2EG5A

The structure of xanthosine methyltransferase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
354
structure length
344
Chain Sequence
GDTSYAKNSAYNQLVLAKVKPVLEQCVRELLRANLPNINKCIKVADLGCASGPNTLLTVRDIVQSIDKVGQLERPTIQIFLNDLFPNDFNSVFKLLPSFYRKLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLQWLSQVPSGLVTELIGTNKGSIYSSKASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCICKGVELDARNAIDLLEMAINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCIVEEEGSFEILYLETFKVLYDAGFSHIKAEYVASSVRAVYEPILASHFGEAIIPDIFHRFAKHAAKVLPLGKGFYNNLIISLAKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of two N-methyltransferases from the caffeine biosynthetic pathway
pubmed doi rcsb
source organism Coffea canephora
molecule tags Transferase
molecule keywords Xanthosine methyltransferase
total genus 120
structure length 344
sequence length 354
chains with identical sequence C, E, G
ec nomenclature ec 2.1.1.158: 7-methylxanthosine synthase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03492 Methyltransf_7 SAM dependent carboxyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.270 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2eg5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2eg5A02
4E2YA 5DX8A 2ZIGA 4KW7A 5M5BA 1L3IA 3Q7EA 3CGGA 3GRZA 3FRHA 4MTLA 3FRIA 3KKZA 3P8ZA 1EAMA 1RI4A 3HCFA 2G8NA 3NMUF 1DL5A 4GUAA 4RVFA 5K03A 2UYHA 3DLCA 3MTEA 4FR0A 2QYOA 2BM9A 5GM1A 3REOA 3PLAE 1XXLA 1WXWA 4NECA 3LSTA 1P91A 1P1CA 2YUIA 3ELYA 4IV8A 4GC5A 2P40A 5K8VA 4OBXA 4HG2A 1MJFA 4P7KA 3CVOA 1EJ0A 3C0KA 4OQEA 5BW4A 1SQFA 2FRXA 3EVBA 5CVEA 5JR3A 2ZLBA 3P2KA 4FP9A 5HZMA 4RVDA 3A27A 5DX1A 3HCBA 4LG1A 2ONYA 5ICFA 3EVZA 5F2OA 3TM5A 2ZIEA 4FS8A 3HCEA 2QRVB 2ZTHA 2V7EA 3I53A 3OCJA 3MGGA 3G5TA 3L8DA 2AOWA 3GRVA 3LPMA 3M4XA 3AXTA 4X61A 5FADA 3SSMA 4QTTB 1X1AA 4OA5A 5CVVA 4R8RA 2OPBA 3FYCA 3LBFA 5CD1A 2IFTA 2YR0A 2GPYA 3GXOA 3PB3A 1YZHA 3AJDA 4M37A 3T7RA 1KHHA 1BC5A 3DLIA 1Y8CA 5MHTA 1X1BA 2O07A 2VP3A 1ORIA 2AN3A 5DWQA 4C4AA 4BP3A 3R0QA 1KPIA 4PYKA 5DPMA 1EJ6A 2JG3A 2FK8A 4P7FA 2KW5A 4HSGA 4C04A 5D1HA 2AOXA 5FHQA 2AOVA 2C7PA 2P3LA 1JQEA 4QDKA 4P7GA 2WA2A 3BZBA 4R6WA 4RVGA 1YB2A 4ER6A 3SM3A 2ZFUA 3TKAA 2H00A 3OZRA 4V0RA 3RODA 3KHKA 3B3GA 2BR3A 4IWNA 3T7SA 3EGIA 2ZZMA 2BZGA 3LKZA 3OU2A 3GRYA 3EVCA 3K6RA 2GH1A 3FPHA 3SR4A 5IKMA 3EMDA 3QOXA 3T0IA 2HMYB 1VL5A 2PWPA 3DXZA 1NW6A 2G70A 4Y30A 1OR8A 2JHCA 3ELDA 2CWWA 3LDUA 5K0GA 3UBTA 2AOTA 1G55A 2FCAA 1KR5A 3LCCA 3UJ6A 4E31A 3UJDA 3A7DA 1NT2A 3BKWA 4RTMA 4KIGA 5K0JA 5EMKA 3EGEA 3KQSA 3GIWA 2P41A 5EOVA 2IBTA 3FPFA 3I9FA 4L7VA 3EVFA 3FTEA 4R05A 3BUSA 5FA5A 3KQOA 3PS9A 1H1DA 3HVHA 5EQJB 3S68A 1O54A 2ZSUA 2YXDA 3C3PA 4P58A 3NWEA 1WS6A 2P7IA 3SVZA 3UJBA 3EVEA 1G8SA 2OBFA 1G60A 5D1NA 3NW9A 1JSZA 1SVUA 3CCFA 5E9JA 1L9KA 1WZNA 3GWZA 2NP7A 4BLUA 3OFKA 1WY7A 2QY6A 1VP3A 5T6BA 5KS2A 5F2NA 1L3CA 3EMBA 4X63A 5DXJA 1YFLA 3PTAA 2IH2A 1HNNA 5KVAA 5DTQA 1NW3A 4KDRA 4MHTA 5DM4A 3A7EA 1SUSA 2JHAA 5K0FA 3C6MA 1FP2A 1RI5A 3KU1A 2BH2A 5E8RA 1JQDA 3C3YA 4FT2A 2EFJA 3CJTA 2PXCA 3OU7A 4U7TB 4RTQA 2AN4A 3TPZA 3SGLA 5LQNA 3ORHA 3RIEA 3TM4A 3TRKA 4AZSA 4DF3A 2PT6A 5HEKA 4C06A 2ERCA 4PIPA 5DRYA 3D2LA 1F38A 2PJDA 2CMGA 4GOLD 1FPQA 3GU3A 3B5IA 3HEMA 3KPWA 1NBIA 5IH3A 3LDFA 3KPVA 4R8SA 5HFJA 4M36A 1TW2A 2EX4A 3KQPA 4PYMA 3UJ8A 3OPNA 3KPUA 4KIFA 1YF3A 5GP1A 1VPTA 2P3OA 4EKGA 1RI1A 3OZTA 5CCBA 2P3QA 3E23A 2ZBRA 4DKJA 1FP1D 2UYCA 2IDKA 1L1EA 2OZVA 5LQAA 4X41A 1ZGAA 2EG5A 2FYTA 2ZWAA 1SG9A 2PY6A 2HWKA 3GCZA 3JWJA 3BGVA 3LX6A 3DXXA 2K4MA 3P9NA 5EEGA 1NW8A 3LHDA 3UJ7A 1RJEA 3DMHA 2P8JA 1R6AA 3BT7A 3NVMB 5E1OA 3ID6C 4XUCA 5KYGA 5U4XA 3GO4A 1NW5A 5DXAA 3T7TA 3KPJA 1O9GA 4F84A 3KQYA 1VIDA 3PFHA 1M6EX 3MHTA 3CBGA 5C1IA 4GOOD 1SQGA 3SX0A 4WVLA 4YUZA 8MHTA 2Q41A 2FPOA 3P2IA 5CUQA 3HCAA 1TW3A 5EKXA 5FWAA 4E33A 5GWXA 5KQSA 2CKDA 3NDJA 1IXKA 2I9KA 5CIYA 4PINA 2P1DA 3M70A 1P1BA 4POOA 4EK9A 4YUWA 3KR0A 3OE5A 4AUKA 3GNLA 5H02A 4QDJA 4YUYA 1JG4A 5P8WA 4KWCA 5LQKA 2R3SA 5EZQA 1T43A 3Q87B 4PONA 1INLA 3TFWA 3BWYA 4HRAA 1Q0TA 5ICCA 3E8SA 5E8JA 3HVJA 4C08A 2PX2A 4QQNA 2NNWB 10MHA 1KXZA 4EMSA 3A4TA 1ZG3A 3CJQA 5HIKA 1XDUA 4LECA 2EJUA 2YX1A 3SSOA 3TKYA 4CKEA 4DZRA 4GOND 3I64A 3EEOA 2I6GA 1QANA 2IGTA 4PYLA 4YMHA 4DA4A 3KQTA 1QAMA 5FHRA 2YTZA 3ELWA 4HTFB 4YUVA 5FULA 3NTVA 3EPPA 3FTCA 3M6XA 5DX0A 5EEHA 2OO3A 3BWMA 1WG8A 1D2HA 1U2ZA 1NV9A 4OA8A 2B3TA 4DMGA 4ER5A 1QZZA 2Z6UA 2G72A 4GQBA 3FTDA 2HR1A 5FCDA 5K05A 5K0LA 4MWZA 1SUIA 4PCAA 5T67A 1F3LA 4YMGA 2YXLA 2I7CA 1B42A 4PYJA 2PVCA 3TQSA 3SMQA 3BWCA 1JSXA 2JJQA 3DXYA 3G2OA 2PLWA 4HH4A 4QPNA 4YV2A 5CM2Z 2VDUE 3TOSA 5ERGB 1R00A 3M6UA 2IH4A 2AVDA 4C07A 2ZW9A 1L3BA 3DMGA 3IEIA 2ZIFA 2ADMA 3OFJA 1PJZA 5DRTA 4GBED 1QYRA 2XBMA 2HTEA 1R74A 1Z3CA 2YQZA 2QE6A 3KPYA 3P2EA 4GF5A 4XCXA 2GAFA 3SXJA 2ZBQA 2PXXA 3OU6A 3GJYA 5G02A 3KQWA 4F86A 3HVIA 3R6TA 3AWIA 3EVGA 3OZSA 3C6KA 2YXEA 3LCVB 3NWBA 4M38A 2UYQA 2IP2A 4Y2HA 5EG5A 3HCCA 1WXXA 3UZUA 3BWBA 4RTPA 2ZCJA 4KVZA 3UJ9A 4PIMA 5K09A 1QAQA 2OKCA 1EIZA 1MHTA 2Z6QA 1KP9A 2PGXA 4XUEA 4CTKA 3P9IA 3FZGA 4FZVA 4GC9A 5LSAA 3LBYA 2IBSA 4CKCA 3LECA 4OQDA 3M33A 1JTFA 1AF7A 