPH A;  3G26 A;  1VQP P;  2LTE A;  1RO2 A;  2VLN A;  3CC4 P;  2M5R A;  3DS5 A;  2MR8 A;  2LIU A;  1BXI A;  1ZMB A;  1FR2 A;  2MF4 A;  3RG6 C;  1KD1 Q;  3G0V A;  3GZL A;  4XFX A;  2AF8 A;  2JBG A;  5I4T G;  3E2D A;  2KG8 A;  1K30 A;  4F37 A;  1VQ4 P;  1M90 Q;  2LOL A;  5JPA A;  5F2O A;  3EJD A;  5HGL A;  1AF8 A;  4GR2 A;  2JB0 A;  3B4Q A;  3CCJ P;  1Q81 Q;  1F80 D;  2FAD A;  2FQ0 A;  2PY8 A;  1A43 A;  5EJD A;  2K0X A;  7CEI A;  3Q20 A;  3GKL C;  3DS2 A;  1K9M Q;  1M74 A;  2QEX P;  2PEJ A;  2M8L A;  2OAR A;  3DTJ A;  1EMV A;  3DPH A;  4U0B A;  4H2X C;  3I56 P;  2AFE A;  2Z45 A;  2GZG A;  4XRO A;  1VQ6 P;  2EHT A;  2PEI A;  2K2Q A;  4PWV B;  5HGN A;  1M6N A;  2GDY A;  3M1M A;  5KP7 B;  3G28 A;  1K8A Q;  1JJ2 O;  4GR6 A;  1DV5 A;  4U0F A;  2KG9 A;  1N8R Q;  2P9X A;  2FAC A;  4IZ6 A;  3EJB A;  1VHN A;  2FQ1 A;  3G1G A;  2LF4 A;  1HQB A;  2GYK A;  2CG5 B;  2L9F A;  2JGP A;  3G1I A;  1KC8 Q;  2LKI A;  3VRL C;  1D1D A;  5HVC A;  2DNW A;  2LL8 A;  1QVG O;  2L4B A;  2KOP A;  3H47 A;  1RO0 A;  2GZF A;  2L22 A;  2CQ8 A;  2KOR A;  2N6Y A;  2XV6 A;  1T8K A;  1VQO P;  2Z44 A;  1M1K Q;  4COP A;  2MVU A;  2CNR A;  3I55 P;  2MD9 A;  2LIW A;  1VQ8 P;  2KOS A;  2Z46 A;  3CCE P;  3G6E P;  1UJZ A;  2N5I A;  1ACP A;  2GZE A;  1VQK P;  5BS2 A;  2AVA A;  4H2Y C;  1L0H A;  2N6Z A;  1VQ5 P;  1K73 Q;  2KWL A;  3U43 A;  2BUO A;  4IPY A;  2EHS A;  4PH0 A;  2KGD A;  1X3O A;  3RG2 A;  1AYI A;  4NEO A;  3H4E A;  2VLP A;  2OTJ P;  1YHQ P;  4CA3 A;  3DS4 A;  1A8O A;  4PXH B;  4R0M A;  5HV8 A;  1IUQ A;  4U0D A;  1Q86 Q;  2ONT A;  1NJI Q;  2EFJ A;  2KR5 A;  1GPJ A;  2KGA A;  1YIT P;  4U0E A;  2PEM A;  2PNG A;  2E1M A;  1RNI A;  3CPW O;  2FVA A;  2BHV A;  1GXH A;  4H2W C;  2K93 A;  2JYL A;  3NTE A;  2ROQ A;  4COC A;  1Q82 Q;  4U0C A;  2X2B A;  4BPF A;  1UNK A;  1VQM P;  1QVF O;  1E6J P;  2FVF A;  1YI2 P;  5DCK A;  2LML A;  3HZQ A;  2N98 A;  2CGQ A;  2FVE A;  2JAZ A;  2VLO A;  3G21 A;  4XRQ A;  3CCS P;  3CCM P;  1YIJ P;  2KOO A;  3WBH A;  2PEK A;  3GJN A;  4BPG A;  3CMA P;  2K0D X;  1IMQ A;  4XFY A;  2QNW A;  1BAJ A;  4QKO A;  3EJE A;  2K0Y A;  2GDX A;  3G4S P;  2DGY A;  1W2B O;  2WPT A;  2EIA A;  1GXG A;  2K5X A;  1VKU A;  1Z6M A;  1YJW P;  3HYB A;  1S72 P;  2KGE A;  2KOD A;  3CCQ P;  2L0Q A;  3DS0 A;  2GDW A;  2K94 A;  1VQL P;  2JU1 A;  4WYM A;  2KGC A;  3P05 A;  1VQ7 P;  5HGO A;  4QNB A;  5F2N A;  2KW2 A;  3G29 A;  2AFD A;  4PH1 A;  4UHP B;  3GZM A;  1QRJ A;  2XZ0 D;  2EG5 A;  2M8N A;  3G71 P;  2L6E A;  2KG6 A;  1YJN P;  2VLQ A;  2PEO A;  2JO0 A;  2K92 A;  2VSQ A;  1M6E X;  2GZJ A;  3CME P;  2XXM A;  1L0I A; 
#chains in the Genus database with same CATH homology
 2MF4 A;  2CG5 B;  2ROQ A;  2L9F A;  2JGP A;  1HY8 A;  2LKI A;  2MVV A;  2X2B A;  4BPF A;  5HVC A;  2DNW A;  1KLP A;  3GZL A;  2LL8 A;  2FVF A;  2AF8 A;  2L4B A;  2KG8 A;  2KOP A;  3NY7 B;  2L22 A;  2LML A;  2N98 A;  2CGQ A;  2FVE A;  2LOL A;  5CZD B;  5KP6 B;  2CQ8 A;  2KOR A;  2MY5 A;  2N6Y A;  1T8K A;  4MRT C;  3EJD A;  2MVU A;  2CNR A;  1DNY A;  1AF8 A;  2MD9 A;  2KOO A;  4BPG A;  5KP8 B;  1NQ4 A;  2LIW A;  2N5H A;  1F80 D;  2FAD A;  2FAE A;  2FQ0 A;  2KOS A;  2KOQ A;  2QNW A;  5EJD A;  2K0X A;  1OR5 A;  3EJE A;  2N5I A;  2K0Y A;  1ACP A;  2GDX A;  3LMO A;  2FHS C;  2MR7 A;  2AVA A;  4H2Y C;  1L0H A;  2N6Z A;  4HKG A;  2N50 A;  2KWL A;  2JU2 A;  1VKU A;  4DG9 A;  2EHS A;  2KGE A;  2KGD A;  1X3O A;  2L0Q A;  2GDW A;  3RG2 A;  2K94 A;  2JU1 A;  2KGC A;  4NEO A;  2LPK A;  4H2X C;  2XZ1 C;  2AFE A;  2EHT A;  4CA3 A;  2K2Q A;  4PWV B;  2KW2 A;  2AFD A;  2GDY A;  4PXH B;  5KP7 B;  4R0M A;  5HV8 A;  3GZM A;  2XZ0 D;  2FQ2 A;  1DV5 A;  2KR5 A;  2KGA A;  2KG9 A;  2KG6 A;  2PNG A;  3CE7 A;  2JQ4 A;  2FAC A;  4IZ6 A;  2K92 A;  3EJB A;  4BPH A;  2FVA A;  2VSQ A;  2LTE A;  2FQ1 A;  2M5R A;  1HQB A;  2MR8 A;  4H2W C;  2LIU A;  1L0I A;  2K93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...