2EG5A

The structure of xanthosine methyltransferase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
354
structure length
344
Chain Sequence
GDTSYAKNSAYNQLVLAKVKPVLEQCVRELLRANLPNINKCIKVADLGCASGPNTLLTVRDIVQSIDKVGQLERPTIQIFLNDLFPNDFNSVFKLLPSFYRKLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLQWLSQVPSGLVTELIGTNKGSIYSSKASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCICKGVELDARNAIDLLEMAINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCIVEEEGSFEILYLETFKVLYDAGFSHIKAEYVASSVRAVYEPILASHFGEAIIPDIFHRFAKHAAKVLPLGKGFYNNLIISLAKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of two N-methyltransferases from the caffeine biosynthetic pathway
pubmed doi rcsb
source organism Coffea canephora
molecule tags Transferase
molecule keywords Xanthosine methyltransferase
total genus 120
structure length 344
sequence length 354
chains with identical sequence C, E, G
ec nomenclature ec 2.1.1.158: 7-methylxanthosine synthase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03492 Methyltransf_7 SAM dependent carboxyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.270 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2eg5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2eg5A02
3K0BA 3EVBA 5MHTA 1RI5A 3P2IA 4O29A 4RYLA 1V39A 1NW8A 5BP7A 1X1DA 1VPTA 5HIJA 5LQUA 3G2MA 3GCZA 3R9XB 2PWYA 5C1IA 4DM3A 3UJDA 4RTKA 1VIDA 4FT2A 2Z6QA 5DM0A 4ER0A 2B25A 2AOUA 2OY0A 3PS9A 5FA5A 5GINE 1NE2A 2NNWB 3EGEA 4RTJA 2CL5A 1N2XA 3ERCA 2OBFA 4PGHA 4GBED 1SUIA 3X0DA 4BLVA 3RIEA 5CCBA 3BKWA 5FWAA 1JTFA 5EVJA 2O57A 2NP7A 2AOTA 3FPEA 3MCZA 3FUWA 3OPNA 4HTFA 3TR6A 1L1EA 2PXAA 3THRA 3TOSA 5CUQA 3V97A 4OX9Y 2AS0A 5CVUA 5E1DA 3EVCA 3LCCA 3C0KA 1U2ZA 5GM2A 2ZBRA 4YUXA 1SKMA 1ZKDA 5ERGB 5FTWA 1XDUA 3BXOA 3IV6A 5DLYA 2QYOA 1KYWA 1AV6A 5EPEA 3UA3A 3GIWA 2P3OA 1EAMA 3LHDA 2YXLA 2V7EA 4FSXA 2P40A 5GIOE 1O54A 3C3YA 1HNNA 2XVMA 3LKZA 3MERA 5EMMA 1XDZA 4YUYA 2PKWA 3QOXA 3G7UA 2G70A 1RJFA 4OA5A 5EIWA 3TLJA 4B17A 1XDSA 3KQMA 5DRYA 2FYTA 3Q7EA 1ZHFA 3FUUA 5EC8A 3SM3A 2G72A 3BUSA 3EVZA 5EHIA 3OU7A 3LX6A 3GDHA 3NTVA 3FPHA 5HOQA 2YXEA 3ER8A 1H1DA 2AN4A 1Q0TA 3V8VA 4HH4A 4BP3A 3KR9A 5U4XA 2GA9A 4QQKA 1EJ6A 2B3TA 3TRKA 3CKKA 5LQCA 1JG2A 4AZVA 3FTEA 4PYIA 1TW2A 5GP1A 4KDCA 2ZIGA 3NW9A 1X19A 3GXOA 4RSRA 2CKDA 4RWZA 4YV2A 1NV8A 1YZHA 5DX0A 1G38A 4XUCA 4F86A 5DTMA 5B1SA 3UJ9A 3M6UA 1SG9A 2ERCA 5D1NA 2AN5A 1NW7A 4EQZA 3UBTA 2IBTA 1T43A 2R3SA 2C7RA 2IFTA 2Y1XA 5E2BA 2OO3A 4E2ZA 2AVDA 3KPYA 1FPQA 3M6XA 3P9KA 4YUVA 3PFHA 5CVVA 5T64A 5K0JA 3G8AA 2FHPA 1QAQA 2YQZA 3KQQA 3F4KA 2YVLA 3EPPA 3SX0A 4DQ0A 5LQKA 2C7OA 4V0RA 4P58A 5BW4A 2UZ4A 2C7QA 1YFLA 3OFJA 1XXLA 3Q87B 4P7KA 4QDJA 4PIMA 3DUWA 3BT7A 5DPMA 1Z3CA 3LL7A 4E2YA 2AR0A 2EG5A 3HCDA 1NW6A 2PX2A 1JG3A 3CGGA 4OQEA 4X60A 3KPVA 3UJ8A 1M6EX 2ZCJA 1AQIA 5IKMA 2E5WA 2CWWA 3OU2A 4HGZA 3FPJA 2NP6A 3BWMA 1JQ3A 5EMKA 4XCXA 3M70A 3ELWA 4M37A 3B3JA 3G2OA 2O0LA 5HIMA 1P1BA 3QOWA 1VE3A 5K0CA 3EVDA 3ME5A 3AWIA 1BHJA 5K0EA 5CM2Z 2PGXA 1O9GA 1XTPA 3NJRA 3BWCA 4E32A 3I53A 4CTJA 2JHCA 2FRXA 2ZSUA 2BR3A 1G60A 1YB2A 4YMGA 2BR5A 3LECA 4C08A 5K0FA 2G71A 2YTZA 2ZTHA 4U7TB 3G5TA 4JXJA 1KP9A 3TFWA 5DWQA 3QV2A 2K4MA 2IDKA 2PT9A 3HCBA 3A7EA 3KQOA 3P9CA 3PX3A 5DX8A 1R8YA 2QM3A 4HTFB 1WG8A 3JWIA 5K0BA 3EVAA 2IP2A 3R24A 2VDWA 3M33A 1O9HA 2HMYB 2EX4A 3KQWA 3HA7A 3OZTA 5BXYA 1QYRA 5K01A 1NW3A 5CVJA 3T7SA 4AZWA 4CWAA 2PSSA 5EGSA 4A6DA 4EVIA 2IH5A 3O4FA 4KW7A 4LWPA 2BZGA 4QPPA 4XUDA 5CVEA 3CC8A 3DMFA 5EKUA 2OXTA 3TM4A 1YFJA 4PGGA 2AVNA 5T67A 4RVHA 3OFKA 3I64A 4QTTB 5E9JA 3HP7A 2ORED 1Y8CA 3UA4A 4X41A 3MB5A 5DX1A 1WY7A 3CJTA 3HVKA 5KS2A 2GAFA 2WA2A 3FTDA 5EKXA 4HSGA 1JG1A 2LD4A 2O06A 5K0GA 4GEKA 3G2QA 3I9FA 4HGYA 2ZVJA 4K6MA 4PCAA 4OA8A 4OQDA 4HG2A 3DP7A 1P91A 4E31A 4AZSA 2YUIA 4RVGA 1P39A 5K8VA 4GOOD 5IH3A 1L3IA 3DMHA 1UWVA 5K0NA 3UJ6A 5CD1A 3DXYA 1RI3A 3EVEA 3VSEA 5K03A 3KKZA 3MCTA 5M5BA 4F84A 3ER9A 3G5LA 2ZWVA 3EVGA 3OE5A 3PVCA 3PT9A 5DM2A 2OB1A 4C07A 3FYDA 5K05A 3L8DA 1G8AA 1WZNA 2H00A 5E8JA 4AX8A 4ISCA 1DUSA 2OPBA 4OBXA 2ZFUA 5FHRA 5GWXA 3IHTA 3EEYA 2AN3A 2VS1A 3GRUA 1JSXA 2ZW9A 4YUZA 3I5UA 4PYQA 5EZQA 2NXNA 3IEIA 4C4AA 3DXZA 1SQGA 3TM5A 4RTMA 5LR6A 3JWJA 1YF3A 3TPZA 3R6TA 5LSAA 3R3HA 4DZRA 3P97A 1L3CA 2P41A 5K09A 3GO4A 2JHPA 1KHHA 2IPXA 4MIKA 3T0IA 1WXWA 4DCMA 1XCJA 2HR1A 3UWPA 1JSZA 2HNKA 1Q0SA 3DOUA 2V74B 5EHGA 3T7RA 3CBGA 5ICCA 4FS8A 1HMYA 2AOUB 2O07A 4P7GA 2XYRA 3DMGA 5HZMA 4RTOA 4ZTBA 2PT6A 3KPUA 2P1DA 3KQVA 5H02A 2BR4A 3GWZA 2PX5A 3B7PA 3KHKA 4KVZA 5EOVA 3TKYA 1AQJA 1XVAA 2EJUA 3LGAA 1I4WA 2NXJA 4M36A 1VBFA 3REOA 2OB2A 2B2CA 3NWBA 3VC1A 3SGLA 3O31A 4KIGA 4BY9E 4PYKA 2Q41A 2PLWA 1FP1D 1NW5A 5JR3A 1VQ1A 1PJZA 3PB3A 3P71T 3LBFA 4M7RA 4KIFA 4E33A 1R8XA 5F2NA 3A7DA 3H2BA 3A4TA 1SQFA 1EQAA 3HA3A 5FULA 4POOA 4DA4A 2CMGA 4RTLA 1UIRA 1YZ3A 2HV9A 4PONA 3TKAA 4CKBA 3LDFA 3MGGA 3P2EA 1FJXA 1YUBA 3ELDA 3NDIA 5EMLA 4FT4A 4C03A 2AOTB 4YV1A 2R6ZA 1JR4A 3B89A 3OZRA 3UZUA 1QANA 3D2LA 4LG1A 4KRGA 3C6KA 2PV0A 3BWYA 3SSMA 5KYGA 1XJ5A 5GIPE 2C7PA 3VYWA 2Y1WA 4IKPA 5E1OA 2AOXA 2JH8A 4FR0A 2XBMA 1IY9A 1TPYA 10MHA 1R18A 2JG3A 1NBHA 5DTRA 2ZBQA 