2EG5A

The structure of xanthosine methyltransferase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
354
structure length
344
Chain Sequence
GDTSYAKNSAYNQLVLAKVKPVLEQCVRELLRANLPNINKCIKVADLGCASGPNTLLTVRDIVQSIDKVGQLERPTIQIFLNDLFPNDFNSVFKLLPSFYRKLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLQWLSQVPSGLVTELIGTNKGSIYSSKASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCICKGVELDARNAIDLLEMAINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCIVEEEGSFEILYLETFKVLYDAGFSHIKAEYVASSVRAVYEPILASHFGEAIIPDIFHRFAKHAAKVLPLGKGFYNNLIISLAKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthosine methyltransferase
publication title The structure of two N-methyltransferases from the caffeine biosynthetic pathway
pubmed doi rcsb
source organism Coffea canephora
molecule tags Transferase
total genus 120
structure length 344
sequence length 354
chains with identical sequence C, E, G
ec nomenclature ec 2.1.1.158: 7-methylxanthosine synthase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03492 Methyltransf_7 SAM dependent carboxyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.270 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2eg5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2eg5A02
1ZGJA 3EVCA 2V74B 1L1EA 5DX8A 2ADMA 4PYOA 2B3TA 4RX1A 1KYZA 5FTWA 5DM0A 2ZWVA 3BKXA 2Z6AA 3ORHA 4PONA 2PX8A 1R6AA 1AQJA 5K8VA 2UYQA 3CJQA 3KQWA 3KR0A 4RVDA 2DPMA 3LKDA 4IV0A 3G89A 3HA3A 10MHA 3I53A 2ZBQA 2JHPA 3TRKA 4E30A 3O7WA 2HNKA 1G8AA 1RI4A 1RJEA 3HVHA 1NW7A 2O57A 2VS1A 3M33A 1EG2A 1KP9A 3P2KA 4RVGA 5H02A 4CWAA 5K03A 1R8XA 4MQ4A 4PGHA 3UWPA 3FRIA 3JWHA 4A6EA 5K01A 4C4AA 5EEGA 5DM2A 2PX4A 4HTFB 4C05A 3GNLA 4B17A 2PXXA 5IH3A 3SXJA 4PYLA 3FTDA 1ZKDA 2OY0A 3P8ZA 1FP1D 1WG8A 5E9QA 4RTLA 2R6ZA 3T7SA 4XUDA 5CCBA 3NMUF 4EVIA 1JSZA 2I62A 4GC9A 1X19A 4U7PB 5T6BA 1UIRA 3LCVB 1FP2A 1NW8A 5LQJA 4KDCA 3FUWA 3A27A 1P1BA 