2NXJA 3SSNA 4E30A 1XTPA 4LWOA 3UWPA 3X0DA 4C05A 1IM8A 4HGZA 1NV8A 5CVJA 5EHGA 3KQQA 3A25A 2I62A 3MAGA 2IDJA 4RX1A 4AZTA 3UJCA 2UZ4A 2C7QA 5FWDA 2ONZA 3M6WA 5CVUA 1XVAA 5DM0A 2UYOA 4HGYA 3V8VA 4DCMA 5BXYA 2C7RA 2GB4A 5CCXA 2QM3A 3PFGA 2AZTA 5E1BA 5EMMA 1N7IA 3LDGA 2VDWA 5LQUA 3FPEA 2HV9A 2Y1WA 3ME5A 1BHJA 1G6Q1 2XVAA 3MCZA 3R3HA 4QVGA 1YUBA 4EKIA 4UOEA 4GEKA 2ZZNA 5GIOE 5EVJA 4B17A 2IH5A 3MCTA 4YV1A 4P7JA 1Q0SA 1XDSA 4RTOA 1BOOA 2JH9A 3FUXA 3R9XB 5K0CA 4DQ0A 4AZVA 3HA5A 3V97A 5EMJA 3EVDA 1RI2A 2AR0A 1NE2A 2XYVA 3P9CA 3TMAA 1G8AA 2B2CA 2OYRA 3ER9A 9MHTA 1VLMA 4K6MA 3TR6A 1ORHA 2BR5A 1YFJA 4BLVA 7MHTA 1JG1A 4PWYA 4Z2YA 4FGZA 3G2MA 3MTIA 4RVHA 4ATNA 4YV0A 3KQMA 5GIPE 4X60A 2ESRA 1VP9A 2XYQA 3EEYA 5E2AA 4QPPA 2OXTA 1M0EA 1X19A 5FQOA 1ZGJA 5K0NA 1V39A 3JWHA 2CMHA 2VDVE 4YUXA 2O05A 4U7PB 4M7RA 3DMFA 5DT2A 5FTWA 3AXSA 2ZULA 4RV9A 3THRA 4ER3A 3G7UA 3DULA 4QVKA 5LR6A 1NBHA 1XCJA 2ZVJA 5EC8A 1BKYA 3MB5A 4E2XA 5EHIA 3DUWA 3HM2A 3FUWA 4QQKA 5F2KA 3UJAA 2QRVA 1KPHA 4MQ4A 3DOUA 2IIPA 2XYRA 5HIIA 1KIAA 3LKDA 3CC8A 3CKKA 4RWZA 1UWVA 1RJFA 2P35A 5EPEA 4E2ZA 3EGVA 3I58A 2WK1A 4RSRA 2PX8A 3G8BA 1RJDA 3IV6A 4BP1A 5E9WA 1DCTA 2PX4A 2O0LA 2R6ZA 4X1OA 3BKXA 5DM1A 4EVIA 5DTRA 3KR9A 4ER0A 5LQCA 2FK7A 3IYLW 1PRYA 2WA1A 3CJRA 3LCUA 1UIRA 2A14A 2NXCA 3DP7A 1X1DA 3QOWA 1ZKDA 3GDHA 1JTEA 2EJTA 2P7HA 2IPXA 2F8LA 1VQ1A 2HNKA 2O06A 3G5LA 3ERCA 2PWYA 3NJRA 2NP6A 1ZHFA 1AQJA 3DR5A 4PNEA 1N7JA 2AOUA 3G88A 4PYNA 1R18A 2GA9A 4G56A 1O9HA 1R8XA 2PT9A 1I1NA 2B25A 2PV0A 3B7PA 3MQ2A 4KDCA 4O29A 5GOZA 4E70A 2DPMA 4CXMA 4RTNA 1XCLA 3MERA 3B3FA 4FSDA 5FQNA 4CKBA 4R6XA 2AVNA 5GINE 1SKMA 4E32A 2O57A 3HA7A 3QV2A 3BGDA 3BGIA 3K0BA 3H2BA 4PYQA 5FA8A 1UFKA 3IHTA 5DSTA 3HVKA 1XDZA 2PX5A 1X1CA 4PGGA 4RYLA 5E2BA 5C9ZA 4AX8A 1I9GA 2YVLA 2AOUB 3PX2A 4BY9E 3M6VA 2Z6AA 1EQAA 2DULA 1AV6A 3PX3A 5KQRA 1D2CA 3FUUA 2G71A 3P9KA 3HP7A 5C0OE 4KRGA 2B78A 4FSXA 4GOMD 2AOTB 1KYZA 3DTNA 3PVCA 2GS9A 3G2PA 5LQJA 3P97A 1KYWA 2NYUA 5K0BA 1NW7A 3ER8A 1M6YA 1RI3A 4ZTBA 3O4FA 2OB2A 3GRUA 3RW9A 3THSA 3ANXA 3F4KA 2H1RA 4PCLA 3I5UA 4EQZA 1G38A 2VZ9A 3HTXA 3G2QA 4BLWA 1P39A 3G89A 1DUSA 5EZSA 4WXHA 3LGAA 1QAOA 5DTMA 5K0EA 2PKWA 3LL7A 2OB1A 2ORED 3KR2A 4A6DA 4RTSA 5K01A 2ZWVA 2JH8A 3UA3A 5HIJA 3FTFA 1TPYA 4DCGA 5DSXA 3HCDA 3NVKI 1VE3A 5DLYA 3VYWA 5T64A 3NDIA 3EVAA 2LD4A 3HNRA 4C03A 4OBWA 2G1PA 1XJ5A 4HTFA 1VBFA 4PGHA 5JUWA 2FHPA 2PXAA 4RTRA 1R8YA 4JXJA 1D2GA 2GLUA 3E7PA 3FPJA 4IKPA 4CTJA 3GGDA 1HMYA 5FUBA 5DM2A 5HIMA 1FBNA 5BW5A 1IY9A 1I4WA 2ZZKA 3ELUA 2XVMA 2H11A 3O7WA 5ICGA 1JQ3A 4LWPA 5EKUA 2AS0A 4OX9Y 4PYOA 3BXOA 5HILA 4ER7A 2OY0A 4HC4A 4MIKA 3FYDA 5BP7A 4V0QA 2CL5A 3TLJA 3JWIA 3HA3A 1AQIA 2Y1XA 2V74B 3FUTA 3A26A 3O31A 3G8AA 3P71T 4XUDA 4CWAA 1JG3A 3UFBA 3VSEA 2VS1A 4IV0A 4DM3A 4RTJA 2ZBPA 4ISCA 5B1SA 4PYIA 2NXEA 5LQRA 2AN5A 4AZWA 4A6EA 1YZ3A 1NKVA 2N47A 4FT4A 1N2XA 5E9QA 1EG2A 4E2WA 2NXNA 1JR4A 3B3JA 5EIWA 3R24A 5E1MA 4RTLA 3KQVA 3PT9A 5EMLA 1KPGA 5EIFA 1RJGA 3U81A 5HOQA 3WSTA 3E05A 4QTUB 5CVDA 5E1DA 3VC1A 2C7OA 2JHPA 2E5WA 3KR1A 2BR4A 3DH0A 3OE4A 3UA4A 4RTKA 5EGSA 3VC2A 3JWGA 2BM8A 1JG2A 3FPGA 4H0NA 2PBFA 1FJXA 5ICEA 2B9EA 5GM2A 4F85A 3B89A 2PSSA 3AY0A 1ZQ9A 3GRRA 3FUVA
chains in the Genus database with same CATH superfamily
1ZXBA 1YQDA 2O1SA 3JVEA 4DBLC 4EIWA 3DZ8A 4CG2A 1L4KA 1QVWA 1WHSA 2NQ8A 2ECOA 4IIDA 3PFIA 3DOIA 1DCKA 3OVMA 4Y6GB 4V02A 2DT5A 1UQUA 5T6MA 2FG6C 4LX0A 1X1SA 2GRJA 2JKYA 4V0SA 2RHTA 1ZUIA 4W9RA 2WU0A 1ZN8A 4U3JB 4B2IA 4DV6B 2QGNA 1ZI8A 3PI6A 4I55B 2K2QA 3CH5A 3WDLA 5AESA 3L8HA 1LLUA 2DF8A 4JSTA 3WLRA 1GYRA 4BFZA 4HX5A 4J75A 2P6MA 1P91A 2WUDA 3O73A 1EX1A 4DY6A 1GHTA 2TMYA 2XWJI 1R9JA 3OZAA 2YJ4A 3N6VA 3WMRA 4ESEA 1BDJA 1Z0SA 5HPYB 1G9TA 3CCEP 1Y5MA 3O8NA 4FPXA 4Y18A 1KI1A 3ZGVA 5BSGA 4M8NE 2UZ1A 5ULLA 3IMEA 3A27A 3TFOA 3JD0A 3GAZA 3KJGA 4IVNA 2ONYA 3CF4G 1E98A 3TM5A 3LOQA 3V48A 1NQ5A 2EF0A 2CV1A 4DR5B 1CQJA 4W5TA 3D6UA 3EQZA 2PMKA 1UXOA 4QDOA 2R84A 4CLDA 4PQGA 1JHYA 4HLNA 2AQIA 2XNJA 1VHQA 1U6JA 3O1HB 5KREA 3LBFA 1WBBA 4RA9A 1E1YA 2VRCA 1AGNA 4RHYA 4QNNA 1JG7A 4N76A 4GSYA 5JS1A 1U3DA 2PKXA 2GETA 3IVAA 1YJ9P 1T1RA 2GZMA 3M8KA 3MWDA 4UQOA 4BV9A 3B6ZA 4O4LA 3W9BA 1V7QA 2CF5A 4X24A 5A4AA 4BP3A 2A5LA 3RYHB 1NA5A 1SKYB 2JAWA 1SXPA 4AS3A 5C35A 2IDMA 4N12A 3MCVA 1BJTA 2ZRGA 1V45E 3GVHA 3WYCA 3HSKA 4D2IA 4YIKA 3R3VA 1YB5A 3GP5A 1IHOA 2WA2A 4M1MA 1JVNA 5DKFA 5HBGA 5FX2A 4G1VA 1JE1A 2XMZA 3OEED 5JRZA 2H00A 1IQUA 1FPMA 3FBWA 1GNRA 1NSTA 2COUA 3VR5H 3ANLA 3WMWA 4FOTA 4GLFA 4MP6A 4E3WA 4US2R 5DHAA 3ADBA 5IVHA 1ZSYA 2WPNA 4XZ3A 5KVSA 2VQ6A 4CQJA 1QBGA 1TVMA 2OG2A 4JODA 2C3MA 5AVXA 2L69A 4Z4EA 4H3SA 5TJHA 1PDWA 2BFDB 1SUBA 3GHHA 2ZPUA 2V7QD 1ZAKA 4MW6A 5JCXA 3SQXA 1OGJA 2HMYB 2QAGA 3COWA 4MVJM 1VL5A 2C8KA 3NEJA 4AXBA 2PGNA 4XLLA 2QROA 2YS6A 4QJBA 4MW4A 4TKVA 2EKZA 1XA3A 4XD7D 4P81A 2VJQA 1LC0A 3QMVA 2ATCA 3VGPA 3D7SA 5KPDA 4X93A 2YXPX 2BGMA 3KQSA 1LJLA 2AUNA 3GJ8A 3D3WA 2IBTA 5A6SB 1SQ6A 1Q17A 3HP4A 3QP9A 4F56A 1F3OA 3M81A 1PHRA 2UZAA 1N2HA 1UF9A 3DM9B 4QSHA 1GP2A 3OKAA 1V8ZA 4D3YA 1EWRA 2R4TA 2WRZA 3IDFA 4QECA 4AKHA 2PSHA 4XRGA 2PUEA 4AMZA 1ZICA 4XEHA 2HGZA 1JEOA 1NMEA 2J3JA 4DY4A 