2ZIFA 5KQRA 4Z2YA 3B3GA 2ONYA 5T6BA 2GH1A 3K6RA 3SR4A 3EMBA 5HILA 4MWZA 4GOND 4R6WA 1L9KA 2XYVA 4PIPA 1F38A 3A26A 2OZVA 3CJRA 3NWEA 3KR1A 4GC9A 5EEHA 2P7IA 4ER6A 3HCCA 3HCEA 3DULA 3PTAA 3MQ2A 3E7PA 4CKEA 2O05A 3ORHA 1ORHA 3OE4A 1NKVA 4QPNA 4U7PB 5DSXA 3T7TA 4WXHA 3GRYA 4FGZA 2GS9A 4RTNA 1X1AA 1SUSA 1VL5A 5DM1A 4QDKA 1VP9A 3G89A 2UYCA 4DCGA 2FK8A 2JH9A 1RJGA 4BLWA 4GF5A 2I9KA 1N7IA 2IGTA 4QTUB 4XUEA 5FADA 2GLUA 1EIZA 4PYLA 5EQJB 5EG5A 4G56A 5FUBA 4GQBA 4AUKA 3FRHA 3G8BA 2I62A 3HA5A 5HEKA 3EGVA 5DRTA 2PXXA 4DMGA 4HC4A 3FZGA 4RVDA 3E05A 4E2WA 4PYJA 2VP3A 2VDUE 4C05A 3GJYA 3LCUA 1KPGA 5HIKA 4QVGA 2ONZA 2ZZMA 3B3FA 3CCFA 2GB4A 3EEOA 5FQOA 5GOZA 5C9ZA 2HTEA 4PCLA 2UYHA 4GOLD 2FK7A 3AXTA 4RX1A 2QE6A 3HVHA 3MAGA 2PY6A 5EIFA 4BP1A 4EKIA 2AZTA 1QAMA 2EFJA 3NDJA 2I6GA 1DCTA 3SXJA 4WVLA 4GC5A 2XYQA 5LQJA 1KPHA 3BKXA 1EJ0A 3A25A 4FP9A 1M6YA 2FPOA 3E23A 3KR2A 4PWYA 3U81A 3HVIA 3I58A 4MQ4A 3KPJA 5DTQA 4CKCA 5JUWA 4HRAA 4DF3A 2I7CA 3PFGA 5HFJA 4YUWA 2JHAA 3DTNA 4EMSA 2IBSA 3EGIA 3KQSA 5E9QA 2ZZNA 5DXAA 4CTKA 3P8ZA 2DULA 5E2AA 3IYLW 1RI1A 2H1RA 4MTLA 4OBWA 4CXMA 3VC2A 3O7WA 5FCDA 4IV8A 3DLIA 4PNEA 5LQRA 1JTEA 4X1OA 1VLMA 5LQNA 3M6WA 5D1HA 1G8SA 4A6EA 1M0EA 4R8RA 4PINA 4DKJA 3FUTA 1NBIA 1ZG3A 2G8NA 2ZBPA 3BZBA 3FTCA 5DSTA 3NMUF 1INLA 1MJFA 3HM2A 4NECA 1R74A 2FCAA 1ZGJA 1X1CA 2YX1A 5HIIA 1NT2A 4UOEA 2PX4A 2NYUA 4PYOA 4PYNA 2IH4A 5E9WA 3FUVA 1F3LA 3GRRA 3KQPA 5CIYA 4KWCA 5GM1A 1JG4A 4QQNA 5KQSA 3P2KA 3OU6A 5EEGA 2BH2A 4GUAA 5DT2A 2IH2A 4FZVA 1JQDA 8MHTA 1FBNA 2PWPA 1OR8A 2ZWAA 4PYMA 1AF7A 2B9EA 2BM9A 3G2PA 3GRVA 3PX2A 1RJDA 5BW5A 2Z6UA 4RTQA 3PLAE 5FWDA 4R6XA 2KW5A 3TMAA 1X1BA 1SVUA 4RTPA 1RI4A 2ZZKA 3AJDA 3HEMA 2F8LA 1KPIA 3AY0A 5DXJA 3UJBA 4EK9A 5CCXA 3SSNA 1NV9A 2GPYA 3THSA 3UJ7A 3TQSA 5ICEA 4IWNA 5ICGA 4M38A 3DXXA 2VDVE 4BLUA 3R0QA 4F85A 3FYCA 3B5IA 1RI2A 1I1NA 3HNRA 3OZSA 1L3BA 2NXEA 3KQTA 3P9NA 5DM4A 2NXCA 3CJQA 2HWKA 3JWGA 3ELYA 1BOOA 2EJTA 4ATNA 1D2HA 3E8SA 2AOWA 3S68A 5EZSA 1DL5A 1KXZA 2PJDA 2CMHA 3BGDA 2PVCA 3GGDA 4LECA 3DLCA 4P7JA 3UJAA 3KQYA 3MTIA 3BWBA 4KDRA 5F2OA 1TW3A 2B78A 2XVAA 3G88A 2VZ9A 3OCJA 4P7FA 4QVKA 3GNLA 3M4XA 5CVDA 1IXKA 5E1MA 1QAOA 3ELUA 4H0NA 3LPMA 4ER5A 1IM8A 2IDJA 4IV0A 1KR5A 5E8RA 5FA8A 2A14A 1I9GA 3MHTA 3NVKI 1KYZA 3RW9A 1RJEA 4E70A 1R6AA 5FQNA 5G02A 7MHTA 1UFKA 3A27A 2H11A 3P9IA 4RTSA 3UJCA 5EMJA 3ID6C 3CVOA 2P7HA 3DH0A 1D2GA 2OYRA 1ORIA 3ANXA 3HVJA 4R05A 1G6Q1 2G1PA 3AXSA 4V0QA 2UYOA 3KU1A 3GRZA 1ZGAA 4R8SA 2IIPA 4C06A 1D2CA 9MHTA 4ER7A 1WXXA 3FRIA 1VP3A 2ZIEA 4L7VA 1PRYA 3EMDA 3SVZA 3FUXA 3KPWA 4Y2HA 2P8JA 2OKCA 2QRVB 1B42A 2N47A 1P1CA 1BKYA 4GOMD 3MTEA 1WS6A 1G55A 3KR0A 2ZLBA 3GU3A 2PBFA 1JQEA 4E30A 3LCVB 1XCLA 3JWHA 2UYQA 2YR0A 4RVFA 3NVMB 3SMQA 4YMHA 3DR5A 2YXDA 1N7JA 2JJQA 5P8WA 3FPFA 4ER3A 4MHTA 2ADMA 4LWOA 2QY6A 2WK1A 3WSTA 2BM8A 2PX8A 2P35A 3LDUA 2QRVA 3FTFA 4Y30A 4E2XA 3RODA 3LKDA 3FPGA 3EVFA 4C04A 1ZQ9A 1MHTA 3HCAA 5F2KA 5ICFA 5E1BA 3HTXA 3LBYA 2ESRA 3BGVA 4YV0A 1EG2A 5C0OE 3UFBA 3C3PA 2Z6AA 1R00A 1QZZA 4RV9A 4X61A 3C6MA 4AZTA 5LQAA 1BC5A 2DPMA 2AOVA 2ZULA 5FHQA 1FP2A 2P3QA 2WA1A 3BGIA 4EKGA 5KVAA 3LSTA 4RTRA 3M6VA 3HCFA 2PXCA 4X63A 1KIAA 3SSOA 4FSDA 2P3LA 3LDGA 5K0LA
chains in the Genus database with same CATH superfamily
4L08A 1G6KA 3P2IA 3G9UA 1HE3A 1L5FA 3AW8A 3GFBA 3OF2A 3T3MB 5BRJA 1UH5A 1PDWA 4KR6A 2NT3A 4DM3A 4ZQGA 1VI2A 2XE6A 4FT2A 4HXFB 2QYTA 5DM0A 3T5TA 1UKVY 4PZCA 1F0KA 1OWMA 3U31A 4ER0A 4BYMA 4PO9A 3RYHA 1Y33E 2C4TA 3A6GA 5JLJA 3ETEA 1MH1A 1X0VA 3GEMA 4BFTA 4G8DA 4UNSA 1F48A 5JCJD 3L02A 1BMTA 4JEMA 2XE8A 4A2QA 3SQDA 3VAZA 1JTFA 3WNQA 4PH0A 5COQA 4AZ0A 2DGDA 1NJ6A 1OA1A 3OHPA 4KVGA 2PXAA 1LV8A 2CEAA 5FOVA 3TR6A 3WQSB 4B6JA 4F8YA 3SYTA 1XP5A 3O0DA 4XFYA 1HDRA 2VATA 3VYVA 3SAJA 5CIQA 1EWTA 2J3HA 4O4IA 1C0PA 5AHKA 5ERGB 2EW2A 2M6SA 3ND7A 4K87A 5F76A 2HK6A 2QLBA 3K5HA 1IAQA 5D87A 1T5SA 1YI0A 4GW3A 1BWPA 1HL7A 2D0OB 4OL0A 4M54A 3GHYA 4FJ0A 4QBGB 4BPGA 4QSHA 3VPAA 1C0IA 4PNZA 2OVFA 4G5HA 3X2SA 3RM3A 5HQ3A 1NN1A 4DYDA 1O0BA 1TEXA 3R2JA 5HV8A 1BEEA 3H6GA 4JYCA 3CLRC 2G70A 2GKSA 1RFGE 4TRMA 4F56A 3QIVA 1PV1A 2OFXA 4J8PA 5C8DA 2X8WA 5CYGA 4TL8A 2AXNA 2JIOA 2ZGVA 3RHZA 3AJRA 1LW7A 1XOIA 2BZ1A 1P9RA 3A6LA 1NXOA 4Z1MD 4HX2A 4JI2B 3MBOA 2LDXA 3SP1A 1U7TA 3IP9A 2Y4OA 4HPWA 1Z12A 4L0CA 1JG2A 4OQLA 5CLFA 3W3ZB 1Z6YA 3AUYA 3ZK7A 3PF9A 2EJWA 2YJ4A 4ZHQA 2FADA 3PGMA 2KR5A 1SUFA 2NVUA 3JQAA 3ZDEA 2C54A 1OT5A 3FUCA 1OXSC 3OZEA 2K2QB 3A2LA 4EP1A 2GEJA 4EQZA 2QZ4A 1RNLA 1J6UA 1K7XB 3L0DA 2M5RA 4MHOA 3PFBA 4Q9IA 3TS1A 5EE3A 1CNMA 1O95D 1MJHA 5BSEA 3U17A 4AN1A 2CD9A 2J6HA 4TYWA 2HMAA 2VZLA 4YIHA 1CRPA 1FZTA 3MXOA 2HCFA 2CYBA 4LSZA 3GMIA 5JBQA 4IILA 5LDHA 3LK6A 5LZ4A 5IBPA 2ETVA 4XFXA 1WDMA 4W9RA 5BQ3A 1KQGA 3T5DA 3LL7A 4C6HA 2EG5A 5HBRA 1RKBA 4NKRA 3G82C 2D2VA 2AKEA 3UMSA 1UMBA 2GLXA 4TLMB 3WI7A 1JHOA 3EXHA 1OZHA 4E11A 2QMYA 3GGJA 1L5VA 3BTUA 4XH9B 4MCHA 4Q7LA 1NKTA 1VE3A 1HYQA 1UP7A 4HAIA 4R2MA 4Y0AA 1KAQA 3VR4A 3HDTA 1QF9A 1IBKB 3NNNA 2BGRA 4HDSA 1NMQA 4AROA 3IBGA 1T8PA 5FTKA 1QO9A 4CI9A 3EPJA 1SBIA 3OE7A 4OXYA 1W30A 2VDKB 3WNBA 3CIOA 5ITZB 3G4SP 4NOJA 3L3BA 3T4EA 2W6MA 2Y3IA 2REQA 4OHZA 2QLTA 