4RTNA 2BR5A 1TW3A 3TLJA 3UBTA 5CM2Z 2F8LA 2P3QA 4KIGA 5DT2A 2IDJA 3NDJA 4UOEA 3GO4A 3FYCA 5C1IA 1Q0TA 4QQKA 2IH2A 3MAGA 4QDKA 1EAMA 5DM4A 5DSXA 3QV2A 5EQJB 2BZGA 2CMGA 2LD4A 2FHPA 1QYRA 3DMHA 5K05A 2VZ9A 3B3JA 1BKYA 4HG2A 4PYNA 5FWDA 1I4WA 5D1NA 1IY9A 4KW7A 1JQEA 2ZBRA 3PX2A 3FPGA 3PX3A 5HIJA 2NP6A 1NBIA 3PLAE 2AVNA 4CKEA 3FZGA 1X1AA 1KIAA 2GH1A 1JSXA 3BGDA 3EVGA 1VQ1A 2QRVA 1AQIA 3D2LA 2BH2A 2XYRA 1P39A 2JHCA 1YF3A 5CVUA 4YUVA 2YX1A 5FHRA 5EMJA 2V7EA 3OFKA 5HIIA 4M7RA 4X60A 4F85A 2G8NA 3KPUA 2YVLA 3BGIA 4HC4A 3TPZA 4DZRA 5K0FA 1WS6A 1BC5A 5DWQA 3HCDA 3OCJA 2K4MA 4GEKA 2VDUE 3P2IA 5GOZA 3GXOA 5E2AA 2AOVA 1P1CA 2ZFUA 5K0JA 4RTSA 1I1NA 1F3LA 2PXCA 3FTCA 3JWJA 4IWNA 3DP7A 1F38A 3PB3A 2ZW9A 2YXLA 2VP3A 4QQNA 5EVJA 4KIFA 1G8SA 5EIFA 2ZVJA 2QY6A 3GRUA 1IXKA 3R24A 3TM5A 2ZBPA 3M6UA 3R3HA 5LR6A 2PKWA 2P7HA 4C08A 3VSEA 3G2MA 3LDUA 4HGZA 1XCLA 3OZRA 3SX0A 3MCTA 3TM4A 2ZIEA 3DLCA 2GS9A 4PYKA 4M36A 4GQBA 4CTKA 2EJUA 2VDWA 3GU3A 4MWZA 4GBED 2PWPA 3P2EA 3CGGA 2NXNA 1VP9A 1NT2A 2GAFA 2Z6UA 3SSMA 4FR0A 3I5UA 1TPYA 4QPNA 1XJ5A 4RWZA 4QTUB 5E8JA 1D2GA 1DCTA 2XVAA 1VL5A 1SQFA 2UYOA 5LQNA 3A25A 1N2XA 3PFHA 2FPOA 4Z2YA 4CTJA 4EQZA 2IBTA 1QAMA 1VE3A 3ANXA 2Y1WA 1JG3A 4RTQA 5GM2A 2UYHA 3FPFA 2G1PA 3OU6A 2EJTA 4FSDA 5LQUA 2AZTA 1RI2A 4PCAA 2NXJA 3CVOA 2ZLBA 1G55A 3DR5A 4PYMA 4ER0A 3ERCA 5LSAA 9MHTA 2EX4A 3SVZA 4HSGA 4P7JA 3SR4A 3KR9A 1WXXA 4AZSA 1PRYA 3KQOA 2H1RA 3HTXA 2R3SA 4BLVA 2EG5A 3UA4A 3LBYA 3V8VA 1V39A 4DA4A 4QVGA 1SQGA 1NW5A 4E2XA 4FS8A 4QTTB 4BP1A 1UFKA 2YUIA 4HH4A 4OA5A 2GPYA 3UJBA 2C7QA 1U2ZA 3G5LA 2BR3A 2B78A 4HRAA 3A7DA 1JG1A 2VDVE 2ZWAA 4FSXA 4KWCA 1KPIA 5ERGB 4EKGA 4EMSA 3SGLA 4YUYA 2ZZMA 5P8WA 1QAQA 2H11A 4M38A 2ZZNA 3HCCA 4PIPA 3U81A 3P9NA 4C04A 1AV6A 5K09A 2OBFA 1NW6A 5GP1A 3GDHA 1O54A 1JQDA 1OR8A 3KQVA 3BZBA 5DLYA 3LCCA 1QANA 4HTFA 3FRHA 4ER6A 5FULA 4OBXA 3BWYA 3UJCA 3DH0A 2AOUB 3O31A 3NW9A 4LWOA 2JH8A 3MERA 3KU1A 