1L6IA 4JI1B 1WY7A 2XBUA 2I6XA 2ZUUA 2V9CA 1WHTB 1VSQA 2VLNA 1E69A 5AW3A 3OQMA 5H0IA 3LA6A 4H6VA 3S3TA 2CLIB 4JLAA 3LWDA 3C6MA 5TMEA 3F49S 1CUFA 1D03A 4UJ5A 4FT2A 6CHYA 3NGMA 4U7TB 3TPZA 1MC1A 4U0JA 1SBYA 1DELA 3RIEA 3SGLA 4C0KA 5C46F 2JRCA 4FHFA 3EY4A 4LHSA 3M3DA 1AMUA 1WF6A 4KHZA 2NLOA 4TS1A 4WEOA 4OX9B 1ZMTA 2YZ7A 4OHZA 3GEGA 2HADA 1TECE 1FRFS 4HWKA 3UJPA 1QK3A 4H1WA 4L07A 4MX8A 3MQ4A 3UJ8A 4CV3A 5AXDA 2C78A 4O08A 4OPMA 2A9JA 2IC5A 4N0QA 1CR4A 5LDHA 1CQIB 4YJ3F 2AJDA 3OD5A 3OZTA 4YP1A 3VZQA 4DLWA 4OGFA 5CFNA 2HDOA 3DS1A 4AKSA 2QU7A 1WX1A 1ELOA 2CNWD 1XTRA 4HI0E 3RDPA 1Y7HA 1C1XB 3JQFA 3IQFA 3C1UA 2WZCA 1QP7A 1H9CA 4I5EA 4YCMA 1P7PA 3PIDA 3E0QA 1RQ7A 2PY6A 1VI5A 3LT1A 2O59A 1L7MA 4JWKA 1WVGA 1U2SA 2K4MA 2LDBA 5LP6F 3G5AA 1RJEA 2FPGB 1NXQA 3CVJA 3HACA 3EIXA 3WMGA 3RFTA 4JCCA 2BGRA 3Q3CA 4TLLB 1RU3A 5EN4A 3FWKA 3K05A 1SHJA 3QVJA 4HDAA 5H7XA 3T7TA 5ITZB 3QSYA 5JEDA 4NBWA 3O1LA 1NE7A 3KJIA 1AQNA 5C1IA 5L8VA 4KP7A 3BB3A 4A8JB 5T7BA 1TJPB 1DQRA 1YMVA 2TMGA 2ZYTX 3WLIA 4ASUD 1CT9A 4YAGA 2JLRA 4TLDA 5A62A 3ZTYA 3TQHA 2CKDA 1VYHA 2C5LA 2FW7A 2I9KA 4R7ZA 2AF3C 4ZV7A 3MRTA 3U3OA 1F1JA 4POOA 2KBEA 2JGDA 3A6HA 4BFLA 4YJDA 2GLTA 2NU6B 3Q7IA 4AN1A 1L5QA 1QIDA 3DAYA 2PU5A 3ETNA 4YQYA 3RREA 4E7PA 2VN8A 5F3WB 3UK7A 4CEHA 3DS0A 1ABEA 1INLA 4Y0VA 1RZRA 3PEEA 1YZGA 1W44A 3II6X 2EKBA 3K4PA 3L6CA 3ZDXB 4P54A 3WIUA 4H4EA 4GMKA 4MWOA 3WRYC 1SURA 5IDWA 4U5XA 4WN9A 4MP3A 5HIAA 3I1FA 1T9GS 3A4TA 2KODA 1NHGA 3D4OA 1DUVG 3G79A 1CUUA 1IOZA 3H5IA 3DL7A 4ZI5A 4L8VA 4C6RA 1NU8A 4HEA1 4ARZB 1E9DA 2CHGA 5BSUA 1TQ6A 1XYVA 5EE1A 7GPBA 2A9RA 2GO1A 4PWZA 2FUNB 4HQKA 2Y0BA 4HNUA 3UHAA 3TF5A 1Z6MA 1VI2A 1U7HA 5DX0A 3V4OA 3W4KA 1RKXA 3AERB 5AFSA 1D2HA 4OA8A 4Y9RA 3QI2A 4PYRA 2XV6A 1HT1E 1OX4B 2VR1A 2X8BA 1JL3A 4QELA 3MJFA 3NBFA 5EZYA 1NVMB 1O87A 4AO6A 5LYJA 4I8IA 1L8OA 1USKA 2CB0A 3MTDA 1NKSA 4H2YC 2CLKB 2R48A 3AGQA 4H7DA 3X2FA 3TQSA 2A5FA 1D4OA 4QUBA 1RZVA 4FMDB 3NHAA 4YRCA 1PTJA 3OWXA 3W7VA 2H1FA 2C4MA 1Z22A 3GJSA 2QTMA 5KYYB 2RK3A 5I51A 4I9NA 1PT9A 2JI6A 4S0ZA 2IH4A 1V16B 3NTXA 3GUYA 3PGMA 3VSBA 5LA6B 3JAWA 4WZAA 4JR2A 1NAHA 3OFJA 4UZSA 3RVJA 3TK1A 3PE3A 1YACA 1ZESA 2HLNA 4D96A 4IXWA 2Z9DA 3NY7B 3TSOA 3KS9A 5E6SB 3S1AB 1KRWA 5WRFA 1E7SA 4ZDKA 5BMVB 3RCBA 4L22A 1JHQA 5KYYA 2DH5A 2H7XA 4NE9A 2SCUA 4B84A 3MAAC 2OQVA 1N5LA 3K09C 4QFBA 4CLOA 3BWBA 1MAUA 2IYYA 2ZCJA 3VTFA 3UJ9A 3K92A 1RAGA 4WAUA 1LF5A 2ATEA 3B13B 4JHLA 1JNXX 3BJMA 5I7HA 3AP3A 3BZWA 4OHMA 4Y1GA 1KP9A 2GUGA 1IUQA 4M46A 1W0CA 1QQBA 3ZCUA 4U7GA 4OHCA 1UP6A 2GN9A 1U8FO 4NAVA 2PMDA 3KZCA 5DYTA 3PQ4A 4DKXA 2QZZA 3PI7A 1KI6B 4TTIA 3LECA 5C31A 2IBSA 3SSNA 3T9CA 4BO6A 5JCOC 3MRXA 3PPVA 1GGJA 4FGLA 4O2BB 3UWPA 3LUPA 2NQ2C 3M1MA 2H4HA 1CJBA 3AESB 1WXEA 3DWEX 1RYNA 2HHCA 2PRYA 1GRVA 2Z2ZA 2QMHA 4K6HA 5J5CA 4NCBA 3WHLA 2O8EA 2R1TA 1WPRA 4K05A 1A9TA 3VGJA 4AJKA 3IE1A 4TMKA 5SYAA 5CVUA 3NIDB 1XVAA 2WHRA 5DM0A 2H4XA 1W49A 1YZVA 4BCCA 4GZLA 2GWRA 1OFIA 1KYVA 3TPCA 4M87A 2C3UA 5A2QA 2ASEA 2JFQA 3JRWA 3LF1A 5CYPA 1GITA 3VNQA 5IT0A 4DLKA 1M8FA 1RRGA 4AJLA 3ZNQA 1G1MA 4IH1A 1DPGA 1VE9A 1ZW6A 3X2EA 4ALLA 2WPTA 1AKTA 1WABA 3CV3A 4DIBA 5EMJA 5FUWA 5LU8A 4XPIA 3RO7A 1ZJ4A 3EDQA 2RFLA 3BULA 4LOJA 4DSZA 3GLFA 4LCEA 4YP5A 5DGIA 1H3NA 4NNJA 5B7QA 1EFRA 3L8CA 3INNA 4LKRA 4F9FA 1YR6A 2KG8A 2QJFA 3Q15C 4PHCA 1YAHA 3ZHQA 3OESA 5M7EA 2AG6A 3FKQA 1FSFA 3QLUA 5FOWA 1J2TA 2XZTA 2PL9A 3FFWA 3ZLBA 1H85A 4GPAA 3KQHA 3WK5A 4I50B 1KVQA 3OIGA 4BJ6A 1RHJA 4N1AA 5EA2A 4OHWA 1W2WB 4DJTA 1B14A 4CVNA 1D6NA 1B2RA 4ONEA 5EWMB 5DYIA 1N2CB 1B7GO 1RKUA 1TGVA 4A36A 2ON6A 2DT8A 1VSUA 2IIPA 3AIOA 1IXYA 4YAEA 1IONA 3D7RA 4Q3BA 5F77A 5IARA 1FFYA 1ZUNB 2P35A 3JV7A 3RS9A 3FNHA 1W94A 2XBLA 4RSRA 3LUCA 3WLFA 2CNBA 3V3KA 2HCTA 1E4EA 3IUSA 4BDTA 1CEIA 1IL0A 1NYRA 2BMJA 1TI7A 5LP1A 3PNYA 4ER0A 4QXRA 5LQCA 2WA1A 5THKA 3I05A 1MXFA 1N2JA 1UIRA 3HWRA 2Q9AA 5CR9A 2JDID 2QYTA 2AFIA 1BAPA 2XT6A 5JPAA 1IZ0A 2R00C 3L6BA 2P7HA 5BUCA 1HNZB 1AQJA 2FQWA 2H18A 4DJEC 4BMPB 3LU1A 3RU2A 4YMUA 3VYVA 1J8VA 3AF4A 1R8XA 1KGDA 2FX2A 1ZH2A 5THQA 1JHXA 1TLLA 5JSHA 3P9RA 4N4AA 3ZDRA 1T2VA 4KAFA 3TUJC 1RMYA 4Q03A 1L8LA 4O4JA 3L92A 4IILA 3EFOB 4R4JA 3WLAA 3T5AA 5LCXA 2G0TA 2VJMB 3I8XA 2C4HA 4H2XC 4R83A 4JLMA 5CD9A 2Q28A 3KUXA 2E1MA 1E3IA 2E37A 4OH1A 1FFHA 1XDZA 1FMCA 3AVXA 2DHCA 1V2HE 4YRRA 4ZODA 2H0AA 1Z4OA 3KJNA 1MOSA 2IPMA 1D2CA 3KM0A 1T0JB 2EHJA 4OGKA 1YMUA 2IYSA 1IOWA 1I0ZA 3AT1A 4PPQA 1TC1A 4B4KA 3DFZA 3ZW8A 1KIMA 4PZLA 5F1KA 4L0DA 5K4HA 1A76A 2RGDA 2VJBA 2ZJ8A 2FEXA 3EFBA 2JNWA 5B64A 3NWOA 3I2YX 3PUJA 4L78A 2FEWB 3OUUA 3DTVA 2JW5A 2C2GA 5K0BA 2OBYA 2OV8A 3CNBA 3AFGA 3HQ4O 3M6MD 4Q3AA 4AJJA 4U00A 2WUVA 3GLFE 3F47A 5BVHA 1QPGA 3SC4A 3T3OA 4LY6A 1C0EA 3PFKA 1KEPA 5F21A 1ZHOA 3I34X 1NI4A 1HETA 2BGUA 4ALKA 1XN4A 4D97A 1YE5A 1KXJA 1PFWA 4F5ZA 1WUTA 3NJ8A 3RU3A 4Q1DA 3TBHA 3T9BA 3L4JA 1IN5A 1Z4PX 1ZD9A 5HBRA 4I36A 5CX4A 2YDXA 3TTSA 5BW6B 1M6VA 5FT9A 1JEQB 2VUUA 3LJKA 1NLMA 1EBBA 1MRNA 1P45A 2KM1A 1Q0ZA 1NLUA 2ALJA 3Q3IA 3U7IA 2RIRA 3MTJA 2PXAA 3ODGA 4Q4JB 5KSPA 1JJFA 3GVPA 3VDXA 3VNRA 1TUBB 1R5OA 5AUQA 3PEVA 2NPOA 3RT7A 1AHPA 5JVDB 4P36A 4BFSA 3UMYA 1NGSA 2AJTA 1YRLA 3CC4P 