4CE6A 2O2SA 5AI6A 1KP9A 2FWAA 1ECLA 3JR7A 3RABA 3Q4GA 2M8NA 1OFUX 4HQKA 4RJKA 3KU4A 1CTQA 1NDUA 3HCBA 5KJEA 1KY4A 4C21A 3QVOA 1I2DA 2YDXA 1V1RB 1CY4A 1E9VA 6CHYA 4DV4B 5K0BA 2J9FA 3AKYA 3UBMA 3UT6A 4HK4A 3MRTA 1T0UA 1VCMA 4WRRA 5BN3B 3HNOA 1CJKC 2QVYX 2R44A 3A9RA 4G1VA 1U99A 4A6DA 3ILXA 1LDEA 4G2TA 2QU7A 4FWIB 2PUTA 1C0KA 1GRVA 4LWPA 2DY1A 5ALEA 3LQQA 3ZLJA 3CRW1 5HJ5A 2H7XA 5KYUB 3UO8B 1T3HA 3B2NA 4F2WA 1YFJA 3E0XA 4RXMA 2GZGA 5LD2C 4CMIA 2XQFA 4F9TA 2ZBDA 3NVAA 2GAFA 1NG9A 1I2ZA 2ZOSA 3FCSB 3G17A 3QEKA 1HTTA 1WPRA 1KKUA 2WJIA 1Z18A 3FAKA 3LPLA 3NOXA 8GPBA 2R8RA 4TV8B 1ZI6A 1QG0A 2A5LA 2GBLC 1PVDA 2ABWA 1MEEA 1N2EA 1QR2A 2X1HA 5E2IA 5ITZA 1P4HA 2FW8A 2C3MA 2JARA 3DM9B 3WFZA 1E3LA 4UM9D 1LV7A 3O83A 2X15A 4HQFA 3BE8A 5J58A 3H65A 4XWWA 3AI2A 2CVOA 1E3TA 1QGUA 4ZZ2A 2WYUA 2BHNA 5CDFA 3VU0A 1OILA 2QYSA 4MWOA 3I56P 1UOEA 2P68A 2EF1A 3L8EA 3U26A 3EN0A 2EFYA 1KNQA 1TIPA 2BKUA 4CTNA 5GZ1A 3LQKA 4ZP1A 4KXUA 5BSTA 3QFCA 1G8HA 3NC4A 4ZCSA 3JYHA 3GEGA 1FUEA 1V11A 1Q11A 2WJZB 4MARA 4WNYA 1KK1A 2NXNA 4TKUB 3CMEP 1N2CE 1VPEA 2XJ4A 4NQRA 2X76A 3ZWCA 1JFSA 4DLSA 1T25A 2PAAA 5D6OA 2LKDA 3TQHA 3PUWA 4JQSA 1GTL1 1XP8A 4LDJA 2AXQA 3F2IA 4QQRA 3U40A 5CA1F 3D8HA 2W42A 4ARAA 4EHDA 3IT0A 3MAAC 4FKBA 1XYYA 4JL8A 4ZC8A 2G82A 5CA1A 4FEYA 4QGBA 1Y80A 1DBQA 1KFJB 1O0SA 1UWLA 3S70A 4ARVA 3MWLA 1L5ZA 3P9XA 2VOJA 2E6KA 2QF7A 4Q18A 1BYUA 4QLAA 5DBFA 1SY7A 3VDXA 5JALA 2JI9A 3GZJA 3ZWWA 3WIVA 1AQJA 4ZVUA 4X64B 1E6KA 1PJLA 1Y4ZA 1U7XA 4KAJA 4XR4A 2WLTA 1FW6A 3IUJA 4ZOQI 1LBSA 2VUHB 3GELA 5T3UA 2YNMC 4LZZA 4YGYA 4UFNA 5BOVA 5B4VA 3E4DA 2QTLA 3PHIA 5CFMA 5AVQA 3B70A 2Z2KA 3EZYA 5C37A 1PJCA 1GCUA 1GOTA 3PIDA 1RJ9B 5AW5A 4UHDA 2CVHA 4I9GA 1Z6XA 1T29A 2VSOA 3EDMA 1M1NB 2ZREA 3PGLA 4J2TA 4QDZA 1H8EA 5CNJA 5KSPA 5LYJA 4DCVA 1ZAKA 2GEUA 2VAXA 3FX2A 4GBGA 4LJ6A 2HYIC 1N2OA 4UVHA 4YR9A 4MEAA 1K88A 1XXHB 5JNSA 3DF9A 5TRTA 1JILA 1EFCA 5EMLA 5DYTA 4A3SA 1QGZA 4YV1A 2VHWA 3IURA 3I01A 3OZRA 1DO2A 2M2IA 1AYIA 1X7YA 1ECBA 4TTVA 4F5YA 2BM1A 1LJLA 3BMOA 3W2IA 3ZS8A 4H6VA 5GIPE 1D2RA 5GADl 3IEKA 4HP8A 3LX8A 2A92A 4BXOB 1WM1A 2O23A 1X15A 2H1FA 2JBWA 3DDSA 1T9ZA 1TAUA 4QRDA 1CZLA 4MIYA 3ENWA 1U7DA 2R6CA 5AQ1A 1KZ6A 2O1SA 1XKLA 4WPGA 4DEXA 3NVKI 1H42A 1WSBA 1EVYA 1KSFX 1YJBA 3CJRA 4HLDA 4JOBA 1J9EA 1FX0B 3SDSA 4DLAA 4FWTA 1J07A 2I4IA 4DC9A 1YV9A 4WCFA 3ZNNA 3OTOB 4URFA 3S0JA 4YCNA 3ZQ6A 4CKEA 5A9RA 2F8TA 3F96A 1UP4A 4QYIA 1CEEA 2F6RA 3N07A 2PPVA 2K6GA 2P9ZA 1ISSA 3JQFA 3OECA 5E0OA 1ZD3A 3KHUA 2JEYA 2H4YA 3PGJA 5HF8A 4EUEA 4R3WA 3UNXA 3FAZA 5DT9A 1NAHA 2OP0A 3KAQA 3WK5A 2OQVA 3L5OA 4B84A 2NV6A 2W2QA 3L05A 4K5QA 1MV5A 2OBMA 2W71A 4OYHA 1DBWA 2HA0A 1WXDA 2V97A 3WYFA 3FCEA 2G7ZA 1EK5A 2ZUVA 1T1IA 1YVEI 2GLUA 2OLJA 4FQ7A 5AW6A 5CH3A 1GIAA 3AEKA 3EG9B 3I42A 4RF5A 3UW3A 3PQ5A 3L46A 1X7YB 1XZJA 1W1WA 2HK8A 3DG9A 2DFPA 4M0IA 4NFHA 4XRRA 3WMEA 1Z4IA 3C70A 4UU7A 3FZGA 4OB7A 4MS3B 1P45A 3LIIA 3NO4A 4JJGA 1KNXA 2D2FA 3NP7A 3SHFA 3ZCXA 2EL7A 4A10A 2Y2VA 2BELA 5IK2D 2H59A 3ADKA 3LLVA 5JY1A 2AI3A 1QHGA 1CR0A 3GA5A 2ONZA 4DLKA 4C0LA 1UZUA 4G25A 1G0NA 1EM8B 1SNYA 1YL7A 2WFAA 1Y42X 2XGOA 4HWKA 4PCLA 3F74A 4RESA 5IDYA 4ZZ3A 4BTLA 3SDZA 3GYGA 2XWJI 3PPYA 5AJHA 3TL2A 4AUMA 4MVCA 5E6RA 2XUPA 5BVHB 1VE1A 4GC5A 1NVKA 1WUKS 1O96B 1NATA 2AW3A 2YHIB 3K6JA 1G7SA 4LIPD 1SKYE 1M6YA 1N4DA 2Y27A 3P9SA 4YJGA 4NARA 5JJIA 2XOKA 4EGCB 1FMTA 2GTPA 3DB2A 4MQ4A 3H9JA 2QPAA 2XODA 4RQTA 2I7CA 3NBQA 2WAOA 3TOZA 2JHAA 1EBBA 3I72A 1U8CB 2PSFA 1MR3F 3R5JA 4ES6A 1XZ8A 721PA 2C88A 3M9LA 2DULA 5JD3A 1U31A 4FNGA 5I9NA 3WC4A 3C7AA 5LB2A 3TLMA 4BPRA 4C2TA 2BGMA 3N6VA 3DE5X 1FVOA 2I2BA 1OBFO 3UK2A 2EGUA 4J9UE 1M6HA 1QIIA 2JCYA 4TRJA 2V0CA 1XTVA 5TQVA 1L9XA 3U9SA 2OTCA 3QMWA 2UXCB 4MKRA 4TV8F 4Z2AA 2FZCA 3OY2A 4TLBA 4D9GA 3G5MA 2GEDA 4LKRA 3COYA 1T9CA 4MQFB 4D92A 4YFYA 2E2WA 1P6XA 1C7RA 5T4HA 4CUKA 1YT5A 3DXFA 4IQ0A 2QVLA 3IBCA 4YMUA 2R1VA 1CUBA 1L0BA 3C6XA 2JGPA 1T4CA 2Z9DA 2D2XA 2XUZA 2P65A 5CJPA 3UAZA 2BH2A 1BDBA 2OE2A 4IAOA 1FFBA 2O8NA 4CLOA 4NDAA 4AF7A 3T38A 2GUGA 2PDAA 2HGZA 1HE1C 5K20A 2HFJA 1DU4A 4HRXA 3QBJA 4LV8B 5C80A 2QOEA 4KQXA 1YZFA 4BAUA 2QUBA 4R9NA 1N3IA 2BZSA 2FG5A 5CCXA 3L2OB 4G0WA 1X6VA 1V4BA 3KAJA 1W5TA 4AAYA 5CITA 1UBMS 4BLUA 1RVV1 3FYCA 2BHVA 1O94C 1NC3A 1JBQA 2FG7C 2A57A 2YZMA 4FIZA 5TVGA 3U2QA 3ZCUA 1MG0A 4KSYA 2YW9A 4ATNA 4JXZA 2HSJA 1HORA 5LNK6 1QFMA 2CDBA 3PHGA 4HVTA 5KJFA 5LU9A 1ZFNA 3K3PA 3LA6A 4RC9A 1H4SA 1Y37A 3H1GA 4WERA 1LSOA 2A84A 3EXAA 4D1YA 4C7VA 3BIFA 8MHTA 1YCGA 3H4VA 1N1GA 1DQRA 3WIOA 4IQ4A 4S1NA 4X62B 1UAGA 3OI7A 3RU7A 1H2HA 4OI0A 4ZZIA 1R0XA 2X0JA 3TRHA 2EV9A 1JW9B 5FQNA 1M73E 3DDZX 5G02A 1R6BX 3V1YA 1AMUA 2EARA 1V95A 1B14A 2JPDA 1ZNQO 3H18A 3S27A 1T4GA 1CQZA 3K5PA 2CXRA 3AJEA 1Z5UA 2G5GX 5KX5F 3FB1A 4MW6A 5HK8A 1B8PA 1E59A 4D46A 5IVPA 2OHHA 1S8NA 3RLIA 1Y34E 3LW7A 1DMRA 3AKDA 2WYOA 1WXXA 4QECA 1R5OA 2ZIEA 4DLZA 3CR3C 3IQHX 1ZPDA 2YWGA 1UJMA 4KV9A 1KQFA 4F4JA 1CHDA 3AHFA 4EB8A 4Z9BA 3ESRA 2H4XA 3HO6A 6REQA 1QIJA 3RADC 2PS3A 2AJDA 3Q6MA 1DAOA 3D2AA 4PR0A 4IZ6A 1F8XA 4BXOA 2HWXA 4JBGA 1UZMA 3D81A 3EXHB 2KGAA 4Q6WA 5EIXA 1T2CA 4CGYA 1OAOA 1BWRA 2ZIAA 2QTRA 2XZPA 3UW1A 3UOGA 3L6CA 