4H0NA 3KQTA 4X63A 4BLWA 5F2NA 5DSTA 2ONYA 3KQQA 5CVDA 4ER7A 3SSNA 1DUSA 3UJ8A 4GOLD 2PBFA 1XXLA 3LDGA 5EHIA 3NVKI 2O06A 5EGSA 5E2BA 5CVEA 1ZQ9A 4G56A 5MHTA 3KPYA 1N7IA 4PINA 2NP7A 3IV6A 3DMFA 4PWYA 3RIEA 4OX9Y 3GRYA 1P91A 1EJ0A 3C6KA 1RJGA 3MQ2A 5EEHA 3NVMB 4CXMA 1D2CA 3NDIA 2DULA 3EEOA 3BT7A 3Q87B 5E1DA 1INLA 3CC8A 2G70A 1L9KA 3HA5A 3ELWA 1YZ3A 3KQPA 3T7TA 3THRA 4GC5A 5EZQA 3I9FA 2BM9A 3KR1A 3CJRA 2P41A 2AS0A 2G72A 3FUUA 1O9GA 3HP7A 3MTIA 4RVHA 1DL5A 2A14A 3LL7A 5EMLA 4C03A 1R74A 5K0GA 4RTRA 2AR0A 3EGVA 4FGZA 4XCXA 2C7RA 2IH5A 2AN3A 3EPPA 3ELYA 1FBNA 2HV9A 3E23A 1RJFA 2IDKA 1SUSA 3AXSA 1HNNA 3A26A 2HMYB 5KQSA 1L3CA 3G7UA 3C3YA 4WVLA 4XUCA 3UZUA 4RTMA 5EIWA 2I7CA 1Y8CA 3EMDA 3LECA 1R8YA 3KKZA 5IKMA 2FRXA 5BW5A 2N47A 5K0NA 5FHQA 1EQAA 4RV9A 3PT9A 3M6VA 3NWBA 1KYWA 4KVZA 4PIMA 4PNEA 7MHTA 3P9IA 2O07A 3FUXA 3LBFA 4RTKA 1H1DA 2NXEA 5CVVA 5GM1A 4PYJA 3BUSA 1NW3A 3P9CA 3G2QA 3RODA 4R6XA 2Q41A 5EMKA 5FA5A 5E8RA 4E2YA 4IV8A 4BP3A 2YTZA 3KPVA 4EKIA 4F84A 5LQAA 3MTEA 4R8SA 3FYDA 5KVAA 1YFJA 3TKYA 2QRVB 2I6GA 4CKCA 2IGTA 2ZSUA 2QYOA 3DTNA 5HIKA 2UZ4A 3DLIA 5EZSA 3R9XB 3EVBA 2B2CA 3EVEA 3FUTA 2OYRA 5BXYA 3LHDA 5ICCA 2P35A 3HEMA 1NV9A 3DXYA 3ELDA 3C3PA 2AOXA 5FA8A 2OKCA 3QOWA 2XBMA 2HWKA 1SG9A 4AX8A 1L3BA 3SM3A 3DOUA 2PT9A 3JWGA 4OBWA 1XCJA 4O29A 2AOWA 5K0LA 1YFLA 3T0IA 3ER8A 4K6MA 3ID6C 4R8RA 3TFWA 1RI5A 2AVDA 2PV0A 1KPGA 3GGDA 3HCFA 4PYIA 4RYLA 5CD1A 2KW5A 2UYCA 4LG1A 1VBFA 1WXWA 3UFBA 5D1HA 5FQOA 3I64A 4E33A 2NXCA 3EGEA 3THSA 5K0CA 3EEYA 2CMHA 1JG2A 3R0QA 4YUXA 2Z6QA 4LECA 4ISCA 2E5WA 2FCAA 2PLWA 4XUEA 3BXOA 5FCDA 5LQRA 5T64A 5EOVA 4RTOA 4GUAA 5ICEA 3X0DA 1ZGAA 2B25A 1UWVA 5BP7A 5CUQA 1TW2A 2QM3A 4E2ZA 1MHTA 2ZZKA 3KPWA 4NECA 4AZTA 4PGGA 1YB2A 2PSSA 8MHTA 2JJQA 3F4KA 3JWIA 3FTFA 2AOTB 2YXDA 2BM8A 3BWCA 3B7PA 4X1OA 4QDJA 1Q0SA 2GA9A 3HCBA 3IYLW 2P3OA 3P97A 4CKBA 5M5BA 1RI3A 4MTLA 3GRZA 4MIKA 4OA8A 2ZCJA 4P7GA 4YMHA 