3GT4A 2CCKA 4ZO9A 1Q22A 4LF9B 3EUWA 4LK2A 2ILVA 2G1KA 1CVIA 2WM2A 4AUEA 4EPVA 2B2NA 5D7BA 1MA3A 5HILA 2FJ0A 2DQYA 4ER7A 1NBMA 1ZGBA 1XQXA 1LQTA 3A4NA 3OY7A 3M9LA 3PWZA 3QG1A 4KYTA 3ZWNA 2Y0DA 3FJ1A 1YGYA 2CL5A 1I4LD 4OUDB 4YAFA 3ZCTA 5JROA 1TCUA 4PV7A 4WY5A 1DG3A 4I1VA 3C15C 1KZYC 1V1JA 3DAGA 3B2QA 4HUQA 5ENZA 3K5PA 2GXUA 4RL6A 1BU8A 4JK3A 2NXEA 1Y1SA 2O3SA 4NZNA 4G4SP 3EZ7A 3MWKA 4GLJA 4L85A 1YBVA 2IGBA 1QGUB 3DE5X 1KSJA 3TVTA 4K46A 1AV6A 1ZMXA 1QE5A 1QWOA 1DRUA 1CPYA 1FW8A 1UJ4A 3BH7A 3V9AA 5BMVF 3I61A 4LE2A 3MVEA 1R8SA 4PHGA 2WJ3A 2CGEA 3SOPA 1NG1A 3VC1A 1ZEJA 2HQOA 5ESRA 4ED9A 2E5WA 2ODAA 2RHBA 3I6IA 4DWWA 1T1IA 4B81A 1J1UA 2Q8QA 2VDOB 4R01A 3QE2A 2B6HA 2HN9A 3FPGA 3W8DA 2VF7A 4HZGA 1VIVA 3WBKA 3N0WA 1WZEA 5I4BA 2O5VA 5A0VA 1HDOA 3O91A 3FUVA 4G0UA 1OXUA 4EY5A 1AUVA 3NHFA 3ANNA 3NVDA 1F6BA 5F1PA 3S7TA 3KLBA 2OHVA 1GQFA 3SIPA 3RHFA 3JATB 5AXCA 1ZJYA 3ZVMA 3NMUF 4HT3B 4MB0A 3TR0A 3TEJA 5GM1A 3REOA 2MMCA 4PLCA 4TT8A 2VTVA 2XLBA 1PT8A 1GFSA 3EIEA 5DK6A 3KXKA 3UMMA 3TE7A 1JKFA 3ETCA 3KB1A 5F4BA 1O94D 5KP6B 5EJ9A 1L4BA 5DVZA 2WD9A 2O3QA 2N0SA 2GZFA 5D87A 4OQEA 4UM8B 4ZOEA 1SQFA 2ACVA 5T5QA 4RY0A 3CURA 1E4EB 3IDZA 4NCAA 3K8YA 4IIYA 4RJKA 3CSSA 1YJ5A 2X0JA 3ZD8A 3PDWA 1JJIA 4RQBA 3NIWA 3VV2A 3PL5A 4ADSG 2A7QA 1R0BA 4BGUA 3Q8LA 3I23A 2IPAB 3QYAA 1NVEA 5AYVA 2A59A 5EJFA 3GFVA 1WXQA 3B9QA 3QOFA 4AFNA 2XVXA 3GRVA 1U5BB 3KJHA 3AXTA 3GFBA 2CXUA 4G5QA 1H2EA 4TTJA 3DP9A 4P82A 4X45A 1E3TA 4MJXA 3GLFB 3MPOA 3BH0A 2C9YA 4OTZA 3S70A 4B8ZA 4JT9A 5CD1A 3HBJA 3ZKWB 4IUYA 4FFLA 2OYCA 3ZJ5A 1FFCA 2QVXX 3BXPA 4IJQA 3BVPA 4UUMA 4LMAA 3U2QA 2JASA 3V8PA 4UNSA 4Z2AA 5JD4A 2KB0A 3OLYA 1AKNA 2V5AA 4DPKA 5FPKA 1GGHA 4C1BA 1KHTA 4PYKA 2VJYA 2DRIA 3TIFA 4HSGA 2QM8A 2GJ4A 2NVUA 3FKSD 1VE6A 2IEDA 3E70C 3FNFA 4PC3A 1PGOA 1XDDA 1YMQA 5BSMA 3VR6A 1Q7CA 4RVGA 2IYUA 1F2DA 1RHKA 2XUJA 2GEDA 1RM4A 3O94A 4YPVA 2FZVA 3V4SA 2UVPB 3RODA 1VPWA 4BVJA 3JCZA 4ETIA 2OWDA 3U80A 5JDIC 1DFGA 3NKLA 4PTYA 2QK4A 1UBEA 1IHUA 2CUNA 2ECKA 2JFWA 3AFOA 3R3ZA 3AM5A 3BE8A 3LFTA 4WGGA 3TNFA 2PEZA 2LP4Y 4MA4A 4EF5A 3ESQA 5D3ZA 1GNTA 2JU1A 1KYYA 1NW6A 1XU4A 5IN4A 3VR4A 2BSQA 5IUNC 1NUAA 2CVZA 1F80D 2CWWA 3M1IA 2Q4BA 3UBMA 3GT7A 4CI0B 4P0PB 4JYMA 2A86A 1DDOA 2H4ZA 2XCIA 1J49A 2O50A 4RZIA 3VDNB 5G0VA 3X1DA 1TK2A 4FW8A 3GIWA 2VLQA 5EOVA 1NBMD 3DMNA 2RGWA 1XQWA 4L7VA 5KX5B 5L40A 2G9UA 3FTEA 1T2DA 1UPUA 2H65A 3AEQA 4LXXA 1XQ9A 2LNDA 4LV6A 1KI6A 1PSZA 1V2GA 2O2YA 3ZDEA 1OHHD 2HA5A 3DC7A 1RPNA 2D1TA 3LZDA 1V6AA 4G01B 4KE6A 1TKCA 2CW5A 4OJMX 3TLGB 1FRZA 3GLIE 3IEVA 2V7UA 2C29D 1ICEA 3KZMA 3SKXA 3WO1A 3CCFA 3PXGA 1QKKA 1R4AA 2F9MA 1JMYA 4OXRA 4OSOA 1QVVA 1P7CA 1G8FA 1EK0A 1VL0A 1ESZA 2X2FA 4CLOB 5IT9A 4TYNA 4TS9A 4G85A 3T8YA 3VZDA 1N3IA 4PLFA 3PRHA 4C7JA 4IEEA 3DYVA 1M5UA 2JBHA 2R4UA 1CW2B 2GN6A 3SVLA 1LSSA 5J40A 2AXPA 1ESNA 2XJ4A 3D4BA 3DZHA 4XVQA 1EHCA 1GL6A 1I14A 5JNRA 2Z1NA 4XSVA 1IVNA 1N6PA 1YA8A 3KKPA 3CZ4A 2R65A 4G1UC 2B1IA 4MVJF 1KYXA 3Q12A 4I6JA 4ASUA 3CW2A 3E84A 4G41A 1NM5A 2VT3A 4J9VA 1W8DA 5KCMA 1UC5B 2CMGA 2PJDA 5LA6A 4AUNA 3GBPA 1EGVB 2EEZA 2ZEJA 3ICOA 3GNSA 4MRMB 3MMPA 1BQEA 2ZROA 1Q1NA 2IW1A 4URHA 2VHCA 4RD6A 4TVBA 2BFBB 4NYJQ 3JATA 5C8XA 4JJIA 3MJSA 1XB2A 3EOBI 2IUYA 4MJ3A 1YRWA 4KO2S 4CJXA 5IM5A 2BCEA 5IU6A 1F0YA 5KJCA 1FW6A 3GX1A 2IU0A 1DC5A 1YZKA 5CDUA 4J1TA 4G2TA 4C76A 5BSWA 2HYIC 2YQ5A 1UM9B 4NDNE 4P3KA 5EXTA 2DECA 5G0SA 1TZCA 3GPIA 4G5OA 2XJ9A 1L8AA 1P1RA 4B3TB 3JQQA 3QKTA 2J7PD 4ND7A 3W5VA 3CVWA 2J08A 3PFHA 1FYWA 1M6EX 3DDUA 2ZJ1A 4MOWA 3WQBA 1PS8A 4KX3A 4MB6A 5K8LA 4JI2B 5LL6P 4WVLA 3HJNA 5SICE 2Q2QA 4UE2A 3WL3A 4DUGD 2DR0A 5B36A 2V7WA 3T1HB 2AF8A 1Z63A 1SIUA 2G7MC 2H1HA 3IAFA 4IUBS 2H17A 1DWOA 3CKLA 4IRMA 3FOCA 4IQ4A 3DGEC 3LY5A 2IS6A 3TX6A 3C4JA 3ETDA 2ZTLA 4F21A 3HWWA 4L5AA 1G3QA 2EJCA 4AUKA 1RLJA 2JLCA 2PKYX 2Y6UA 3LLSA 4QZVA 2YHSA 1O4VA 1Q3TA 3RS0A 1ZYUA 3GCGA 2WD7B 2YXNA 4JVSB 2L6EA 3ZNOA 5KNBH 1PNQA 3EEQA 2RHRA 1WSBA 3O3MB 1NF2A 5IW8A 3HYTA 4IZIA 4WK4B 3QVKA 4O33A 3ZVKA 4HRVA 2ZRKA 3PDJA 3HUTA 3LSYA 5AKLA 3JQ6A 2EJUA 4LJKA 5FFMA 3F8SA 3TKYA 4BNUA 4FFMA 2GRUA 3DEFA 4W4TA 4EPXA 4GX2A 5I9IA 4ML3A 4FXPA 2ZI4A 3N8NA 2QMZA 2FPGA 2X4LA 1R64A 1LDGA 1MP0A 2V96A 2QSZA 3D4IA 3IGFA 4HAOA 4HX9A 4CGYA 3ZWWA 4GFDA 1DBRA 1T9CA 2YFQA 4MV8A 1UBTS 4TRRA 3C2QA 1RJ9B 1TA0A 4MVJG 3ZUGA 2JQ4A 1I30A 5EJ7A 1YI2P 2VHJA 4IFBA 3JARA 4M54A 3IUJA 4MWZA 2FZ4A 2IL1A 2EW1A 4PYJA 4H35A 1ZIYA 3VO8A 4B6RA 3D0RA 1GLNA 2XQVA 4MDFA 2HSZA 5IJXA 3ICVA 1QIMA 3G2OA 5GZ3A 1U8YA 1HE3A 5KYXB 5CB4F 1LPSA 2WVAA 2OGWA 1BWPA 1OWLA 5ERGB 2HJRA 2PRZA 4XCVA 2WLTA 3F46A 3VMMA 3H2JA 1C4XA 1KEKA 1FR2A 3HLYA 2Y2UA 5AKKA 3SXJA 3RSHA 1AKUA 3NM6B 4Q66C 4AD8A 4EECA 4LNHA 1BFKA 3N86A 4L76A 3G49A 2YWBA 2BISA 2R1ZA 2DBZA 1PD0A 3LCVB 4TQUS 3CCCA 1N9KA 2X42A 5EIXA 3E03A 3K2IA 3JTEA 2XUAA 3UZUA 2VRCD 3GCXA 3H9QA 4EJFA 1PK8A 2VJAA 3QMMA 5BSVA 1R0RE 3N8IA 4OM7A 3GC6A 4NQRA 3LM8A 3RS7A 4V1CB 5KJ1A 1JIQA 1C7JA 1CLEA 1HYGA 1YZQA 2ZWPA 3MFQA 4YB8A 4CTKA 4FMDF 3PJRA 3FZGA 4D4IA 3EUAA 3LC0A 3CRVA 3D8HA 2PNGA 4C20A 4OATA 4MVJA 2GF2A 3OPQA 4GSKA 4OQDA 1B3BA 3AV0B 4GT1A 5IDVA 1R16A 3D3WB 4EG6A 4UE6A 1VKZA 2X4IA 2I62A 4FYMA 