1FW8A 3TPCA 3FTFA 3D0QA 4YAFA 2C57A 1SU7A 3ZJ4A 2R87A 4A8HA 1QFXA 3HMKA 2GVNA 1KI7A 4F0JA 1LVGA 4RETA 4C7XA 3PUKA 4DIBA 4W7IA 4DDHA 2WIAA 2ORVA 2BM0A 3CRQA 4X0EA 2YV4A 4ALLA 5EP3A 3UANA 4DMUB 4IIHA 4RHEA 1YRQA 2YKGA 3A9SA 1WPGA 1KO4A 1Q2UA 1IK4A 1UOPA 1RP1A 1W581 2YASA 4K81B 2RAPA 4MRVA 4QBIA 1Q0ZA 3BXHA 3HBFA 2DG2A 4L8WB 3WIUA 2QRQA 1SXGA 2BUAA 1DG3A 3F90A 3HCFA 4KO4S 4WBNB 4R3NA 4TTAA 4K0RA 1ZL2A 1SC6A 1G7RA 3R9WA 1M74A 3HCWA 5MHTA 1PD1A 2QK4A 1EGMB 3D4OA 1MO6A 3BD8A 3FLEA 1J00A 3NIGB 1NUQA 2QQ0A 1M34B 2XUAA 4CV3A 4AWBA 3B1VA 1W46A 4DC1A 5BSHA 4XIJA 2B37A 3PYXA 1F2VA 3SCZA 3MS2A 4FM9A 1FP7A 1P8JA 1L4BA 2XEDA 1PEDA 3QFHA 5GINE 4I08A 4YREA 1XMVA 1M76A 5CDYA 2CL5A 1COWD 4A03A 4OLJA 4GZMA 1M1UA 4L2IB 3THYA 5L95A 4BLVA 3ZHRA 4EZBA 2TSYB 1TXGA 1VGQA 4RH3A 2O57A 2ZU0C 4WLNA 2RGEA 3Q9LA 3KLMX 5HQ3B 4H27A 2ECPA 1GP2A 2BKVA 3GAAA 1F5NA 3EY4A 4QYSA 3H1EA 3MMSA 4N5LA 4Y9UA 4MLZA 2LP4Y 3EVCA 4KGVA 4O2BB 4RPJA 4C7BA 2YOHA 1MABB 1KDZA 4Z3OA 3SIPA 1ACMA 1ZW6A 2V3VA 4MUBA 1CDOA 1LPAB 2P9GA 1XTRA 3Q3JB 1A7JA 4N5HX 4NJOA 1SHKA 2P3OA 5JTTA 1DO0A 2W37A 5AM0A 3GXBA 4RPCA 2BGIA 1N8TA 1PK8A 2I1VB 3KLOA 3QPBA 3EWSA 4LGYA 1M5TA 1AK1A 5LZ2A 4X85A 3FUUA 3GJRA 4QG7A 3MLBA 4I81A 5LIPA 5TR9A 1CUUA 1AK2A 1E3DA 3PL1A 4NK4A 2GD2A 5HVCA 2QAGB 4LK2A 3G2IA 4DUGD 1OUMA 3DO5A 2H1IA 2X8LA 4HH4A 4IUYA 1TTQB 4J0GA 5LCXA 3ESQA 4M99A 1M2VB 1RVDA 1XB2A 3UICA 3P0RA 1H2BA 3KS9A 4R8LA 3A05A 3NW9A 5KTOA 1GRRA 2AI2A 2CJWA 2GVDC 4HVCA 3KZVA 1TMOA 4XASA 2CSXA 4O5OA 3OCCA 3QELA 4YTEA 3RVSA 3T8YA 1G21A 3CW8X 5H82A 5I7UA 4LDNA 3A31A 1U2PA 1MPXA 4BCCA 3FE2A 3FKQA 1EDEA 4ITUA 2IFTA 3K92A 4ZJUA 4ZEVA 2H0RA 3KWMA 1W0KA 3L6RA 1DBSA 2DERA 4YUVA 3I52A 2GZJA 4A9AA 3I05A 4EB3A 3MELA 3W0LB 1VQLP 2ZIWB 2FPSA 2C0PA 3A0RB 4ILEA 4X7MA 2G9NA 2PVPA 2VLIA 3G79A 5JRJA 1OHHD 1STOA 1UK7A 3A4VA 3LG2A 4V0KA 2ZG6A 5EP1A 3TZHA 5BMVF 5ALYA 1YFLA 3EBOA 5DFAA 3K7EA 2IOFA 1OKKA 2YJ6A 1P3DA 1A2BA 2GZ2A 3DNFA 3K8ZA 3BFKA 1LLQA 3AU9A 2Y1FA 1SUPA 1JLLB 2HA3A 2XQGA 1SEVA 4IIGA 2PNJA 4D9FA 1RP7A 2IEZA 4YAGA 1FFYA 1EH5A 2AZXA 4BEBA 1N0UA 3E81A 1H4VB 4IRUB 2I3ZA 4Y18A 2PRZA 3JVDA 2DHEA 3C1UA 5AD1A 1R5JA 1XTZA 1XQ6A 2QX4A 4Q02A 2I6UA 1C8BA 2E4YA 1LJUA 1M2OB 1OFVA 3JWPA 5I7HA 2EP7A 4FE3A 4NYMR 4RNDB 1PR2A 1YKGA 4E32A 1NZDA 1V37A 3I53A 4CTJA 1VXRA 3CXUA 2BRUA 4UVIA 1J1ZA 1EB8A 1XZKA 1YB2A 4L0QA 2V98A 3FTQA 1N2CA 4PAQA 2AFIB 2LXNA 5DISB 3PPXA 2I2WA 2YC4C 4JXJA 1XMIA 2YFQA 3HCOA 4GPD1 4RSMA 1IPEA 1ZLYA 2KLBA 3IA2A 3A04A 4PRLA 5DWQA 1IOZA 1P0PA 2H63A 2PMEA 5BVGB 4IIBA 1Q7GA 1IUPA 2IPNA 1IN1A 4PG6A 1XN1A 4HMPA 4QIHA 3I09A 4C6RA 1Y63A 4OFXA 1A5TA 1JDJA 3IE0A 4MAFA 3MHPA 3U7EB 2H2GA 5FPKA 5FLYA 2HJGA 2P5SA 1ORWA 3X1DA 4EVIA 1XZLA 4H3KB 4U9HS 5BWLA 1GA1A 3DMFA 1J0DA 4QGGA 1JLRA 3WRXC 4GMDA 4B3IA 4D9CA 4LF8B 4IUBS 1YHYA 4KBFA 4RVHA 3DTVB 1ZMTA 1Z7BA 2BGNA 2YHUA 5T67A 3T1HB 4HKGA 4LHVA 1YUMA 1E9SA 3L0IB 5EIHA 4TV9F 2AG1A 2QRMA 1HYGA 2XA9A 1AHPA 1ZK2A 4JCCA 4OPMA 4W6QA 4M3NA 1CT9A 1T2EA 3E22B 3HSSA 3WJ1A 3ZCPA 5ICMA 4MVJD 1PWXA 1QGOA 3FFXA 3ZWOA 4DV5B 2F9MA 1GZ7A 4MR7B 4U2KA 4LNAA 4B3CA 4HNVA 5KU1A 3FNBA 1UK6A 1I1HA 5JC8A 1KXJA 1ULTA 2XVYA 5K0NA 1L3IA 3FI9A 3E8XA 2RKOA 4EB0A 1NR5A 2VBIA 4C0SA 5I9LA 2XZDA 4I19A 3LC7O 3MBIA 3W05A 3M1LA 5KX5A 3KOMA 4L9RA 3EPRA 4OU5A 5AOVA 4IH1A 3OE5A 1MIOB 4B0PA 4DQVA 2XNDD 4DCUA 1I4EB 2TS1A 1KSJA 3FYDA 3NDPA 1BA3A 1HF3A 2IBMA 2RC5A 4S04A 1GNRA 3NEAA 1S01A 4B76A 4EGSA 5FHRA 4M1EA 4DV3B 2LRHA 2RG1A 3OIGA 2ENUA 4ON9A 1JSXA 1E2EA 2XMPA 5CLGA 1IJKA 5EZQA 1YNSA 1VI6A 2OXEA 1H2ZA 2ZVPX 2D1YA 5MF6A 1G9TA 1RMQA 1E94E 1OXXK 3PNVA 3RG2A 1YF3A 2WPDA 1G8PA 2HXGA 2XYGA 4NQZA 4AMZA 4DZRA 1JQBA 3IV7A 1L4UA 3GO4A 3SQOA 1C1DA 1WXWA 4MWSA 4S1PA 2A0KA 5C7LO 1E9FA 1VJCA 3HDVA 4I55A 5H3CA 3NRJA 3M3PA 3D59A 3UB3A 1XQXA 3Q7QA 1UPBA 4KQ2A 4FS8A 2AXEA 3GVPA 5LA6B 5HA5A 1L4YA 1ZU4A 1TTTA 5CNKA 4W5QA 1SC9A 3L1KA 4WDRA 4CMBA 5A4MS 1X7XB 4CM8B 3OM0A 5ITWA 3STUA 5HW0A 4N5IX 3IKVA 2XZ0D 1ZMOA 4CIAA 4GDMA 4BRSA 3GMDA 1TK9A 4NHOA 5EJDA 1Y7HA 2EYQA 2O2YA 2BEWA 4Q1AA 4RKWA 3DD1A 1Y8AA 3LNTA 3GKLC 1ONSA 1DTSA 1VCOA 2Q41A 1NWCA 2WWFA 3NC0C 1Q22A 1RYZA 3HRIA 5ELLA 4DBLE 5CEJA 2JAXA 5C31A 4YRLA 1P77A 3QHAA 4JI7B 4MS4B 5F2NA 1Z56C 3KTDA 1AD2A 3QKIA 2APJA 3LT5A 1DKQA 1I3KA 1EQAA 3PXEA 1U7UA 1X7XA 4G81A 4CM8A 4WE3A 2IP4A 4CKBA 3AOEA 1MOPA 4TKLA 4UASA 1L4LA 2VDLB 5DW0A 2R9VA 5EMHA 2LPKA 5JC1A 4FR2A 1TKCA 3ZDYB 5FB3A 4UD2A 2YHSA 3CB4A 1F12A 3D2LA 5KYGA 1Z08A 821PA 5ER6A 4HVAA 3AHJA 3K2QA 3AEUA 4JLPA 1QGYA 2CC2A 3W04A 4EUSA 4PH1A 3REQA 4MYTA 1GZ6A 1N75A 1Z17A 2ZBEA 5H9WA 3QW2A 4LE0A 1QE3A 4WZBA 1KR2A 1YRAA 1UWKA 1NQAO 2RGUA 1NI4B 4Y2QA 4D3YA 3COZA 1FUUA 4NDNE 1PJBA 1MFZA 1S2MA 1UKCA 3P9PA 4XIGS 3ROPA 4CL3A 3G71P 2NSYA 2H06A 5GJWC 3DULA 5A02A 3IO5A 3KLNA 1AUXA 4P6VF 1HPLA 1MO2A 3EFEA 3KJXA 1USIA 3OLCX 1QZUA 4K1LA 2KWLA 3ISVA 3JQEA 1Y1SA 4HX5A 4ZAFA 3QWFA 2IV7A 3IP8A 2KG9A 2DQYA 3K72B 2OL4A 3VX4A 3T7TA 3WGNA 1S3IA 3GRYA 4ZQCB 3ETJA 1CWUA 1M34E 2DBRA 4IDNA 4QDKA 2NPFA 3FPCA 1AQLA 1PZMA 2BLLA 2YIJA 4DV2B 3V8RA 4ZQEA 2WMDA 2OD7A 1MB9A 2IGTA 3K1AB 4KZKA 1O94D 3OD5A 2AE2A 4O2RA 4J03A 2DWUA 4R84A 1SHJA 3SHVA 1HLFA 3HXLA 4C89A 