2OXTA 3BWMA 3OZTA 3E05A 1WY7A 3B89A 3HCAA 4QPPA 2P3LA 2AOUA 5DPMA 3K0BA 5EPEA 2OZVA 5DRTA 2NYUA 1G60A 2CWWA 2PJDA 4E70A 3UJAA 1JR4A 2HTEA 3L8DA 1NE2A 3GRRA 4FP9A 5EC8A 4JXJA 5GWXA 5EG5A 1HMYA 3ME5A 2JHAA 1SUIA 4DCGA 5GIOE 2WA2A 3DMGA 3PS9A 3ELUA 3OU7A 3Q7EA 2XYQA 5HEKA 5FADA 5E1OA 2B9EA 3C6MA 3GCZA 1XDZA 2PVCA 3KPJA 1SVUA 4YV2A 3VC2A 4FT2A 5GINE 4P7KA 2PX5A 3G2PA 5LQCA 1N7JA 5T67A 5K0EA 3G2OA 1FJXA 2PWYA 4RSRA 1JQ3A 1X1CA 1VPTA 3QOXA 3MHTA 1RI1A 1I9GA 3O4FA 4U7TB 3EVDA 3GJYA 3MB5A 3CJTA 2IFTA 5F2KA 2ORED 5FWAA 3PTAA 3PFGA 5HZMA 3HA7A 4FT4A 1Z3CA 5E1BA 2YQZA 5DTRA 1G38A 2Y1XA 3M70A 3TOSA 2C7PA 4MHTA 3BWBA 3LX6A 2XVMA 2G71A 3C0KA 4YMGA 1XVAA 5DX0A 5EHGA 2FK8A 4PCLA 2P1DA 3P9KA 2QE6A 4P7FA 3SMQA 1XTPA 3AJDA 3OZSA 5GIPE 3LCUA 4HGYA 5CIYA 2I9KA 2IPXA 4R6WA 3LPMA 1XDSA 4EK9A 2JH9A 3OE5A 5C9ZA 1NBHA 4DF3A 4YUWA 3HCEA 2BR4A 2FK7A 2H00A 5E9WA 2ZIFA 1VIDA 3KQYA 3EVFA 4QVKA 5K0BA 1R00A 2IIPA 4ATNA 1D2HA 3NJRA 2P40A 5DXAA 4V0QA 1BOOA 3BKWA 3B3GA 5HILA 5DM1A 5DTMA 3DULA 3FUVA 3REOA 5B1SA 2JG3A 4GOOD 1WZNA 3CBGA 1M6YA 3LGAA 2YR0A 3EMBA 3LKZA 5DX1A 4ER5A 3PVCA 2OO3A 5E9JA 3KHKA 5C0OE 4DCMA 5HIMA 1SKMA 3NTVA 2ZULA 4GOMD 1JG4A 3G8AA 2GLUA 2PXAA 2YXEA 1O9HA 1QAOA 3AY0A 3DXXA 3G88A 3G8BA 3V97A 4GOND 4RTJA 1VP3A 2OB1A 1NV8A 1YZHA 5CVJA 3TKAA 4DMGA 2ERCA 2ONZA 5BW4A 5HFJA 3HVKA 1QZZA 1BHJA 3LSTA 2XYVA 3M6WA 3GIWA 3MCZA 4L7VA 3T7RA 4AUKA 4YUZA 2WA1A 1M6EX 4DQ0A 2AN4A 4OQEA 3AWIA 4RVFA 1KHHA 4LWPA 4WXHA 4C06A 2IP2A 3P71T 5EKXA 4KRGA 2O0LA 3NWEA 2CKDA 3CCFA 3G5TA 3OU2A 5LQKA 1R18A 3EVAA 1X1DA 2WK1A 3M6XA 5HOQA 2O05A 3SSOA 2HR1A 5G02A 1XDUA 3I58A 4IKPA 4PYQA 3R6TA 4YV0A 4DKJA 3IHTA 3M4XA 3UA3A 5KS2A 5FUBA 2ZTHA 1EIZA 3FPEA 2IH4A 1YUBA 1X1BA 1ZHFA 4F86A 5CCXA 3EVZA 4E2WA 2IBSA 2P7IA 1PJZA 2AN5A 2OB2A 3FPHA 2FYTA 3A4TA 3OPNA 4ZTBA 3IEIA 3UJ9A 3UJDA 1M0EA 2PT6A 2C7OA 1G6Q1 5KQRA 1VLMA 2PY6A 4X61A 5JUWA 2CL5A 3HM2A 1T43A 4RTPA 1KPHA 4M37A 