4BGVA 1OA1A 3R3UA 2ZTSA 3U7EB 3WZMA 3ZVRA 4YJKA 5EXSA 3EIUA 1ZVKA 4JS0A 3ENNA 4I9UA 1P1HA 3U4MA 4DRXB 5JAIA 1XELA 3VPAA 2LWIA 1IM2A 1RXIA 3DYBA 3BL8A 2GB4A 3KYIB 4RDIA 5BXYA 3AW8A 4FZJA 4I4NA 4J16C 1T34A 4NI5A 4W8OA 4ZT5A 3K9LA 1SVSA 4QJ5A 2PY8A 1BHJA 1NFRA 1ESDA 2FWJA 2J4FA 1VG8A 1YUBA 2EU8A 2Z95A 2ZIXB 3EFHA 3FOWA 3MWFA 1OPRA 3E22A 3INTA 4GEKA 4Y2XA 2ZI7A 1OZGA 5FBHA 4INAA 4B17A 2CT8A 2ZT5A 5IC6A 1ECCA 2JC3A 4MV9A 1M1XB 1WL8A 5HGJA 5B1DA 4AZVA 3EVDA 2JEOA 3MAJA 5U4QA 1Y1LA 4IPYA 3ER9A 1VLMA 1T36B 4WOKA 4WOCA 1OKKA 1E6MA 2J9FB 3K0CC 1JG1A 3G2MA 3LW8A 3EH1A 1F8YA 3DE4X 4MQLA 4MUBA 3RYHA 4AYWA 5IANA 1P4HA 4URVR 1JR3A 1ECLA 4LYFA 1CETA 1M0EA 2WJ6A 3L6DA 5J4HA 3FMOB 4E1BA 3HABA 4EA6A 1C80A 3UPUA 1RSZA 2C5HA 2OGTA 5F33A 5BOSB 2C9MA 3H1EA 2OBXA 4PICA 2QQFA 4XPIB 3GA5A 4QYIB 4PHHA 3DWIA 3EG9B 1RHRA 5D8DA 4GZMA 4EG3A 1WXHA 3HM2A 3KWLA 3FUWA 3OQIA 2GCOA 2CSXA 4LXIA 1KPHA 2C4KA 3FF4A 1HF3A 2ZJAA 3MJHA 4XSGA 3C8UA 2OO5C 1SZPA 2Q45A 1ZIPA 3EZ9A 5ALOA 2PENA 1Y5IA 3VTZA 1JI0A 3OCUA 4EA8A 2FU5C 1J21A 2C9OA 4BNXA 2Q4DA 2ZSDA 1CRPA 3UW1A 3DP7A 3NBAA 2NO5A 3CRZA 3T34A 1P7WA 2YYYA 3A04A 4NCNA 2F8SA 1U0FA 2EJTA 4EMTA 1I3CA 1P60A 1P9RA 3F3KA 4II7A 5HF9A 5AW0A 1ZVVA 4FWIB 2O8DB 1GNSA 2ODBA 2R85A 1ZHFA 2UVQA 1V43A 1L5WA 3I9MA 5JNUA 1H2FA 3RFXA 3OUTA 4PQEA 2AOUA 5L3RA 4U8HA 4Q7QA 1QIHA 2C97A 3PGVA 4L3WA 1I1NA 1MKYA 2FFRA 4KDCA 4O1IA 4OFXA 4UDNA 5TC4A 2V6MA 1DBPA 2CXPA 3KV1A 4EH1A 1I51A 1QCCA 1HQCA 4BN0A 3IVRA 4BNZA 3TZ6A 4MLCA 4E32A 5BPFA 1TM1E 4N8EA 2VXCA 1FZQA 3KZKA 3OX3A 3QYFA 2QTHA 5FA8A 3IHTA 4ZI7F 2POQX 3WKCA 1U7WA 4ZV9A 2CJPA 3U9TA 1SVWA 3BFJA 1G98A 2EKDA 4FCCA 3RABA 3FDFA 1EQAA 3S2YA 4CUZA 3RYTC 2VSNA 4A82A 4BECA 4RACA 1AXGA 5DP1A 2BFOA 1SVOA 2WVJA 1R4NB 2E0IA 4XVHA 4B3CA 1VHNA 1J33A 4ZMRA 3D54D 3OO0A 1SUEA 1Y80A 1P1JA 1TAHA 1RQNA 1JPNA 3G2HA 2ZIUB 2C96A 5BQ5A 4WESB 1OOEA 4E15A 4DLNA 3AUXA 4ZQGA 4CZ2A 3ESZA 3QA3E 3LBIA 4G1EB 4NDZA 1CQPA 1F2UB 1IVYA 2FZGA 5JZBA 3DS5A 1TZJA 2VZ9A 4R41A 2JFNA 5AXBA 5EZSA 1IJBA 1KMHB 4GI5A 2R1UA 3LL7A 2LIWA 2GQ0A 3ACCA 4JXXA 5CT6A 1LD3A 4JUIA 5ALUA 5K4AA 1NZFA 5EZYB 2HSGA 4NZMA 5CK5A 4YIHA 2QG6A 3U9SA 4URFA 3UNXA 3NDIA 3GMIA 5BUSA 3ZQ4A 2G5GX 2F3PA 4OBWA 4ZOLA 2FR8A 1X3OA 1I4DD 1OX6A 2DR3A 1VBFA 2XB6A 3G9ZA 4FFBA 4A8TA 2F1KA 1VQOP 1IXRC 2BFFB 3D8BA 4IIEA 2ZS8A 1M2OA 4C0QC 3ND9A 2O6HA 3QVXA 4BMZA 3NPMA 4RVNA 4Q3OA 4K6FA 3CCUP 2JI7A 3NIGB 3PR1A 3RHSA 4WDRA 1G20E 3AF3A 1GUBA 3HGMA 3NOXA 4YECA 2Q0QA 1K7CA 1EYZA 4XWGA 2C2MA 1C8BA 1CJCA 3DEZA 4LTDA 4F9EA 3VFDA 3E2MA 3GUHA 4OAQA 2YRWA 4CWAA 2CMKA 2PRKA 2Q2WA 3VSEA 5KAMA 4RZUA 1UJMA 4PYIA 3QWFA 2X9LA 3GFPA 1NKVA 2IU4A 1I0IA 1M33A 5ETJA 5TRTA 1L9XA 2DYKA 2ZETA 3JW8A 3E9QA 2B21A 3COVA 3H3XA 2Q7DA 1LSJA 1CR1A 2C9ZA 2EBHX 3UK1A 3R0VA 2IOFA 1DKNA 3ON5A 5IDXA 3CRQA 4NU6A 1IU9A 4MLPA 3UA4A 3L0DA 2GBPA 5LMCA 1T9GR 1UT6A 3A1FA 4CW7A 1Z36A 4GYWA 5CHYA 1XZPA 2BGNA 4GGPA 1JH8A 4G0YA 3H2GA 3Q3HA 3P9PA 2TMDA 3IE2A 3NKFA 1K6EA 1N75A 2DJ5A 3OICA 4KGVA 4MPTA 4PBTA 3DBIA 4QQRA 5E7JA 3GPCA 5DCWA 4LOHA 1UNKA 1KOFA 3DW3X 4X54A 5EXEA 5I47A 4MPPA 1SY7A 2CCJA 4J3JA 3VMFA 3LTNC 3L7IA 1SVIA 3PRYA 4ZEWA 1FU8A 5BV2P 1QYCA 1HOTA 2W2XA 2WF8A 3JVDA 4E1VA 4WBNB 1XX6A 1TMOA 5B6IA 3I1YA 4PIVA 2GN0A 4MI6A 2C3OA 4ZT7A 3KWMA 1NT4A 1Y8QA 2PZ8A 3MNFA 3HO8A 2P40A 4J7AA 3UXYA 5BSEA 4AURA 2JGIA 1WDLA 2AG5A 1H0SA 1U98A 3T12A 1ZU4A 2HXSA 3DHVA 2PZAA 4Q21A 5DB4A 2H1CA 2FRXA 1O5OA 2PX3A 1W1WA 1JQBA 3PQFA 2WY2D 4WXRA 3TTXA 1JS1X 2C2WA 3L8MA 4HNRA 2FSFA 2VJKA 5D3MB 3OWHA 4KPFC 5ITVA 4KEAA 2BKVA 4B3GA 1U8CB 5J58A 1MB0A 3G1TA 1UJNA 3R9WA 3HCRA 3RYCA 2YJZA 3HXKA 1JGTA 1R50A 2BRUA 1R9MA 3B20A 3M4YA 1G8YA 5FOXA 2XZOA 2QPTA 2OPHA 4EENA 1JEAA 1VQ9P 1XXHB 5ALGA 3ASVA 1E6JP 2G5TA 2J33A 3DONA 4WBXC 5K0ZA 3DPIA 1P2VA 2YHUA 4JBXA 4P22A 1GXSA 2N5HA 1P6XA 2HAEA 1Z0AA 3SDZA 4XGKA 1MEJA 1BC5A 2GAOA 1CERA 3HEBA 1NKTA 5TPWA 2Q7OE 3ORSA 2BN4A 3RS4A 5DWVA 2LBPA 4M0LA 3TVYA 5ALVA 3R0QA 1PZFA 1Z18A 2R751 4TTAA 1XJWA 4P7FA 4FJ1A 4B4OA 4HLQB 1SQ0A 1XD2B 4D6XA 1SK8A 4TQGA 1TTPB 2W0SA 1XROA 4PH1A 1UKAA 1GRRA 1A96A 3L7NA 1XLVA 3ZBQA 2VZEA 2R0QC 1N0WA 4RS3A 1Z0DA 3DV2A 1CJMA 2P77A 2Q0HA 4ERNA 3D7KA 2FETA 5CCEA 3BAZA 3ZE7A 4IRXA 1HE8B 2XYGA 3BMXA 3EGIA 1YS7A 3EQ6A 4DLVA 4FB4A 1RBMA 4JC4A 1M1YE 2FDCA 3OU2A 3LT0A 3CPSA 4P8RA 3EMDA 4I5IA 1XRMA 1E2BA 1O96B 2W6ID 3I12A 1ZUD1 2YJ6A 2A3RA 4MRTC 3CN9A 3ZOKA 4RIEA 3UAXA 3LCCA 3JZFA 3OE7D 4RTMA 3BK2A 1OY1A 4IAOA 3ZHTA 3VPDA 3EG5A 1SU6A 3FPFA 4RPHA 3GN2A 4KGDA 1WDWB 4NVRA 1DV2A 3P5BA 2AZ4A 2OHFA 1SIBE 3KQOA 3PXAA 2YNMC 4PG4A 4MQ6A 5AKIA 1XTUA 2HD4A 3UWKA 4A0SA 1C3EA 4MXDA 5FORA 3I4LA 5DNCA 3EVEA 1KJZA 2HSWA 2JZOA 4IY1A 3HYRA 1KK0A 3V1NA 3R5JA 5BQ3A 3D4LA 3PENA 1UZUA 2VYVA 4DSTA 1A4XA 2OZPA 1DE0A 2FMIA 1YFLA 4B3HA 1QH8A 2BPOA 5KNLA 4AZ3A 2IQ5A 3A1VA 4K26A 1NRXA 4MQUA 4XQ9A 2AFVA 3A9UA 3A7EA 3C3EA 3OCZA 3KXDA 1RWKA 1WR8A 4LOKA 1Q84A 3EK2A 3KTOA 4J90A 4ZDWA 1L7NA 1T2NA 4D42A 4UCXA 1JQLB 1ONOA 4JWTA 2D7DA 3G29A 4BJHB 1TUIA 5FTKA 2Y4NA 3OIDA 1J23A 4NULA 4LQ4A 4PSUA 1NXSA 1MBZA 2VK1A 5COAA 1FPQA 3I8OA 2J7KA 3W6PA 3W1EA 3VSCA 3W2GA 1CJTC 2EKLA 4AKTA 4AT1A 3W5AA 4MIEA 4Q48A 5LDDC 2Z98A 2VJLA 