4TM8A 5EQJB 1GFWA 3WX0A 1OYVA 2VH2A 1ULAA 2Z4SA 5HEKA 1XLVA 2G63A 4NY1A 3W6ZA 4Q03A 1IL0A 4OHBA 4PV7A 5F7XA 1I01A 4OH1A 4JYAB 3V80A 1EFKA 1D4FA 2NU7B 4GRAA 3AR7A 1ORRA 1VIAA 2HU7A 4XWTA 1R64A 5ED4A 1PQWA 3A1FA 2OCKA 3AG6A 1UC9A 2X2FA 4KB5A 3WS7A 1FYFA 1NVBA 2QRUA 3IRUA 2C4VA 3DE3X 2R5WA 4PNHA 3AESA 2JGKA 2X8BA 3QFFA 3S5UA 1F6BA 1TZKA 4FFLA 5JV5A 4IPTA 2POCA 4GXQA 4WKGA 5F9FA 4IIJF 5LKRA 2IK8A 4IDEA 1J0XO 2Z46A 4TSRA 4C0WA 1VE7A 1ONOA 4HYTA 4PGMA 4WV3A 4NV0A 3HVIA 3RJZA 2CJYA 3BA1A 4YP5A 4BNYA 4PHGA 3UJ3X 4BE9A 1OBVA 2HO5A 4PSAA 1AUPA 1QB8A 1HY8A 2L82A 4TVOA 1K8QA 5CA0A 3C2QA 3FZYA 2NU6A 3TZKA 3NR2A 3NAMA 2VTVA 2WUWE 1B76A 4JJAA 4OHRA 4AG3A 1JA9A 2A33A 3C3XA 3IPCA 4IMJB 1U8FO 2HUNA 4MMXB 2XWSA 5IEJA 1Q0HA 1WSDA 1ZVMA 1GT91 2WG1A 3C6QA 3ND9A 3O7WA 3OO1A 4J6EA 1RAFA 4MUYA 4PU0A 4XIFA 3V8MA 2EJBA 4E7OA 3P4UA 2CMKA 4BIMA 2PH3A 1J39A 2C82A 2QL7A 2FR0A 2ZBPA 4PINA 3EAGA 1PBNA 3CN9A 5CW1A 1KI6A 2OAQ1 4MYHA 4M1OA 4W5OA 5LYYA 4RTQA 4IXTA 3KOYA 1QTIA 3FUVA 4OUDB 1MAHA 3HV2A 3IUMA 3KQPA 3KUKA 2A9FA 4BQOA 5AXBA 2CLOB 3RU9A 1MENA 3W3AA 3WV5A 1H6BA 1UBKS 1HOXA 3W8EA 2PPLA 1PFWA 1XT6A 5SZKB 3ZBQA 3F49S 1N77A 1JIVA 1UT8A 4GHWA 1KH3A 1RXSA 1LNZA 3Q2KA 4ICIA 4COPA 2ZIXA 1LD3A 1X9HA 2BFDA 3DHWC 1G6HA 3E9QA 1NPTO 5DM70 1NVTA 3B1WA 1Z6AA 1JIKA 1V16B 3CCVP 5TS3A 1PFUA 2LUOA 4A26A 4EG4A 2QN6A 4AY2A 4WCFC 2VDVE 2QSZA 1WHSB 1J42A 2O8EB 1GQSA 1FU4A 2A59A 1FDSA 3IQWA 4PBRA 1I1NA 3HNRA 1DP4A 2Q1YA 3F4LA 1UMDB 3ILHA 4B4VA 4CMGA 3G0HA 5J2UB 1ODIA 2B8WA 2LZ0A 4YASA 5SZJA 3ER6A 4UPVA 5CJJA 2EJTA 4XEUA 2EX1A 1EDBA 2KHZA 3K8YA 3N75A 2BBSA 1XHLA 1BU5A 2P4EA 4ZAVA 3L8HA 3ADCA 5ER9A 2HL6A 1W76A 1QONA 2CMHA 3K70C 4URWR 1EFRD 2XOEA 1Y82A 4O4JB 3SX4A 5AM4A 4LNUB 1TO1E 5ICEA 1TW3A 1DHTA 5TF0A 4CEJB 1QX3A 2G67A 2RONA 2XITA 5E1MA 1FFGA 1L5YA 3GNLA 1CFJA 1NASA 2PL9A 3ELUA 4HOYA 5EJAA 3VKUA 4ER5A 2FPXA 3FM9A 3P0IA 4P86A 4KXXA 4OHMA 5AICA 1J90A 3OFND 1ZU5A 3J81k 2FWPA 1XMPA 2UYYA 3HYNA 4P0QB 3TZEA 1U7OA 4FJ2A 1R8SA 3A6DA 1N1DA 3B36A 3H7AA 3OQHA 1T9KA 3HYTA 1IIBA 1AXGA 4BNXA 4CETA 2G4CA 1E20A 3AHGA 4GBMA 4KN9S 4L75A 5DTEA 2FMIA 4F37A 4P32A 3URMA 2GBPA 3X1YA 1YHNA 2GN4A 3ZUGA 8AT1A 3O73A 4FGSA 1AX9A 3K0CA 2FPIB 3F9CA 4A27A 3C8HA 1H0SA 4FMCB 4GOKA 3RU3A 2WC1A 1M2JA 1PTJC 3MUOA 2QN9A 1Y4SA 1SPXA 3KPWA 4Y2HA 3RVBA 5JDIC 2FQQA 3ZE8A 2GPNA 3T3PB 1PCXA 1G20A 1G2OA 1LCIA 1YDHA 2FUEA 2P9YA 2ZJZA 3FWZA 4G0XA 4BB6A 1L5GB 3ITDA 3IJ5A 3JWHA 1L7MA 2KBEA 3OSZA 4HUQA 2WJ3A 4JJ8A 4D26A 3GPCA 5HHTA 4PSDA 3TJZA 4XB2A 5DLDA 2WINI 4LWOA 2DFNA 2P9QA 3IEUA 2IYEA 3F5MA 4RJJA 2VDQB 3DQZA 2QRVA 4Y2XA 3W34A 2AFHB 4LXIA 3A4MA 2BDTA 4GP9A 4KFCA 3PDHA 4EW6A 2VNSA 3MJRA 3GJ0A 3QMMA 4DHWA 3AZQA 4Z9FA 1ZD5A 1PQ4A 1SUBA 5E6UB 5ICFA 1KJNA 5IWAB 3KWJA 5EQFA 4UAVA 4K8OA 1FFSA 1P9OA 3FDIA 1E32A 1SXJD 5EIOA 3SXPA 3WLTA 1BYIA 4FFNA 3QX3A 4O6VA 4R2KA 4EI7A 5K3OA 3FMVA 1MJGA 1RWMA 2NV0A 3UVEA 1MZ8A 1I2MA 3R6DA 3M6VA 2BEKA 2HREA 1RPNA 2VA9A 5EMNA 5THXA 2JGDA 1NQXA 4BQRA 4MB0A 1FFXA 4HEJA 2V9CA 3H2KA 3R0ZA 4O29A 1TU4A 1TO2E 3RVDA 4DVGA 2ROQA 2VWPA 1YA8A 1Z38A 3NHMA 3JZDA 1LPNA 3ZDXB 2VN8A 3I1JA 1YJ9P 3F8TA 3MW8A 4Z0NA 3GCZA 3R9XB 4NMLA 4D82A 1G3IA 4JLSA 2XUFA 3AF2A 4E6PA 1BVHA 2AZDA 3LH5A 3ZDZB 4FZ5A 3VTKA 5ALIA 2B21A 4EYKA 3ERCA 3EMVA 2OM2A 5KREA 3VR5D 5EFZA 2QU8A 5CCBA 5FWAA 2W6ZA 4DMHA 1YZUA 3N0XA 4G1UC 2J9FB 2TYSB 4ZGWA 5IRCD 4MV6A 1W2HA 3TG8A 1EUDB 5BN5B 4PLFA 4ZT3A 5AUPB 5KPJA 1GPKA 1J8MF 4L4XA 4QT0A 3ZHXA 2A8YA 2VL7A 2EKPA 3E9EA 4E3WA 5H8WA 1VG8A 2VDPB 4ZYUA 4CPDA 2BWJA 2IHUA 5B7QA 4XIIA 3ZVMA 3F47A 4OYYA 5EJIA 1G8MA 3HY4A 2BFEA 4QGSA 1R0RE 5JYEA 4P2GA 4GKAA 1Z29A 1L4NA 2AMYA 4N3AA 4DQXA 2HF9A 3H9UA 4IX9A 4Q9KA 4XPIA 5EMMA 2Q4RA 1XZMA 3LT1A 3UF0A 1B16A 4NPHA 4AY4A 4OA5A 1RJFA 3EZFA 4R2JA 3UKDA 5KNLA 2YJ3A 3PXBA 4N12A 2GZIA 2OPHA 5L40A 2IYOA 4CT5A 4AJJA 4GI1A 5LU8A 1BO6A 1EUCA 2VF7A 3PWZA 3K4HA 4OBBA 2HMVA 3GDHA 4Z6KA 5I8PA 4OCZA 2XBLA 3DMTA 4HYEA 4W99A 3JQBA 4DE5A 1HZJA 4B4DA 3SZLA 5HKKA 5KWJA 1IC6A 1O0CA 5I7RA 3OJWA 2W7TA 1EWQA 1FR2A 5JSZB 4ENTA 4OXKA 5K8IA 1XJ0A 3A6ZA 1BOFA 1KJWA 1KY2A 3NZEA 4HDOB 1DKPA 4M46A 1BCSB 3ZLVA 4EOGA 3EDRA 3I2GA 4YH1A 3CYFA 2M32A 4D57A 5JWRA 2ERCA 1V41E 1R1DA 2EX0A 2ZR7A 4UEOA 1VQ9P 3S1LA 5IUNC 3ZKWA 5FUQA 1O03A 2OK8A 3N2KB 1BX0A 3AM5A 4IICA 2O59A 1X1EA 4IGAA 3GB9A 1VQKP 2J32A 4E2ZA 4C4OA 3E7WA 5T64A 4YECA 1L5MA 4MUGA 2VJAA 3L84A 1JAYA 2Z44A 2HPHA 2X3FA 2LVBA 1RFLA 1ZJYA 3C7TA 4JU9A 3QJYA 2ZAOA 3WK9A 3CLTD 2DECA 4P7KA 3JQGB 4LMBA 5K4HA 3JU3A 4NMXB 3CH6A 1UZAA 4TL6A 1F0YA 4OXRA 3GR6A 1KMCA 3R4CA 4E2YA 5H81A 4KREA 3SYLA 4EG3A 4ZPJA 2M8PA 3JALA 3SC2A 1T5TA 3E9RA 2PX2A 3K2EA 1KYYA 3IJPA 2ZCJA 2O3UA 5MN4A 3KSMA 4HGZA 3HUEA 4P5PA 1VB5A 3LPCA 4EJSC 1G4HA 1T0IA 2GCGA 2CG5B 2FN7A 5HIMA 1YJ8A 1M8KA 4KTVE 4AECA 1N9GA 3V46A 3WHPA 1I33A 1B8UA 3JYPA 1NHWA 4YRGA 1E0DA 5IC6A 3A58B 3HDGA 2EFHB 4QJ3A 3L7NA 1HE4A 1RLOA 3O2QB 3KX2A 5HGXA 5AXAA 1OMOA 1RXWA 2QD4A 5ILQA 1C9EA 3OLWA 3TXXA 3WA7A 2FVXA 1DMSA 2GAJA 3AY7A 2JFVA 3SZOA 5AH0A 5DIFA 4XJXA 1X7WA 3G29A 1Z0ZA 2CB0A 3PDWA 3SBDA 1W36D 5EN4A 1OH8A 1A4XA 5LN1A 3J7AC 2OCYC 3P9CA 5FT9A 4TLDA 3ZH9B 1R8YA 3EHEA 5FTNA 4BLOA 4RIIA 1MTOA 