1AF7A 1ZG3A 3DXZA 5DTQA 4FZVA 5U4XA 3EGIA 3VYWA 1B42A 3ER9A 2PX2A 3AXTA 4P58A 4Y30A 5EMMA 3TMAA 3FPJA 4KDRA 4BY9E 2ZIGA 5JR3A 3HVIA 2ESRA 2P8JA 1KR5A 1JTEA 4OQDA 4ER3A 3BGVA 2EFJA 3OE4A 3KQSA 3B5IA 4C07A 4V0RA 3CKKA 4YV1A 2AOTA 2OPBA 2PGXA 5F2OA 3S68A 3UJ6A 4AZVA 5E1MA 3TR6A 3GWZA 4E32A 3HVJA 3FTEA 3GRVA 3WSTA 1MJFA 4Y2HA 3TQSA 3E8SA 3KR2A 3UJ7A 3B3FA 1IM8A 3VC1A 3H2BA 1NKVA 3OFJA 3A7EA 3KQMA 4POOA 5KYGA 4DM3A 2GB4A 5DXJA 3MGGA 4X41A 4R05A 5ICFA 3DUWA 4BLUA 3LDFA 1ORIA 5DRYA 5ICGA 3HNRA 4AZWA 4A6DA 1KXZA 3E7PA 1FPQA 5EKUA 4E31A 3K6RA 1EJ6A 5FQNA 1ORHA 1L3IA 2NNWB 1RJDA 1JTFA 3RW9A 4GF5A
chains in the Genus database with same CATH superfamily
1U7OA 4KB5A 4YWHA 4ASUD 4D4MA 1T8TA 2XNCA 4INZA 4BX3A 2Y67A 3PRYA 2H1HA 1JLRA 3QA9A 3BM5A 5H16A 5JEDA 4KPEC 1ZY2A 2UYQA 3FTNA 2C7BA 1T0HB 4RPHA 1M0TA 3WNCA 3HA3A 2NO5A 3W4KA 4BQEA 4JZYA 4WKBA 1GTL1 3IIKA 1MHPA 4QGGA 1NPYA 3NV7A 1QGYA 1RJEA 3KSRA 1KEWA 4Q1CA 4F7WA 1NQ5A 2I54A 2DQKA 2O8FA 1Z2NX 3AR8A 5C4MA 3FAKA 3PKJA 1JEEA 3COPA 1PK9A 3R77A 1E0KA 1HEYA 1U2GC 2EXXA 1VYVA 3WLHA 3DFKA 1ICEA 3CXCO 1ILEA 1CUDA 2JCSA 5J3JA 3IIIA 4AS3A 4Y9UA 4E5NA 3ZH2A 2A57A 4I55B 5AW7A 3ZTWA 4DYDA 3LPAA 2J4FA 2A0YA 1TW3A 3H4TA 4QRIA 3WLOA 5CM2Z 2F8LA 2OAEA 5ES3A 4B83A 4ZCMA 1OIVA 4TTIA 5FUWA 5TEWA 3SD7A 3FYCA 4C4PA 1PLJA 1LK5A 4B7ZA 1ZEJA 3BFKA 3HI6A 2XECA 3QSYA 3RF7A 4H16A 5IULC 1GKYA 2VK2A 1JDBC 3LLCA 3C39A 4DBLC 2JI7A 4DLTA 1TVEA 3TUZC 2H1OA 5A0VA 4G8DA 3FGNA 2QM7A 3H2SA 1UH5A 2XOKD 4HLUC 3N2GA 4MKHA 3PX2A 3U61B 1BQ3A 1U9ZA 2V8BA 1EUCA 3K35A 2HKIA 1DAMA 3RRFA 3B51X 4BQQA 4KR2A 4KR0A 5TMBA 4EY6A 4KQXA 1GZ7A 3IRVA 3EZ2A 2XT1A 1GGJA 5U1PA 2GDXA 1DINA 1WSBA 2VPTA 3DEKA 3ENQA 2OM6A 3KHUA 3C1OA 4IQFA 3UCEA 1WCIB 3U7RA 1LI4A 1OPXA 2AF8A 3A2KA 2WTEA 1I4LD 3RR2A 1ODLA 1Y48E 3FNIA 5HUHA 3DCNA 1RKUA 3CUYA 4FC7A 3BTUA 3V8MA 4EG8A 1D4ZA 2WPNA 4RC9A 1RYDA 3UKJA 1LVUA 3GXOA 4OF4A 2OLEA 2ZGVA 3LQQA 1P7PA 