1JAYA 1NMQA 3Q3GE 3OPNA 3K30A 1Y6GA 1QR2A 1ISHA 4KIFA 1T26A 3FDXA 1OIVA 3N39C 2C1XA 3OX1A 4U3JA 2IYPA 4OQNA 4NL4H 1CX9B 1CUVA 3K7EA 4DAOA 2FSSA 3QITA 1T3TA 2OFPA 2OV6A 2ZE8A 4F1KA 5TMBA 3AB7A 2R6R1 2WV7A 3L2OB 4TYQA 4OAOA 3VDQA 4F7DA 1NXPA 5AVUA 2C57A 3P0IA 4CKZA 2FR0A 5T8KC 1JUDA 4TUYF 1OYYA 5EEGA 5AKEA 4IP0A 4JJGA 4ZVVA 3BA1A 4ND4A 3BT7A 1HX7A 4NDAA 3V42A 4NU0A 4QPZA 4OCZA 4JBLA 1WIWA 3R7SA 3DNPA 3GCWA 2CNKA 1PKXA 4C2BA 2I2XB 2QTVB 1YI0A 2PS0A 3NBMA 4QBIA 4BCDA 4QHYA 3EPLA 1WM1A 5H16A 4J1QA 1HFEL 4KFRA 1GOTA 1PEKE 2B7BA 1VDMA 1V9SA 2WHYA 3C41J 3KZ1E 1DAOA 3T6KA 4EZIA 3VR5A 1OTXA 4LZAA 4Y2SA 2H1SA 2I3GA 1HL3A 3LCJA 1JJ2O 1UK8A 3MT7A 5IUJC 3KSAC 2V7GA 1VLLA 3S6JA 1LPNA 2V7TA 3VZBA 4CNQA 2GMWA 4HQOA 5G0UA 2LIVA 4RXTA 3CLVA 1E6KA 5EZQA 3TIXB 4ZZ0A 4FHZA 5BN3A 5CJ2A 1KGSA 2CNLA 2Y68A 1ULUA 4PX9A 2JD2A 3OQ6A 1FTGA 1HDCA 2VJPA 2WUEA 1UBNA 2Z58A 2QM0A 1FNDA 3IIKA 4LKOA 2C8LA 4Q3DA 4QQNA 4REQA 3KOOA 4C3OB 2JHGA 4BPFA 3WAGA 3RQSA 2PMBA 4W9NA 4BMYA 4UHPB 2XKJE 3ED5A 1U7PA 4ZVRA 5T4BA 3VNSA 3QMPA 3AC0A 5SZHB 5HUJA 2H9YA 4I1SA 1ZM9A 4QOJA 2NZ8A 4KYUA 2CK3A 4V0ME 5FHRA 2JK1A 4B34A 4EW3A 2P11A 2ADOA 3BDIA 4HTFB 4LJ9A 5FO1A 3TI7A 4CMIA 1Z38A 2WT8A 4UJ3A 1N8TA 5CPFA 2GCNA 4XTRA 4NOMA 5FJJA 3SZUA 4CTOA 4EG8A 2B8TA 2H5JA 1XNQB 1NV9A 5C4GB 3O9VA 6YASA 5EHQA 1XV5A 2BFCB 3OQJA 4L51A 3VUFA 1T8SA 3CCBA 2BL4A 1SM4A 3E3MA 5K0LA 2OCIA 2EP8A 3AK4A 1JHUA 3FHJA 1W2BO 3IB6A 3E9ZA 1E2DA 1PVDA 4JGGA 4KMMA 3K72B 4L4UA 5KOYA 1NJFA 1RKQA 2PLWA 5JRJA 4LRWA 4B7AA 2XODA 1YBAA 3BBLA 1VL1A 2GD6A 3TJRA 3LC7O 3FF1A 4H7IA 4C07A 1L3BA 3ND6A 4FLMA 1IIBA 1U8AA 2DFPA 3NEYA 3V2GA 2XBMA 4ZCTA 1Y82A 1SVKA 3C3AA 4EUHA 3K6SA 4J16A 6GPBA 2JGLA 1BO6A 3Q40A 4UU0A 1E2PA 4NZOA 1XEWX 1CZHA 2FFAA 4UPEA 1EAYA 4H1VA 5HFAA 3V1TC 4XASA 1NN1A 2DXIA 1E18A 3C6KA 1EEXB 1HG1A 4MUKA 3N0VA 3TE6A 3NWBA 4IOLA 4R1UA 3RUAA 1XZHA 3HZOA 3KUKA 1ZNQO 1S1MA 1AY0A 1YV9A 2XAAA 4RNCA 3B2NA 2AVAA 4BZPA 4MS4B 3EXEA 4BRUA 2QTCA 3ZE0B 1EIZA 1GAWA 2YW9A 5K7SA 4KQ2A 1IH8A 4LMPA 1MC5A 2Y3IA 1J56A 1AQUA 1Z2PX 3ONEA 4W1QA 3ET5A 3DD5A 4WFJA 4X1IA 4XWAA 4S2EA 1NJIQ 1A8QA 2OBBA 3ETHA 2NXJA 1FFXA 2ISQA 3RRNA 5JLJA 1GM5A 1XTPA 1Q21A 3N2YA 3BJIC 5FBKA 1Y8ZA 1YC2A 4RKFA 1JQJC 3C16C 1SBTA 1UP7A 2EV9A 4FX2A 5H5JA 3VRHA 1P19A 3OG9A 3KUDA 4WCDA 1WBJB 3TTVA 1YGPA 4WLNA 3UUGA 1Y1RA 1KH3A 3AEUB 1I5RA 2ZDHA 3FX2A 1EQUA 2I1VB 1Y7TA 3BWEA 1EVYA 1TIBA 1IOVA 121PA 1KBZA 1RE0A 3EWIA 3P0RA 4NPHA 3T5MA 4HUTA 3V8VA 2Y1FA 3KB2A 2Y1KA 1EFDN 1KI8A 4YJGB 1TQ4A 2JATA 3FPEA 4HAUA 5KOHA 4QVGA 4EKIA 2XVAA 2A6PA 1QG2A 1QHIA 3L1KA 1H42A 3WYNA 2ZSHA 3BAFA 1XTBA 1OFUA 2H9IA 2FQXA 3K8OE 3T0FA 4E03A 1KVUA 3ABZA 1VKHA 4JBIA 5J2TB 3F5QA 4WJKB 3FH0A 2EHTA 3ITEA 4L3VA 3PNKA 3RIMA 2CLDX 2B2CA 4CM1A 3DVLA 5AJYA 3C98A 4ZYXA 2PSJA 3CO5A 13PKA 2Q8PA 4D1YA 3VKGA 1TX4B 4D46A 1FFDA 2ZB4A 2HK8A 1E3WB 1WU8A 3D5QA 3GLHB 4JZYA 4X60A 3IEKA 5JWRA 4RJJA 1BYIA 1OI4A 5EQTA 4Q9LA 4LDAA 2BBSA 4R5MA 3TSCA 4U7PB 2F67A 4M7RA 4P1ZA 1REQA 2RIPA 3R3JA 4OREX 1F1BA 4WN3A 3TI9A 4XGQA 3IUMA 4PNHA 3V2UA 5BMOA 4X84A 5H70A 3SC2B 1V7CA 1KJWA 5HKLA 4DHWA 2ZIAA 3PF9A 4TVSA 3RUDA 5EC8A 3N74A 3H84A 1KVSA 2R7KA 2FF7A 1ZZGA 4Q7JB 1RM5A 3AJ8A 3RFFA 5GONB 1TJ4A 5HZGA 3SJCA 5BWBA 3D5EA 1XVIA 3WKAA 3D43A 3OSUA 1E3EA 1P0IA 4N9WA 1Q3KA 3QG5A 3KNZA 4YMIA 5AJWA 3RS3A 3W5SA 4X1OA 3VDRA 4G1BA 3QPDA 3D7MA 2WU1A 1U5AA 1WZIA 1M2JA 1T91A 2QJTA 4ISBA 4JJ7A 4LPSA 4MV3A 1X39A 2RHHA 4QOEA 5L3SA 3RANA 1R4MA 2IPXA 3A1WA 3DZKA 4H18A 4IIVA 1JV2B 5J59A 2QLJA 3O7MA 2H7CA 3OFSA 5JDIA 1E66A 2R6AA 3U6BA 4MR8B 3L41A 1F2VA 4C43A 2DHEA 2AFHB 4LCJA 5CT9A 3WQQA 3AM1A 5DIFA 4I6EA 4N5LA 4XGRA 3ZNPA 3A6EA 3F6YA 4M9UA 2ZWOA 1PP4A 4FSDA 1T5LA 4RFVA 1E59A 3HLTA 3RVMA 3ZBUA 1LBTA 3PD0A 1EMVA 1Y42X 4X92A 5EIEA 5DSTA 1NPTO 3ENWA 4P5EA 3NAZA 4PZDA 3V2HA 2C88A 2NSHA 1BNCA 5IASA 2B6NA 4G4SO 4XYGA 3SJBA 2IHNA 3PYXA 1SXGA 4TMZA 4HMOA 3RUFA 1Z7WA 4RIIA 5CW1A 1T15A 1C9YA 2G71A 5E6UB 3BMCA 4KRGA 1ZVJA 3AEKA 1PWZA 1E0JA 3IP5A 5JJBA 1K6JA 5L7TA 2ZANA 3QKUA 2YJ3A 4BLPA 2EBWA 1TAGA 5AKJA 1L0HA 3EXIA 4EHIA 1IE3A 4INOA 3JQBC 2HQSA 4MDHA 4W5HA 3FVQA 1B8OA 4A73A 4LF6B 2XXMA 3I2HA 4B71A 2AJLI 4GXQA 1AA6A 3PBKA 4H1TA 2R6JA 4LJ6A 4PR3A 1EXWA 4QJ4A 1NUPA 4RMIA 5KYUA 1AS2A 3THOA 2ZR9A 3VAZA 3WVNA 2MU1A 3Q20A 4TKLA 4BQPA 1SCUB 2ORED 1YR1A 1TQHA 1FTWA 1ZK3A 2BKXA 3BXXA 1KDPA 4O4HF 1HE2A 2BFCA 4W1SA 3EY9A 1H4QA 1V8BA 1NJ1A 2NSYA 4WZ6A 2YC4C 3HB0A 3MUEA 2HK9A 4LGYA 5CK4A 3OUZA 3TMKA 1EZZA 4FWBA 4J43A 4RETA 2F6RA 2JB0A 2ID7A 2XDAA 1E3QA 1W4CA 5F52A 5HRAA 1IYZA 1LNQA 3PE6A 4P3YA 2OCXA 4G5SA 4D3FA 2QUZA 3QW2A 5DM2A 3HGQA 2EW8A 4G8CA 5HIMA 4LSWA 3OC6A 1GZDA 2VQEB 4X8HA 3UOWA 3HU1A 2X7JA 5AUPB 3DZJA 2ZRHA 3BXOA 1JIJA 2C4NA 1QR6A 4PC7A 1EP9A 5BRAA 3E7XA 4REQB 4YN3A 3DO8A 3NC0C 1CHDA 3KEGA 2IZZA 821PA 4OLBA 2ENUA 3H6GA 1VQ5P 3NEAA 4JL8A 5AP9A 1ENPA 3JWIA 2JDIA 5CFPA 1AQIA 1P81A 2V74B 2GERA 2Y1XA 3FUTA 3H9GA 4YT4A 2VNAA 1NSYA 2F43B 3KOXA 4X1YB 1GL9B 2J3QA 1P3DA 3KVYA 4MVYA 5K3FB 4M6WA 4N3CA 1OB2A 3NM4A 3DZBA 3MN1A 2P9JA 3ANYB 4PANA 5C81A 4BO4A 2JD1A 4F6LA 4I0WB 3FWHA 3MIIA 4MUNA 1Z6YA 1SBNE 2AFRA 2YY7A 4JBWA 4TTPA 3UJNA 4A2PA 1YVPA 3FIUA 3PUIA 