2IYYA 1P1KA 3EC7A 1QIHA 2ZRJA 4ZT7A 5H83A 2ZWPA 5CJ2A 4Z7JA 2RHLA 4B6OA 1L7DA 1EWVA 1PS0A 4RXUA 3OP4A 5MDHA 4YV7A 4OMUA 1Y5MA 1MX9A 3OZVA 3UHPA 3DR3A 3VC3A 2FMKA 3HB0A 1WZ2A 2BFEB 3OMXA 3JASA 4BATA 1FSZA 2ERYA 4YPFA 1HDYA 3GF4A 4HDMB 4ND8A 1I7QB 3PIIA 2LMLA 1CE8B 3LLSA 1JI3A 2D2EA 3BREA 2ONCA 2FRVA 2GF2A 3B5JA 3DYBA 1G9SA 3X1KA 1ZJWA 4PPYA 3CF2A 3HVKA 1GQFA 3TBFA 4KUEA 4G5RA 4INAA 2X2EA 1F17A 5ARCA 2AD5A 2IXDA 2CNRA 4HDNB 5COAA 4AX4A 5B3KA 1FEZA 2OO5C 3QF7A 3WAKA 1E2MA 3JARA 1JDZA 1VDZA 1QV7A 1VGVA 5CVUA 2ES4A 1O3YA 1AKNA 3B78A 4N76A 3C97A 3CRVA 2C7VA 4LFBB 1PV4A 2ODPA 4HN4B 5HCIA 5K8VA 4HPJB 4INJA 4JB3A 3A9CA 4YN3A 3QOYA 5B36A 1R10A 1CUSA 3DXYA 4QDXA 1AM4D 3CNHA 2FSIA 5IVIA 3MCTA 4GLOA 1N9GB 2ZWVA 1GYRA 4DWVA 4DSAA 1PG0A 3GLQA 2C03A 1PUXA 2ZKLA 3ZWKA 1MC1A 5ALZA 5I4IA 1M6NA 2XR1A 1QIGA 3H8JA 1M6WA 1VJ5A 4CODB 2V3CC 5FYDA 2VS1A 1OB5A 4LYHA 4CR6A 1Z73A 3HZHA 1VJGA 3B6KA 3NT2A 4C3VA 2Q5HA 2H2DA 5BRNA 1JNYA 3NHFA 1U0SY 3I6BA 1JSLA 1P4RA 4U6SA 4DPKA 4ZOLB 2AMFA 3DDNA 2BCJQ 3EW9A 3ZY4A 16PKA 2JHPA 2YBDA 2P69A 2AE1A 3DF7A 4NCIA 5KDLA 1SOWA 1GM5A 4ZQFA 4H17A 3U4CA 2ZJBA 3M4ZA 2G08A 2V4ZA 5DMHA 3TDNA 3Q3IA 1QRSA 2W2LD 1Q0SA 1WL8A 3HC7A 1SXJB 3F3MA 1ZL0A 4TVBA 4X1KB 3OVMA 5P21A 4AXBA 5ICCA 5LPNA 4ND5A 2DX7A 3OICA 4P7GA 3PXGA 1MT3A 1NBME 2JAQA 3QKTA 4DARA 1CRQA 1K5HA 3II6X 2E4WA 4TGLA 4MCIA 2I6SA 4FBMA 4YBZA 4CMCA 5JBNA 3NTEA 1L1RA 3K16A 1TF5A 1UKYA 3WYAA 2J3KA 2JDID 5DHRA 3RSHA 4CT4B 2O7QA 2QIOA 5KCZA 3T1TA 1P18A 5CPBA 4OREX 2B2CA 3O31A 1NQTA 5L3ZA 1FP1D 3OH8A 2OBXA 3LW8A 3W5IA 1PJZA 2WPTA 4QJIA 4WEOA 3BH0A 3R7LA 4P7BA 4D42A 2AFVA 5KO2A 1P5FA 2VQSA 4QUEA 1KHTA 2ID9A 1YITP 4XQ0A 5D84A 2R1ZA 2Z1DA 4Z86A 3RFCA 2Y1KA 2CLLB 4JEIA 3CY6A 4LOIA 1XFAA 4X00A 1DEHA 4JSTA 3DD5A 3U44A 5A62A 2AOTB 2WM9B 3DE0X 2P91A 3DNMA 2JZOA 3K30A 4IIXA 4KH0A 5G4KB 3WYEA 4EMBA 2BONA 2Q7OE 2PCJA 4NAVA 4E09A 1P81A 1RRVA 1SCKA 1I4DD 3D1JA 1C5KA 1OXBB 7REQB 4WLFA 5A7GA 4Q4HA 4BMSA 1XVUA 5HILA 4YMLA 1DV1A 3BAZA 3E3NA 5BRAA 2WIBA 2FQ1A 1UP6A 3EW7A 1TUEA 3Q0IA 1E7RA 1EMVA 1C4XA 1X3SA 2JGAA 2OSBA 2VJPA 3CNBA 2PEOA 1I0IA 2ETXA 1EJ2A 4YYZA 3MQ2A 1SOAA 2B4YA 4M8LA 3PE4A 4PO8A 1XPJA 4ZOEA 3H5IA 1QB7A 3GW8A 3ORHA 1KJIA 3G1WA 4QNMA 4DIKA 3L4JA 1MF7A 1U5CA 1F8FA 3JARB 4U9IS 4E51A 1JJ2O 2WWIA 3S29A 1IG3A 3KUXA 1K5PA 2CDCA 4GXTA 5DM1A 5ADHA 3PA6A 3TWOA 3SJBA 1EXDA 1QVZA 2POQX 1MTZA 4PSCA 3KJFA 3PQ4A 3E58A 4IWXA 5SZIA 4ZI3A 1PW5A 1Z4OA 1XDDA 2PJZA 4ND6A 5E9AA 2XTJA 2WKRA 4EYSA 4RULA 5FX2A 4L4YA 4P5DA 2W2PA 1GXSA 1RO2A 2O5RA 1Y3AA 2A0WA 2FW1A 3LXUX 5BYJA 4P38A 3U39A 4A8JC 3TUZC 2WKWA 3PHBE 2IELA 3D0KA 4EHBA 1BS9A 3EGVA 3OAAA 2PRYA 5AW8A 3QG5A 5I5EA 4D9EA 4HEA6 3D0OA 1DWUA 1X77A 4KE6A 4NZ9A 3AERB 1X7GA 3NGMA 4H1TA 4BQIA 2VDUE 1E3WA 1PR1A 1Y7LA 3GJYA 2VF5X 3KOZA 4D81A 1DAGA 1RYYA 4QVGA 1RRKA 2IW1A 1OWNA 3BG5A 2R6HA 4UUMA 4U7DA 1UNKA 4BTVA 4RX1A 1L5SA 2NW6A 3TBHA 2BUBA 4CDNA 3PD7A 1N5KA 5HK9A 2I6GA 1OIXA 1USUA 3LK7A 2ODAA 1KI3A 4ALJA 3BKXA 5JFTA 3CN7A 1XTTA 2FPOA 3NHBA 2OO5A 2W5UA 2YZ2A 2GYVA 1IY8A 4GXRA 4KIUA 2WJWA 3PZRA 4XDYA 4CYMA 3GPLA 1K8RA 1DOZA 1HNXB 4TWIA 4EECA 2Q7DA 1H8HD 3PG5A 3SHWA 1DUIA 2RBEA 3DZBA 3ND5A 2K0YA 1TCUA 1L1FA 3VOTA 4OK6A 4B73A 4MDEA 1QJCA 4O1HA 2ZSBA 3QE2A 4GPEA 4JQZA 4QICA 1C50A 1OIWA 1GARA 4G8JA 1JA1A 1N25A 2O3JA 2RGNC 3Q3HA 3PJRA 3FZQA 5FCDA 3O8BA 2JA1A 5TQJA 5GZ3A 4R1QA 3VR6D 4A6EA 1PNRA 1D6MA 4DKJA 3VHXA 2EDAA 1JEJA 3RDPA 1YK0A 3TGWA 1DADA 4MDHA 4KDEA 4W8GA 3MJDA 3UK7A 3EPKA 5TQ0B 1R74A 2FCAA 3HO8A 5HIIA 2FN4A 5IDQA 4UOEA 2QTFA 4X3PA 5JNWA 1IY0A 4LGVA 2GTIA 3DTTA 3SE7A 3PE3A 3LBAA 4QJBA 3UK0A 1X0XA 5A4KA 2GM4A 4F12A 2P3SA 4FEGA 3GH1A 5AKYA 3UY4A 3VM6A 1ZZEA 2X2BA 3OFVA 3QPVA 1TM7E 2Q27A 2K2WA 3JQ8B 4G41A 2P27A 4KACA 1Q50A 1RBQA 2XSZA 4WK2B 4E12A 1R6TA 2Q2OA 3VR3D 1RZRD 1QWSA 4RHUA 3G2PA 3IXMA 5BW5A 2AR7A 4HLUA 1V7CA 3VH4A 1QORA 1R4NB 1V5FA 2FPPA 2H1HA 2Q2NA 2WABA 3AY0A 3BGOS 2XB6A 4FHGA 4PG7A 4AJ1A 3N8NA 3SSNA 5FOQA 3HXQA 2HUPA 1TJPB 2Q3DA 2GPYA 5K8JB 4YRCA 3UJ7A 3TQSA 3AM1A 1K68A 4IWNA 4ZO4A 3DZFA 1NXQA 4FKZA 3MD9A 4K9NA 3S4YA 1E2JA 5IM4A 2W6CX 1RE1A 5CLLA 2HHAA 2O3QA 5EJGA 3ISJA 2QA5A 1L3BA 3KQTA 4L9SA 5IM4F 3MJSA 2OFFA 3QPWA 3UOAB 1RXUA 2BW0A 3H2JA 2VT6A 4RK6A 1XCMA 2D5LA 3VYRB 1F4PA 2WSYB 1I5RA 4FFVA 2AOWA 3S68A 4B34A 4MDFA 1ZCAA 1JAIA 1DWPA 1XF9A 3A1DA 3R75A 3V55A 3VI3B 3GLGE 2ZM5A 2ZRPA 4RPLA 4CF6A 1ZKMA 3ZEIA 3PHHA 1A2KC 2R1UA 4J4BA 3KL4A 4FFSA 3UJAA 4QOSA 3AY3A 4HDRB 4YWHA 5DBEX 5HGLA 2AK3A 4BQFA 4Z7QB 1UBCA 2IPOA 2QNIA 2E1RA 3P20A 2IDJA 4IV0A 4YQZA 2WICA 3LF1A 2CNWA 5EYPA 1GCIA 3EC1A 3D43A 1KYZA 1YMVA 3RF6A 4GUDA 4MVJI 3AL3A 2CLDX 2UUAB 4PLYA 3HEBA 2JKYA 4FSHA 4JLDA 3NHYA 4FW8A 5EMJA 1OLSA 3ID6C 1NLUA 4L15A 4W5JA 3WNDA 2OYRA 1XZGA 2OV2A 3CPJB 2GWHA 3IAUA 3KEGA 3GLKA 3UFXA 4NCBA 1GG2A 1T9GR 2J4DA 3LQ2A 4D8TA 3A4LA 5KYWB 4PHFA 4C06A 1KL7A 2Q1SA 2JZNA 3IIIA 4KXVA 9MHTA 4FHCA 1OE0A 2L9FA 5IW8A 4K88A 1W47A 1ECGA 1KJ8A 2FCRA 2WZBA 1L4EA 1LRKA 3FUXA 3MFYA 3X2FA 2P8JA 2FXIA 4C78A 1GKIA 2HRCA 4IFEA 4IEEA 3VNBA 4FC7A 3AF5A 4V39A 3UT5B 4EX6A 5ENDA 3CLVA 1YQUA 2PBLA 3LBIA 4ZO7A 2OZLA 4ARUA 4ZQIA 4CMIB 1DTWB 1LSJA 5JH7F 2Y05A 4PTYA 4OP1A 