2M1XA 4QD3A 2QW1A 1OX4A 4IWNA 5IBPA 5K0JA 1PUXA 1Z6TA 5KOJA 4TMTA 3R7FA 3UF0A 4N5MA 4JP5A 1EE2A 2XBUA 1IXKA 4KEAA 2BFAA 1F8YA 4TMWA 3TM5A 1LV8A 4HDCA 2CDBA 3EOBI 3M6UA 4RHFA 3VH4A 4BFZA 3TQCA 1CUAA 2NOAA 3UWOA 3DMDA 1ULSA 1QO0D 3PP8A 3U7JA 1KF0A 4IIJA 2ID8A 1SBIA 2Q3BA 3D1JA 3LDUA 1NOKA 1XCLA 5JROA 2P0AA 4O4IA 4XIIA 4YJGB 3TW8B 5FEUA 1A2KC 4DV1B 4NJMB 4AKGA 2DXIA 3FSGD 2Y4NA 3W8EA 1NVKA 3AR9A 1I2CA 5KX5F 1RQ2A 2P62A 3P2EA 1Z5UA 1Y3CE 1Z6PA 3FKSA 3KKNA 4G1MB 3PXDA 2JYGA 3O8OA 2LXNA 1RPNA 4O1HA 5TJHA 2R6CA 3SHTA 4YUAA 5LIPA 1S1CA 4MWSA 4B3CA 1YKGA 1W36C 1G6HA 2AWOA 1DMSA 1MXFA 3ETCA 2YICA 1YAHA 4IHKA 4ZT3A 3JWEA 3K1TA 2XUPA 4NU0A 4QWWA 5JCOA 1XQXA 2HA5A 4OHXA 1VE3A 1XYVA 2I1QA 2I6SA 3OO1A 1JALA 5D5QA 3EQ6A 1RE0A 3JQAD 2EJTA 4Q4JA 2W4IA 2W6CX 2XJ4A 3ZQKA 2OORA 2D2EA 3CRVA 3OTGA 5IJ9B 2O3JA 5E7MA 5CFQA 3VPCA 2RHWA 4IZ6A 3TVYA 4AZSA 2VDPB 3OPYA 1SY7A 4BNMA 3IEPA 2QTMA 2EG5A 1BMTA 3GUHA 3H7AA 3V8VA 2IV3A 1NVAA 1IXSB 3E81A 3LL4A 4PEVA 4QTTB 1UFKA 1Z33A 3JAMA 2K2QA 4DB4A 4H7KA 5U4QA 2B78A 5ALSA 5BWNA 2VDVE 2KWIA 2I34A 1Q12A 3MTGA 4JU8A 4Y0NA 5L53A 1V9CA 3IPYA 1RQLA 5KOHB 3L49A 4LDZA 5CEFA 4C04A 2RGNA 2WKSA 5IVDA 4LWZA 2R6FA 3G17A 3HDVA 3L0PA 3QUQA 4AZ0B 1O54A 4RQUA 3IP7A 3BZBA 4U3JB 2A0KA 3CZMA 3WMGA 4DYHA 4EUSA 4IQ8A 2W2KB 4CKBB 1XTVA 3EPHA 4I5EA 2QTHA 3HHEA 2QTRA 1L5MA 2BCGY 2R1ZA 4DT1B 1Z75A 3GGCA 4NBVA 1H9AA 5CT4A 4PQGA 2V9ZA 4LWOA 4D9EA 1EK5A 1FL9A 2YUTA 4I46A 1U0HC 2YXBA 3EWIA 3LG2A 3ZE0B 3L01A 1CQJB 1I13A 1OMOA 1QBKC 3DZIA 3IKLA 4MHSA 3KZNA 4U7JA 3W2EA 4IM7A 1Q22A 3L93A 5DCUA 1MT3A 1Z2CA 1YVUA 2EEPA 2VDJA 4O4HB 4WXMA 4TRJA 3W7AA 3FVRA 2R1VB 3KYCB 4Z4IA 3LDGA 3FM9A 4KNWA 4WZBB 5GVRA 1SIOA 3RYIB 3MYRA 4Q3CA 1K7YA 3DDNA 4G1BA 1W4RA 3W77A 4EB3A 2XQIA 2XW6A 4KU4A 1CY7A 3P19A 4JENA 4Z9YA 3RVPA 3DS2A 1U5AA 4KXNA 3JTEA 5AR1A 3SFVA 3T7JA 4TRRA 4P34A 4QUDA 2YBEA 3MQ2A 4IFIA 5BSKA 2IKQA 1II9A 3EGWA 3LC1O 5FLYA 1TO2E 2HADA 