1KPGA 1N5RA 4RLSA 2VLPA 4HL6A 5TQ2B 2EKQA 3EDOA 2A1TR 3AHIA 1ZWKA 3JWPA 4QQFA 1V5EA 5KC8A 3KR1A 3KHSA 4C7VA 2BR4A 2GK4A 2OV1A 3D7NA 2JIBA 2NYRA 4N3BA 5G3YA 5GM2A 2CNDA 3B89A 2EJBA 2R8XA 3FHCB 5JNVA 1SQ5A 3ZXSA 2XD9A 1PFKA 3IOMA 3VO2A 1JR2A 4HDSB 4Q7LA 3UMCA 5BVGB 4JI8B 2A4MA 2WKQA 4J0QA 3D59A 3TRIA 2PCJA 5SYMA 1EAMA 1K68A 2DLNA 2J5QA 4PC1A 5F1OA 2CFOA 3K2EA 4HFMA 4ILKA 1Q2UA 4MPDA 2Q6TA 1PWYE 3PEUA 4HFJA 5AR1A 4C21A 5B55A 4ESVA 5E6RB 4JQSA 3KT0A 1TCVA 4R31A 2PWBA 3O8OB 2C1EA 4Z6KA 4ENQA 3HBMA 3WS7A 1H3FA 4LSZA 4MWSA 4FOPA 4OBXA 2X86A 2C5SA 4P7KA 4OGGA 4RO0A 2ZJ2A 4H7KA 4HYEA 1H6DA 1UP4A 3FYUB 4EG0A 3DC2A 1EA7A 3AZPA 4QFCA 2PD4A 3T3PB 4E7OA 2H2DA 7REQB 4JA2A 1M34A 2Q2NA 4NRDA 5JCJA 1GJRA 2VFAA 4LNUB 5DX1A 4JUDX 2J9XB 1FVOA 3K2QA 4BRZA 3WLNA 3ZQUA 2HMTA 2FSVC 4KQ9A 1OLXB 1PX2A 2H5IA 4MO9A 2V7EA 2Y92A 3BXGA 5DULA 3T3MB 3ZE9A 4BN5A 5HP4A 3NH9A 2E21A 2AOWA 2XZLA 4B4VA 4OXQA 1ORDA 2OBMA 3PHLA 3TINA 3G5MA 4CLRA 1L5NA 4R8RA 3CLTD 2WG1A 2QAIA 3CX6A 4MAAA 1BXGA 2X5NA 3TLCA 2C0PA 1ZMBA 2WHEA 2B61A 1NVFA 1XZLA 4B6SA 1YCFA 1Z12A 1JKJA 4C4AA 2JAQA 2XQFA 3HY3A 5AQ1A 2NVOA 1Z17A 2VTDA 1KPIA 1S8AA 3BWXA 2JG3A 2JGFA 4LFAB 3DKPA 3RHTA 1DWUA 1WULS 2VNIA 5JJLA 2B7LA 5D5PA 2W6QA 2P3LA 1JQEA 3VR2A 3WJ7A 4ILEA 4R6WA 2QMQA 4GPZA 1DRVA 2RCYA 4ENUA 2FKNA 4YR7A 2XECA 1M7GA 2D6FA 2WNHA 3E22B 1E8NA 4IWNA 5IBPA 5JPDA 3BMNB 2YIMA 3LO8A 3EARA 4BBPA 2HHHB 4CR8A 1BYUA 1OGIA 1VRVA 1XHFA 3K8ZA 3W8EA 1P7YA 3GRYA 3V1LA 4GLLA 4DIDA 5B2FA 2LUOA 2I6TA 5I3ZA 1VKRA 3QOXA 1CNFA 5HV8A 2VRBA 3WNVA 3H16A 4P5DA 1KQ3A 2VPQA 3KIPA 4PLPA 3BHIA 5L7WA 2XCUA 1WBDA 3H6KA 5IYZB 1SHLA 4IQ8A 4HH1A 3I1IA 3B5EA 4AIRA 1AG9A 3I09A 4LC9A 1ENOA 5J1TB 4N54A 2UU9B 1QYDA 1O95A 2P41A 1J07A 4QA9A 2AR9A 2Z2XA 2IDZA 3L1VA 4FYWA 1G3MA 2QG4A 2TRSB 4FGSA 2PD6A 2J9ZB 2QP9X 2I8AA 3HVHA 5KOJB 3OW2O 2GDJA 3OOJA 5L6LB 3VR1A 2VWHA 4LJSA 2X2OA 1CF9A 2Q3JA 1SC4A 4ZGBA 1DIGA 2NU8B 1GXSB 1G60A 1E1RA 3MOSA 4JMLA 4V0MA 5FBWB 4KGZA 3M83A 1KMQA 1H65A 1PHPA 2JH3A 3PC8A 3U3RA 1PE0A 3SSAA 4BP9A 1XZJA 3GLIB 2QEXP 1HEYA 1UAAA 1SXJD 3EXHC 4YALA 5HKKA 2ZUEA 3PTAA 2NO8A 4FU0A 5KVAA 2B34A 2EZTA 4B1FA 3MT0A 4LXQA 4D9JA 4D0NA 2HSEA 1X7ZA 3F4BA 1EDZA 5SY4A 1D4AA 4IGAA 1CLUA 1Q1BA 3B53X 4XDZA 1L4NA 3PPYA 5ENVA 1G5QA 1P3Y1 1UOEA 2QD2A 3I2GA 3PUKA 4FFRA 1KO1A 4UFNA 3U1TA 5HEKA 4CQLB 2WMYA 4FGJA 3LUKA 1TIKA 3U3DA 3UOGA 3QVSA 4EGFA 5TLSA 1B8VA 1PEYA 3ZK8A 4B3XA 3NDPA 1QO7A 1BU5A 5KWSA 2FPUA 4QXPA 3VDMA 4C2TA 3QE4A 1P5ZB 3A9RA 4ND6A 3H0CA 4RF5A 1ACMA 4KXQA 1E7WA 1NUTA 4WZZA 3TDMA 4OP1A 4NATA 2OO7A 4UBKA 5EXDA 2HA7A 1GQSA 2VDPB 4PO3X 4AZ3B 4BNYA 4CPDA 1O97C 1PGNA 1Z4MA 2CHEA 2PBLA 1KOGA 1N0UA 2ZBRA 1AD2A 5C5EA 4PTLA 1C50A 1AA9A 5G40A 1JEYB 2UZ3A 4UBOA 1RTTA 3KLMX 1ODJA 4QO7A 5EIOA 4WJZA 3UAYA 1Y8RB 4CMEC 2O1EA 4PNEA 1K8ZB 3FZYA 2QTZA 3C8DA 1F0PA 3R41A 3F9RA 2OQIA 3UPDA 1E0KA 3I9NA 1ECGA 5COBA 3RTAA 3HRIA 3DDWA 3KPJA 3AHJA 3M9XA 4PQYA 4Z0TA 4A6XA 5HJ7A 4D5GA 1NQWA 2C61A 4DXDA 2QRGA 2ZJ7A 3RSSA 1IXZA 3C43A 4Y0AA 3QENA 4HEHA 4ZICA 1U2RA 1WQ4A 1HT3A 2E48A 4LYYA 3B7WA 5FA6A 5G4KB 2ZJOA 5GQSA 3N7UA 4KO3S 4LNAA 4GI7A 4Z8XA 5FPSA 3JAKA 4MQEA 2X2PA 3CUVA 2DFDA 2DQZA 3EHEA 3FGZA 3S44A 3FLEA 4MVCA 3VVLA 3GZ4A 5CLGA 3W4IA 4BQOA 1H9AA 3FTPA 2V6GA 3H04A 2AQHA 3HFRA 4BTEA 4TRMA 3HFGA 4BATA 4DNOA 1G6HA 4HRAA 1EP3B 3OEWA 4HO1X 2PR7A 4UVHA 2DFTA 3UOAB 421PA 4CF3A 1XTVA 1ZJ5A 2P2CA 4TMVA 1YJWP 1QWSA 1ZONA 2WIDA 4U5QA 3U9LA 1ZFNA 2IS1A 2BGIA 3K0EA 4UQLA 4QLBA 2J9YB 1S8NA 4D98A 2I65A 1W1UA 2WJYA 4R2WA 4TZKA 3EA5A 3I64A 1BHO1 5LBIA 1QBKC 3N3AC 3ETEA 3QKIA 1GILA 1QKJA 1Y9JA 3QEMB 2VYNA 1UFQA 5D85A 1BA2A 2HFJA 1Q1EA 4ZGWA 5KC9A 4LVOA 3FYTA 3IVXA 2V7QA 1RQLA 3FB4A 1YOVB 4EZEA 2B3TA 1H23A 3GFOA 4PO8A 1N2EA 5KB3A 2VWPA 4LGVA 2VWGA 3BIOA 1H5QA 5HMMA 5HX7A 3Q5GA 4N3AA 1Q91A 3AHGA 2PVCA 4HVLA 4KYIB 4JGBA 3RYCB 2R2AA 4PSAA 5FBQB 2FR8C 1UBSB 2WMOB 3BFPA 1JIUA 1ZXLA 4MRRA 2OORC 2DETA 1T5IA 4QPNA 3EMKA 4ZAVA 3TOSA 1L0BA 2BJWA 1R00A 1LNZA 3JQ7A 4OLJA 4Q47A 2X19A 5C8DA 4EUFA 2YC2C 1G59A 4KLAA 3E5MA 2JJ1A 1IPHA 3O4GA 4N6NA 3H9JA 5ADVA 2X9VA 1GKLA 3P2EA 4J07A 3TBFA 2A9KA 1OWNA 3IBCA 4Q3CA 2AD1A 2PXXA 2N9UA 5A0TA 4TMTA 5BQOA 2JIPA 1RCTE 2AJBA 5F7OA 1TC2A 2PUWA 2WM8A 4Q3NA 5F9MA 2GARA 4XIYA 1VMDA 4FIDA 3FOAA 2BFAA 3PCTA 3AUSA 1E3SA 3DFKA 4JITA 4AF7A 1MC4A 2I1WA 3C3CA 3ZCPA 1OCEA 4A2WA 2G9NA 3PQ5A 4NHEA 1N6NA 1WUIS 2PUAA 1A43A 4PIMA 2F3TA 3N59A 4XQGA 1O95D 1PU2A 4EVQA 1KNQA 1M1KQ 2Z5FA 2Q27A 3AG6A 3GG2A 3AUUA 1UMCB 4HQRA 3ADDA 1S1CA 4HF7A 3N2KB 1MGPA 3LY9A 6REQB 5JYDA 3JQAD 1BX0A 2E6UX 2PAAA 3E35A 4M99A 3ZHUA 2Z3VA 3L7OA 4JJKA 1JTFA 3TDKA 1JDNA 5SZJA 1OI3A 1WZUA 2H7VA 3QF4B 4YT2A 3X0DA 3G0GA 3UB2A 4OXNA 1Q82Q 1SCDA 3EDYA 2B3DA 1XEWY 4CKXA 5FI1B 5TGDA 1IAVA 1NR5A 1YDEA 2EL7A 1ESCA 3L77A 4ZIRA 5JIBA 2W2TA 3PG5A 2HGSA 4UVIA 5F5LA 3UK0A 4B4WA 5K0TA 2QTTA 5EE3A 3PUHA 3IQDB 4C4XA 5ADWA 2Y0EA 4PLGA 1Z5GA 4IIHA 1F8GA 4WV3A 2YBDA 1RBYA 1RMTA 2C54A 1AZTA 3GEDA 3RUHA 3DBLA 4QHSA 1FNCA 5JLAA 1R5NA 1E3MA 2V54A 1JB9A 5IG2A 4M1WA 3F7MA 3ZY3A 4BE9A 3DJYA 2AL7A 3D9QX 3ZV3A 2L4BA 1KD1Q 2FRVA 1T4MA 1YL5A 3H2IA 3O3NB 4MGEA 2OHXA 5I8ZA 3ZLJA 3R9XB 2WHXA 2IWRA 4COCA 4F4FA 