4E30A 2PMCA 1IRIA 3NVMB 4GLBA 4HAVA 3NXKA 4TL7A 1A9OA 2JKZA 3N2LA 3UMGA 3SXUB 1X70A 4RZUA 2VF4X 4BN0A 2DR3A 1T3ZA 1A82A 1EZZA 5FI5A 8ATCA 4UDXX 2FAXA 1MGPA 2PEZA 4DLVA 1ZQ9A 4A0SA 1T4DA 3IBFA 3R5FA 2GPBA 4IHJB 1ZN8A 1OJ7A 3I9KA 2GZRA 1MX3A 3B6IA 3V33A 4Z4IA 2YBEA 2V7BA 3C14C 3I34X 3IP1A 4NU0A 4RVOA 2CCKA 1DHRA 3EIHA 5UKDA 1Z74A 1Z6GA 2PX6A 3N1UA 4FD3A 3IEPA 4C1BA 4LZOA 2ZULA 5EJ4A 4WL0A 3CNOA 1M90Q 1OLOA 4F4FA 1JAXA 4X63A 3TF5A 1KIAA 3V8BA 3K1ZA 4XJTA 1QIDA 2FSVC 1XBTA 2UVQA 5CP8A 4BNLA 1BAJA 2XGGA 1Y98A 3HDQA 2ZJOA 5CGQB 1F51E 3EB9A 1A76A 3O7MA 2IYFA 2FPKA 1M7GA 2Z98A 4UM8B 3KKLA 1VHTA 1MXHA 2FPUA 5HIJA 2DSTA 1SXJE 3DOCA 4RTKA 4NEHB 2Z6QA 1I7LA 2CWDA 5BN5A 1SHLA 3HXKA 4MYDA 3SJAA 3FHLA 2Y77A 2NVBA 2IY8A 1FDTA 2XZTA 3QE3A 3OZ7A 1Y3CE 2M9MA 2OZPA 3IT2A 3CS3A 4LFAB 3RU2A 2H5LA 3H2YA 3ZZNA 3PNBA 4OLBA 2NP7A 1OYOA 4C76A 4RDXA 1C3LA 1YHQP 1QH8A 2NM0A 2Z95A 4L4RA 3JY6A 4RHCA 2C31A 1F8UA 4REMA 5ALOA 3THRA 3DOFA 4CFZA 1QX4A 5B3LA 1CUDA 5F3WB 3LWNA 4ZRMA 3T54A 1JR6A 1Z7WA 2QN3A 2ZRNA 5FI1B 1E5VA 3W9YA 4J6FA 2O7RA 2UZAA 2HA6A 3VBEA 3DEIA 5ULLA 4JVOA 2ZDQA 4IW3B 4M0PA 1UKAA 1QFZA 1FFXB 1U2GC 1RMTA 1YCHA 2H2HA 3G1TA 1AKEA 5AHXA 5I7FA 1A69A 3Q6IA 3LPAA 4R1LA 4ZU1X 3IBTA 3IP6A 3DCJA 3MTGA 3C4JA 3UUWA 2WHXA 2HWWA 2YV2A 1XDSA 1RC0A 1YQDA 2H52A 4KSBA 1RLIA 3CNEA 3DUFB 2BFOA 2ZI9A 1NM5A 3EVZA 3W6NA 3DAYA 4R1MA 1OZAA 5JDIA 3ER8A 1CDEA 4L6IA 3O93A 3OE1A 4LY0A 1HFWA 4I1PA 4QQKA 4G1CA 3BF7A 3OC6A 1X8LA 4C4XA 1V8BA 1WP9A 4F5WA 2PGIA 1APBA 2DC1A 2JCVA 2X2OA 2BTQA 1TJ3A 3RTAA 1HDZA 2DHDA 1L4MA 1SCDA 4Y7CA 2GFQA 2F67A 1Z6QA 5JSQA 4WZBE 1P74A 2GK6A 2GNPA 4XVQA 1M1YA 5JAPA 1JEYB 3T41A 2HDNB 3IDSA 3N2EA 5H3LA 1SRRA 2CXQA 3H1BA 4WKOA 4M98A 5IARA 1BXRB 3CUEF 3IVXA 3SVLA 2BFFB 2XVXA 2B8EA 3CVJA 3DBIA 3KQQA 3M49A 1VKZA 3MQ4A 2W2MA 3E3OA 4MS1A 1U5AA 3L7LA 2B8JA 1WF6A 4OLFA 4L3VA 4R1TA 5DYYA 3S2GA 4YCCA 2B4QA 4EJ0A 3A2KA 5K8UA 1DJLA 5A7FA 3V4PB 4G5GA 3IE1A 1NYLA 5LMUB 1P7CA 1RWPA 5JXIA 3RAPR 2G77B 3PWSA 4Q1DA 1F0NA 4JBXA 1M6EX 4L16A 1NBMA 2W58A 5AVZA 3A6JA 2QPOA 3BWMA 2DWCA 1ANKA 3KYCB 1U2DC 4LHSA 4RZ2A 2RGCA 3O4JA 1TM3E 3BRWD 3KLBA 1QU3A 3HRHA 3RG6C 3M83A 5JG7A 1GNVA 3MWJA 5K0CA 3EVDA 2I65A 2EZ9A 2E85A 2BHTA 2HCJB 2ZUCA 1PJQA 5JJLA 1P72A 1VMEA 3AIOA 2X3UA 5MGNA 1FSFA 1HDIA 3HDHA 4YBRA 2ZSUA 5FEUA 4YQFA 2AQ8A 5ALWA 5C35A 3ZIDA 2LGJA 3BTVA 3M5WA 1P5JA 3HJNA 1J49A 4BFSA 2ZUDA 2QBYB 4ZT4A 2MSWA 4HS9A 3DUFA 4D9HA 5FL7D 3E1GA 3K96A 4V38A 4QELA 4XWAA 2IYQA 4E5MA 1RDFA 2IHKA 4OHWA 4DNPA 2PT9A 3TR0A 3O8RA 2FSVA 2QR5A 1VYTA 2GGSA 3DOIA 4F7DA 4O33A 3MSCA 1DO8A 1IUNA 1LQUA 2GD1O 1WG8A 1GGEA 2OV1A 2PH1A 4K3VA 3R5SA 5AVYA 4Z51A 6GPBA 2J6BA 2GCPA 5K0SA 1KMNA 3EQ7A 3TE7A 1RXYA 3V5NA 4BO3A 3PPVA 3UAWA 4D41A 3CRRA 4LF5B 1VIVA 1UMKA 2ZXFA 2EQAA 4J16C 4ZVVA 4AJPA 2G83A 2WQ7A 2LOLA 4GFDA 1TZBA 4LHZA 4WZAE 2CZQA 5DN6D 4RFVA 5JZBA 4DV7B 1I7DA 3ZDQA 2WHPA 2X77A 2XF8A 1JRLA 3LWBA 1FDWA 5E7MA 2GN8A 2QSYA 3RFVA 3PR2B 4BRUA 3U09A 4CEIB 3PBKA 4QU9A 1PJSA 3TKLA 3UT5A 2FEWB 3K9LA 4MPTA 3WIBA 2XMSA 2J4FA 3C1OA 3EVNA 5C8YB 2I2DA 1E9DA 1QO0A 3NHJA 2W2NA 1REQA 2BF4A 2O06A 5CLHA 2QX9A 4F72A 2PE5A 2FKAA 1DT5A 3RHTA 2WB2A 3OX1A 2GBGA 4D4LA 1ZGZA 3BRCA 4MOWA 1AKUA 1Z5VA 3T34A 4DUZB 3VRHA 2P0AA 4HGYA 3UFXB 1T4BA 3BB1A 4NXMB 2BP7B 1TYDE 1MXFA 1ADFA 3M6FA 1H5QA 3E2PA 1PJ3A 3FH0A 3CXRA 4PFKA 2JCSA 2WTXA 3ZHQA 1N33B 1VLLA 4FCWA 3IX7A 1T26A 1T1RA 9GPBA 1DG1G 1JHQA 1L5OA 1PZHA 4PPQA 1QPBA 4V0ME 1W5AA 2J6CA 3MGCA 3VKGA 1R4ZA 3P0FA 5F23A 3RIYA 3S2ZA 1RU3A 3GLHE 1C9NA 3PNLA 4Q4LA 4EFMA 4DV6B 3E0QA 4PS0A 1QM5A 4WZAB 2OPBA 1IJBA 5C34B 3M34A 1UJ5A 5B5SA 4JITA 5T57A 1M75A 4WLVA 2ZYHA 3FROA 3AUJB 3UHAA 4IPYA 1EUDA 1IUKA 2ILTA 3ZHYA 1U9YA 1WW3A 3ILYA 4DQLA 3R6TA 3RV4A 4REQA 4Q9LA 2QEQA 1DSSG 1XZHA 1LKZA 3KQLA 4WXMA 2CHQA 1KHHA 4XQCA 3L8YA 1NVVR 1XTSA 2V6JA 3TCKA 4WY2A 3RRMA 4CVNA 1RM3A 4Y2GA 2ONKA 5G0VA 1JQKA 2J8ZA 1VLJA 1JB9A 4NDZA 1A9ZA 4JZYA 4CFYA 2OWEA 7ABPA 2PR2A 3RRZA 3ORQA 3WK4A 2MR5A 1T8TA 3FPLA 5A3RA 5IF3A 5LP6A 3K1TA 2V54A 4TSFA 1ENYA 3I6QA 3VUFA 3ZXYA 3EIOA 1UAYA 3HBJA 1Z6TA 3KPUA 3KVOA 3ORFA 1U1GA 3E9MA 2N0SA 1EBUA 1PF7E 3B7PA 5EOVA 3U49A 4YAWA 2O1WA 2F59A 1MQ8B 2IYTA 4YJHA 5F33A 3REOA 4E1AA 2Q62A 3IEVA 4RV5A 2AQHA 2JFZA 4K6HA 3VC1A 4P98A 4UC0A 3KP1A 3QJ5A 2RMKA 2C5LA 1E9EA 1U0HC 4UUBA 3SF0A 3SHQA 4L6AA 2JLRA 5LA6A 5BR4A 5B3JA 2I1WA 2DKNA 2IY7A 1ZOPA 1EKXA 1HSOA 3H2BA 2EC5A 1QHFA 5JECA 5KC8A 1MVLA 2MJLA 3ZWQA 1T34A 1GV1A 3B52X 2DUUA 3WFIA 3ZWYA 3OM8A 2FA9A 2QSJA 2H0AA 1VHJA 2O2GA 4P36A 4YRAA 3D7RA 4M1YA 1YUBA 4ARZA 2B7BA 2R86A 4FT4A 5H16A 5LNK1 3HZQA 2QLLA 1EK6A 2NIPA 2XIQA 3C6KA 4X92A 5ESRA 4HN9A 3AV3A 3PLNA 4GT1A 3FNFA 4QDTA 1GGJA 4KLRA 3DKVA 1T24A 1YO6A 4M1WA 1TADA 1Y3IA 3UHFA 2XBMA 1Y9DA 5FBKA 4F4UA 2XXAA 3P2MA 4MYRA 4OI1A 4HQ6A 2C2MA 3LAWA 4FFRA 4PG8A 4CF7A 3KJZA 2VRBA 4R5HA 1JIXA 2ATVA 2GH1A 3OLXA 5H59A 4BLPA 3NONA 2WYHA 2ZEJA 3RS7A 2B94A 2VWQA 3JALB 3SC2B 1L8OA 1XYGA 1B3BA 1YVRA 2B36A 2V45A 3DDCA 2VP4A 4Q37A 5CX1B 4LY9A 5HX7A 4J3NA 4DKXA 2DM6A 1EG7A 2C8KA 2IYAA 2ZRHA 3KSRA 4HQNA 5C81A 2YVKA 1G19A 1W94A 3F5FA 5REQB 3Q0TA 1OI3A 1LC3A 2GARA 2O05A 4EW1A 3ER9A 4MR7A 1I80A 2V8BA 