3NHLA 5HM8A 3P9CA 1NE2A 4JDPA 4Y7DA 2CLLB 4J49A 9MHTA 1ADFA 2XF8A 4K6MA 4NC9A 4AKEA 4AY6A 1PJCA 2EATA 3ONNA 4F6RB 5ELXA 3ADKA 3HCWA 2JO0A 3ZKAA 1A7AA 2W2VA 3N8HA 4FGZA 2XXAA 5BWCA 2BFFA 3KETA 3AFHA 3EEYA 2Q5IA 2CN1A 2XYQA 4LWQA 2WWFA 4QXOA 5I9MA 3VC7A 2BV3A 4DMRA 4YYZA 3IUPA 4ZOLB 4AZ0A 4XSHA 2W2QA 3N7AA 4YCCA 1J09A 4Z3KA 1PFVA 2KPOA 2MDTA 2ZULA 2NV0A 1YTLA 4XLZA 3AOEA 3C8HA 4ZAXA 4RPGA 1IHXA 2PT5A 1YU9A 2C84A 5EHIA 1G66A 2Q5FA 3MC1A 3PC4A 4O4IB 4AS2A 3BB4A 4DXHA 1XZDA 1VQLP 3IQWA 5I7EA 2OHGA 3TTUA 2ZYHA 2FNAA 4RY2A 4A16A 3M34A 1LGYA 3JVVA 4TL6A 2FSUA 4KUEA 5DGCA 4DA9A 1PEDA 3K2BA 5IZCC 1N8KA 4KIJA 4OK6A 2RAPA 3KEOA 5ILGA 4OXKA 1K3UB 3WWYA 1CEQA 4U7JA 3AR5A 4FCVA 2ZRMA 4PG6A 3HB4X 4ZANA 1UBJS 5DTRA 3G26A 1UXHA 1PRYA 4CEJB 2VHYA 1IZ9A 3ABQB 2QL6A 1NNSA 1OKKD 2N3ZA 2PK3A 4P92A 4F4CA 1GUYA 3QU7A 4Z86A 4CKWB 3LQ1A 2KYRA 2X3UA 3E58A 4H2DA 1WMFA 4KAJA 3MS7A 4KXVA 1NJ6A 4D44A 1SG6A 1LUAA 1V4BA 2VPYA 5DI9A 4LHXA 1BX3A 4TL8A 1QYXA 1FYVA 1ULTA 5YASA 4A26A 3A1NA 4E70A 5IXYA 5FQNA 4BYMA 1Q1AA 3WV5A 4MWBA 3CRMA 4W5OA 2E85A 1WPQA 3CX8A 3O0DA 1HT2E 3VU3A 3KC2A 1KDOA 1B43A 1FUUA 1Z4LA 4YJ2B 1ZH8A 4EB6B 1FUIA 2IU6A 3H1TA 3A9SA 4LE1A 3IXQA 1KJ8A 1V11B 1P0QA 3AU9A 5K8UA 4DZTA 1E61A 4OAPA 2QRNA 4RADA 4KN6A 5DHQA 1RWOA 5CX1A 1P31A 5DV9A 4GRIA 1Q6YA 3BORA 2YYZA 3CF0A 1XZBA 1QX3A 2BW0A 2EXXA 5LKAA 4GECA 2NO7A 3O2SB 3E8MA 5GGYA 1QNFA 3B1JA 3B6KA 5DLPA 2QG9A 3CNLA 3WGQA 4W82A 3CCVP 5IS2A 2XX3A 4KI0A 3PQ7A 4YV7A 3SHWA 2BLNA 1SEVA 1GQRA 2GCOB 4CR7A 2QT9A 1T4GA 4K5QA 5JBQA 2UZIR 1NYQA 4QO8A 4AWAA 3R2JA 2ZSEA 4N5IX 1ZM4A 5FTLA 4RD4A 4RK6A 1UPCA 2PRIA 4ZI7B 5EJ5A 5H8WA 4BX0A 1RWBA 1KO4A 3PPIA 1YRAA 4J4BA 4MVJP 1LZLA 2VUIB 3EVAA 2F3RA 3WR5A 1HEIA 4WKNA 1Y6JA 2FHPA 3LZ6A 3R23A 4JL5A 4Q05A 4WTOA 3SQNA 3U26A 3RAFC 4PN7A 4YCSA 1YAJA 4KWTA 1UAYA 4RH3A 4YP6A 4OGLA 4UZEA 1V1MA 2ZZKA 2A0KA 5C4MA 1M74A 3MGCA 1D2MA 3RK4A 2IPOA 1VB5A 4Q9JA 3N6XA 3LNCA 2X5XA 1RQXA 4O2BF 3L8FA 2Z4RA 2OY0A 3QX8A 1GL3A 2HLHA 3KAPA 4DG5A 5A9SB 5KI6A 1WSDA 5TMDA 2BF4A 4FFDA 1KSFX 4KACA 3AINA 4QT4A 1ZISA 3E5RA 3FFAA 2FHSC 1YQQA 2VRNA 3F5DA 4GMFA 1G291 1Z2NX 2R7AA 4PQFA 5G53C 3H47A 4ISCA 5LUBA 3D8SA 1YQUA 3MMXA 3PZRA 4G65A 2Q5EA 4UTVA 4M8LA 1QF9A 3ED1A 3LVFO 4Q01A 4KDEA 5K3CA 3R9IA 1Z5ZA 4XM2A 5AWFC 3A4LA 2X58A 1C9JA 4KN8A 3KYCA 4MGIR 1NQUA 3OA0A 3DEJA 1HDGO 4QXAA 3ZZ1A 2CSUA 1MRZA 1U7OA 3TQRA 4E12A 5HOQA 1KQGA 2JEZA 3WNZA 3B9BA 5L3QA 1W4RA 4H7JA 1GDDA 4JC0A 1NXVA 2YN2A 1PK9A 4Z7JA 3IPAA 2VAWA 4NQZA 1YQGA 1YDMA 1JA1A 2BM8A 1ATIA 2QM7A 2CLSA 3C7AA 1WEKA 3JWGA 1UM9A 2KOPA 1TJ5A 2IZ6A 4B76A 2C2YA 1SZJG 4Q4LA 2P1ZA 4L0QA 3NYRA 1DX9A 2IOHA 2SBTA 4FI3F 4FN5A 4LZPA 3G9XA 4OOFA 2J0UB 5FLXA 1TPZA 3FBGA 5E0OA 3G85A 3PLRA 2PU7A 2R7NA 1RXUA 3FRIA 1RRVA 3WTBA 3ZS8A 2P9TA 1AC5A 2BGGA 2HU2A 1U3GA 4X6YA 2NV6A 3QKWA 2N6ZA 1GR1A 4GH5A 4YGXB 2O7RA 4HD8A 2I4OA 4GDMA 3SKVA 3L7KA 4MGZR 4RV4A 4DHEA 3PLAE 4QXQA 1AMNA 3EF3A 1ISGA 2JJ2A 3U17A 4GC5A 2JFGA 1HG0A 1TQDA 2E87A 6LDHA 2BMVA 4PU0A 3KYCB 2CZCA 1J5XA 2F9FA 3K32A 3PIIA 1WRBA 4J91A 3ZLVA 3EVBA 4KL8S 5AQEA 4RDCA 1XTSA 1YCGA 2VTBA 3ZTTA 5HZMA 2PTHA 3HHPA 2K94A 1QV7A 2GDWA 3R5KA 4L5CA 3T1YB 3O8RA 3LFHA 1XNRB 4OKSA 5KYXA 1DO2A 1K73Q 1JSRA 3D1VA 4G86A 3MK31 4WKCA 2EIHA 4EYEA 2QRVB 3GYGA 4E21A 1IUKA 3U6KA 4Y2YA 4N47A 1JMKC 3HPRA 3JARB 4W5WA 1X1AA 4YFVA 2HF8A 3G68A 2C77A 2O48X 2IA5A 2M9MA 1SPXA 1YFZA 2C59A 5ILOA 2FVEA 3V00A 4QM6A 1I4TD 5ALPA 4LBYA 1EXNA 4A5SA 3DLIA 4YO7A 2H4WA 1W52X 2MINB 1MABB 5FL7D 4KZPA 1J7KA 2AGVA 1AOXA 2W83A 3EGWA 5KEIA 1SUWA 2FK8A 1U31A 1RPAA 3WK6A 4CDMA 1N2BA 2E1RA 1WEHA 1WCV1 4A0FA 1XWIA 3GDFA 4ALIA 4ENTA 1F6WA 5K6TA 1E1RD 4DC1A 1XRSB 3PA6A 4DLRA 3I3SR 5KNBA 3B2EA 1D6MA 5IXJA 2AX4A 3BYZA 1GCOA 4YXWA 1P5JA 4K87A 5FLKA 2P75A 3PGJA 4HAVA 1ILWA 1ZNYA 5JSUA 2BR3A 4GX1A 3MWEA 2C5EA 2GM5A 4KG7A 1VLVA 2K0DX 3AKCA 4GE3A 3HB7A 3LC1O 1UJ2A 4NFYA 5AJXA 3EX7C 3QEAZ 2PVPA 3RB8A 5A5FA 1JHVA 2P6RA 3QPBA 2E55A 4NJMA 2EYUA 4N0PA 3IAAA 1XCBA 1LKZA 4YRFA 1BWRA 4QL3A 3C85A 4Y30A 5FR2A 3W0LB 3T3IA 5K0GA 4AY4A 1E79D 1G55A 3DHEA 5B53A 1PFGA 1KDVA 2IOFK 2QNIA 2VOEA 5HOEA 1MAHA 3OHPA 3ETLA 1XZKA 3EGEA 1NULA 4RLHA 2AEJA 3AESA 4COPA 3W5IA 3WISA 4JCOA 3IIIA 2RH5A 1QB7A 4YS6A 3BIFA 2QBYB 3G0VA 4RF4A 4G63A 3G2NA 4JU8A 3VOSA 3OQNA 1H1DA 5EQJB 1V7PC 4B3SB 4TWZA 4Y9SA 1ZKMA 3DF7A 1JAHA 1GCGA 2JJMA 2I4RA 3LG2A 1QIJA 1Q0UA 4IHAA 1UC9A 4R3NA 3C4VA 3IQEA 2NZJA 4BO8A 1N6LA 2R6HA 1ZI9A 1XRRA 4M4SA 1K66A 5ES3A 5AK0A 3K20A 5T6BA 2FMUA 3SY8A 3CLHA 2LR0A 2DTDA 4HVTA 4MUMA 2BFBA 4OFBA 1HNNA 2CE7A 2GD2A 1GRCA 4QU0A 5FWXA 3X1ZA 4Q9DA 3QMWA 4DM7A 2F1JA 5KTPA 4QYTA 1B6GA 1E4YA 1DMRA 2OTCA 3IP8A 4D9KA 2L19A 2QZSA 4M1TA 4K9SA 1JJAA 3C3YA 5ECGC 3WA6A 4A8PA 4MRMA 1YQEA 2WFZA 5H83A 2I3AA 3WLHA 5BW8A 1WKVA 5F3RA 1WD5A 2PT6A 2R86A 4JFRA 4U0CA 2B1QA 3GP3A 1ZRSA 4JYBA 5DRYA 4D0RA 4EJ0A 1J5PA 1QG6A 4FR5A 4DV2B 3PL1A 4N82A 5IABA 4EABA 5B6JA 1Z5VA 1J2UA 3LDFA 3DWFA 3HR7A 4OLFA 2QQGA 4PYMA 1JYEA 1P2UA 4MWDA 2IV2X 3CVUA 5IBQA 4BB0A 2L82A 2Q3FA 5C37A 2YL2A 4IOJA 2YHBA 4KC0A 5LPNA 3VA7A 1YF3A 5JNWA 5CAEA 4L8GA 1RMQA 2CV2A 1J9GA 2AZMA 5K3AA 1XC7A 5BNZA 2O8DA 4MYDA 4QOIA 4YCJA 5A71A 4X41A