2VXBA 4PHHA 2M1ZA 2CLEB 4WY8A 3K0SA 1UPXA 1J0AA 2X1MA 3CHYA 4LX8A 3DEZA 1F7UA 1A9XB 2IU4A 2XOXA 4PM4A 2DYKA 2IEYA 2FV8A 1EINA 3G7NA 3WZLA 3O2JA 2ARKA 3TB4A 5KTRA 5F73A 2FK8A 1LX7A 2YYZA 2F64A 1X39A 3QVWA 4KKVA 3EGXB 1HDGO 3QENA 4BLWA 1J8DA 1J8VA 1W0CA 1VLHA 5CVCA 1IMOA 3SYRA 1IZ8A 1XZIA 3TSCA 3E03A 3GJ7A 1SHTX 3K5IA 4XRGA 5L3QA 2VQFB 2YJ5A 1DKOA 2COKA 3MLEA 4LDPA 4IS3A 4DBLC 5TLSA 5BS2A 3HWX1 2O2JA 4Q1EA 1GU1A 1I3OA 3FRHA 3HA5A 4YJFB 2D1TA 2JGLA 5DB4A 1E0AA 1QRDA 4CIBA 5AVSA 2IZ5A 2K87A 4NCNA 1YMUA 2NZ2A 3C7CB 4YJGB 2OAEA 4NAUA 5JRZA 1ABBA 2VP3A 1ZUHA 1KYVA 1XYVA 1QDUA 4H2YC 4MUIA 1XEXA 3D8BA 2I80A 4JR2A 1MMFB 3GEDA 3ZD9A 3ZD8A 4UJ5A 3DBHB 1WZCA 3HY3A 5FQOA 5B30A 2HTEA 4PG5A 2W70A 3RTGA 2UYHA 2F1OA 2EWVA 2X2PA 2DQKA 2YZKA 4YMTA 3ZW7A 4QXPA 4M76B 2ZT7A 5HFAA 2HMSA 2QVCA 4JYPA 3AVPA 2XUQA 4UU8A 4DANA 3DWEX 4ASUD 3FRJA 1JEQA 4TUYB 5KCMA 3ROMA 3LMKA 4URHA 1YB7A 1ORTA 1PR0A 1K4MA 3KPJA 4HRAA 4UTOA 3ZTYA 4YUWA 4W5TA 3ZJVA 2DUNA 4Y6RA 2ZTUA 2PH7A 4D02A 2CFOA 4EMSA 1ZIDA 3C45A 2O8FA 4GM1A 3Q1KA 1FIUA 1QE5A 2HADA 3ILVA 5K3SA 2JBAA 1QG4A 4BZZA 5HPYB 4JVSB 5E2AA 4QUKA 1NT4A 1XAHA 3IYLW 2H1RA 2G5CA 4W1PA 5F9MA 3SQMA 1FOEB 3VYUB 3DYVA 4W6ZA 3T52A 4Q3BA 1A9TA 3CO0S 1CQJA 4GR5A 5AK6A 4PNEA 5CXUA 1OCEA 2LNDA 4OBEA 1WZIA 1SR8A 2KJQA 2JIDA 3DVSX 3QEMA 2QD5A 4BV8A 4UOZA 4TTSA 2G8NA 2VFAA 4WK6A 3X1ZA 3W9SA 2JK0A 4BJ6A 1F4LA 4Q7EA 2CMFA 3PDCA 1EIAA 3HM2A 1ZIYA 2EBHX 3PRJA 3C3JA 2PX4A 3H9EO 1B0PA 4CFSA 4A2WA 2IH4A 3NM5A 1YJWP 2D7DA 2XRMA 4RKYA 5K8CA 3OEEA 4AO8A 4F5DA 4ZEMA 4OOEA 1AURA 3LYAA 1JIJA 2VPQA 1E1RA 4HEHA 5EEGA 5BPHA 1ZIPA 2ASEA 1P4GA 3KSZO 4L8LA 4FFBA 3TTUA 2WTMA 1J5EB 3B12A 3PX2A 1QQAA 1RJDA 1HMPA 1U4OA 3IHLA 3MTBA 4CQLA 2MVUA 1SKMA 2VDMB 1RHMA 3CCEP 3V1KA 2X4GA 3DV0A 3VR4H 2ECOA 3QVGA 5K6AA 4EDHA 1Z13A 4CL2A 2PXHA 1OAAA 1W8DA 1QVAA 1ZJZA 4EVQA 1CR1A 1BDMA 3LDHA 3MCVA 4Y6PA 1W0JA 4QBTA 13PKA 3S1SA 1OH7A 5F4ZA 5FBWB 1K9MQ 3DL2A 3LUKA 2RH8A 2R47A 4IFBA 5DM4A 5IUJC 3OT1A 3AM3A 2HPVA 4WDQA 3S28A 2Z2XA 4INZA 3SHTA 3ZEAA 1MQ9A 3ZXUB 5BWMA 3BGWA 3M81A 4Y2TA 3I6MA 3PVZA 3RRFA 1EGVB 4RLSA 2X19A 4B8WA 3ZHOA 2Y6UA 2MMCA 3B7WA 1QUFA 4LECA 1B8NA 1LK5A 1T8WA 2YWFA 2HK7A 3I4FA 4Q3EA 3T7JA 2IDMA 4CN8A 2JLWA 4P2BA 5JJKA 5HGOA 1Q1BA 5I7VA 4ZIRA 1IXKA 1DUVG 1U9IA 1R50A 3ICPA 2OCAA 3NRCA 1EFPA 3DFIA 4IBOA 4XCQA 4XOIA 3TK1A 3IIKA 1BXGB 3AP2A 1I9GA 3TQOA 1MV8A 5C5DA 3K53A 1JB1A 4KI7A 1UEJA 2VPIA 4GBJA 4DQUA 3GT0A 5ITVA 3UMMA 2H11A 1CK4A 4HLCA 4ACAA 2ZYAA 3VNQA 4FHDA 5IVHA 3NTRA 3EH2A 2GN1A 2NLOA 3EEFA 5FJJA 1P2FA 1TTPB 2ECFA 4G9BA 4KWTA 4DUYB 5JVDA 5KC9A 4YROA 1SVMA 2ZPUA 3F8WA 2PA0A 4R8SA 1P9WA 1W96A 1BQ3A 3W5AA 4MJ7A 1KRWA 1AO3A 1AQNA 1I6WA 4I4LA 1M1NA 3SVZA 3W1EA 4E2FA 3KQHA 1H66A 4MPPA 4FNMA 4D9NA 4C2UA 1HQDA 2ZR9A 5FWYA 1DKMA 1II8A 2QV7A 3IERA 1RC8A 3AX6A 1D03A 3C3DA 4KQGA 4FOOA 3RS5A 3KR0A 1Z22A 3CPHA 1WDTA 3MT8A 1H2EA 3G2JA 2NG1A 2ZXUA 5CT6A 1X7DA 2W2XA 1IN6A 1VE9A 3CMCO 4UAGA 3S2EA 2ZYDA 1YI2P 4MEJA 3JWEA 2HY7A 1TFUA 1C3EA 3MMNA 4IFIA 5GAJA 2EIHA 1J2EA 4YYEA 3L1VA 4NU8X 3EYWA 2X8JB 1E4EB 1SXIA 2ZUWA 3LJKA 3EEBA 4HQ0A 4XUGB 3JZAA 4BNTA 2EG9A 1SIOA 2P77A 4UUNA 1N2SA 4QPJC 4RE5A 2CDAA 5BN1A 1L2TA 1Z16A 1ZJ6A 3RYCA 1XN4A 1KJQA 3B4QA 1TIKA 3ENNA 2G1JA 4PFQA 1E1LA 5T5QA 3GQBA 4L51A 4CKBB 1CP2A 1GPJA 1ES9A 2AF3C 2J1LA 4ZAXA 5FI3A 1OFTA 1RPAA 3C8UA 1E7WA 5SZHB 3HNPA 1W44A 3P94A 4EF5A 4URXR 4BKPA 3OIFA 3PWTA 1FP2A 2KGDA 2BYTA 5KVAA 2ISCA 1PX0A 4PLWA 3PXXA 2QBYA 1LS1A 4O3MA 5BNIA 4PWVB 1Z0FA 4KPGA 4TQGA 4FSDA 2QY9A 2SICE 4TWAA 1PVVA 3BK7A 3H19A 4GS5A 1YR8A 4F38A 4YRQA 2C04A 5E4JA 1CFZA 2BGUA 2F1KA 4K6GA 1KETA 3VTFA 5C5CA 2KW2A 2PGJA 4DCCA 4DIMA 1MDFA 1UOQA 4WFQA 2ZBGA 1ULSA 3KKNA 4L8GA 1PQUA 2O0JA 2ZQZA 3D6UA 2NX2A 2PH5A 1CR6A 2XQVA 3GRPA 4I5GA 5BQPA 1T6XA 3AILA 4JXKA 1P4AA 3PS9A 3K6SB 1H85A 1BWSA 1GKYA 1B74A 6PFKA 4BWFB 4RTJA 4F3TA 2GEKA 2EZTA 2O3RA 4NOLA 4HRYA 1QCCA 3K94A 1PLLA 2FPRA 3LBNA 1ISPA 2P6PA 2Q2VA 1W4RA 2D5AA 1RC1A 2ACEA 2QJRA 2PVSA 3RPEA 5BV1A 1L1EA 2EAUA 4Y2SA 5IHPA 1VA4A 4OX9Y 2WZQA 2NGRA 2AS0A 2Q8NA 4R40A 2GAOA 4NZZA 1B2LA 5A0VA 4EG5A 3Q7PA 1E7QA 4UEKA 5D7BA 2JAOA 4CMAA 3ESBA 1IXSB 2B6HA 4PN7A 3ZKWB 2QYOA 5LOVF 3L18A 1GKUB 1QG6A 2PN1A 3GIWA 3JD3A 5FWXA 3IUYA 5KYUA 3TPFA 4B2YA 2P40A 3E5HA 2JAZA 2TRSB 2XTNA 1PT5A 2ZSHA 3ENVA 3W78A 4BKQA 4XE5A 2WTUA 2Z3ZA 3CLUD 3GRCA 1EK1A 2BTQB 3IOMA 2A5DA 4URVR 4K2AA 4BNVA 5FWNA 3PDIB 1P5ZB 3HSKA 1VKOA 1GSHA 1C1XA 3I0MA 3F5QA 4U0FA 4DXDA 5I7EA 1J56A 2Y71A 1Q74A 2UZ1B 1SU4A 4X20B 4MRMA 1VIMA 1WBJB 1YWGO 2X1LA 4LGMA 4TTQA 3VZPA 4DDTA 2B3TA 3QSYA 3A1UA 4L78A 5AJXA 4E5UA 3FTEA 2HHHB 3P32A 1GPBA 1JMVA 2UUOA 4TT3D 5AKHA 2FRDA 2Q6KA 5DX0A 1G38A 2P4UA 2WWRA 4Q7QA 4H2WC 1XZNA 2C2OA 3QI2A 4KTTE 3DT8A 3UJ9A 1E0JA 1SG9A 4IGKA 2FPLA 5D1NA 3U3OA 1ESMA 1I6KA 2AN5A 1BEZA 1IG0A 5D3MA 2CHEA 4HEA1 4J29A 4I55F 1ZY2A 1VYUA 1FPQA 1XA3A 2Q8PA 3S40A 3FXAA 1NDQA 1VCHA 1XFDA 2A78A 2J67A 5JZVA 4MUFA 4BX0A 3EPPA 4NCKA 2QL6A 4V0RA 5BW4A 5J1SB 2C7QA 5A5EA 1YJXA 2XCUA 4I4CA 2VNHA 1A9YA 4FXPA 5BN4B 2OUIA 1PL8A 2C5BA 1CJSA 1RWWA 2Z8XA 2G6BA 3HCDA 5HKOA 3QBTA 4LMRA 3ECAA 4EPTA 4F21A 1VQ4P 2W83A 2PKXA 3CT4A 3KELA 3NNSA 4EF4A