5AM5A 3NJ4A 3SF0A 2G70A 2XD4A 3EISA 3MJSA 1YNOA 4GI1A 4PFKA 4UBOA 5BNFA 3QKTA 3I9FA 1O87A 2OR3A 1PZMA 3ZDDA 3FMIA 1DL5A 3EQ7A 3A2LA 2A14A 4BKQA 5K0GA 2AR0A 2BGNA 1OWLA 1D2AA 5DNVA 5EP1A 4QDXA 1YB7A 3L0BA 2QW8A 3HEAA 3GGOA 4HDKB 3IR7A 3UAZA 1B8PA 3Q8KA 3LXUX 4FFMA 3RC9A 4HZUB 3T7KA 7GPBA 3C6BA 1MO3A 4RH1A 1RCFA 1TIPA 3ZCPA 2A92A 3G7UA 1U1DA 1J56A 1YI8A 2ZYSA 3GFPA 4NICA 1N2OA 2FN3A 3TJRA 3TQRA 1I7PA 4BPHA 2JGJA 3H1PA 1X7YB 4Q9JA 3JV7A 4UUBA 3AL0C 1FTWA 2GZSA 5K0NA 4PRYA 1NTRA 1Y1TA 4MWCA 4URUR 2G6TA 1IPFA 1KOLA 1J4AA 2REQA 4A4DA 5DNUA 3GLGB 3BFPA 1T9GR 3GJRA 4JC0A 5MN4A 2GEUA 4RDCA 1AHNA 4FM9A 4W4TA 3FDZA 1SELA 2IYLD 4H9GA 1V4BA 3F8SA 4F4DA 1GL7A 1RQRA 1U8ZA 2HK9A 1NNLA 4LMBA 2FZCA 4AO8A 1TU3A 5TNXA 2B4KA 4DIOA 4QJ3A 3WQBA 3GFFA 2D5LA 2WDPA 3OPMA 3KDPA 4AY3A 5I9MA 1AUVA 2JEYA 3LUBA 4YQEA 3K1AB 1Q82Q 2Y1CA 3CLUD 4BKPA 2B99A 5AXCA 4ZCSA 4UFNA 3R0ZA 2OD9A 2SKDA 3L8GA 3NEYA 3G0DA 1F4PA 2GZ2A 3QRWA 4YT8A 1ZONA 3U4QB 4CA3A 3AHJA 4KMOA 4I4NA 4JR2A 3QLEA 1KK2A 4BQOA 2ECPA 3AMVA 2ZYVX 1QK5A 5HMLA 2JAOA 2QY9A 1DZ3A 4R2HA 5FXMA 3CCQP 4OEHA 1J1ZA 4DV3B 1C2YA 2O9JA 3OCCA 4P32A 4MAMA 5AXDA 4B4WA 3ZVLA 1IPEA 2AVDA 1QX4A 4BNKA 2BEVB 1SZPA 3I1FA 3R6DA 1KSFX 2LBPA 3KB8A 4WKNA 2GESA 3CRNA 4NABA 1YSCA 4PU0A 1A7KA 3DVSX 4X8LA 5L4LA 1R1DA 2LIPA 4YYEA 3HVUA 4AURA 3QKSB 3RSZA 4C7KA 1FS4A 4B47A 4EHAA 2V3WA 3UNXA 3SU8A 5JNLA 2JD2A 1W0CA 1H0KA 4Y6RA 3I9V6 4H7DA 4ISCA 4LC0A 4AP9A 3IE1A 3DWFA 2R25B 5ICEA 1TRHA 4E5YA 2DR2A 4LZAA 1TYZA 1JHPA 1HT3A 4URWR 4F1KA 4RHUA 1EE1A 4LA4A 3BA6A 3IP5A 1GQRA 3PPIA 1H0RA 2I22A 1ISRA 2IL1A 3QBVA 3PIDA 1ZAYA 2KOQA 4GZ6A 4TLCA 2KWLA 1RJWA 3M5WA 2ZKIA 2WG1A 2AOTB 3AO0B 2P2DA 3T8YA 1GN8A 5HHTA 1OHHA 2YIVX 3DZKA 4YJ3F 1ZA2A 3T95A 4H1WA 1Y3AA 3KTAA 2LGJA 4K86A 1NFQA 4UHFA 4V0KA 2ODPA 3R74A 2WWFA 5JLJA 1PUIA 5BN3A 3EY9A 5C5EA 3HZQA 5HS4A 2PAFA 2YL2A 4FYVA 3K0BA 1QCYA 4INOA 3ZNOA 2HA0A 3NX4A 3GCWA 2R66A 2W71A 3WJ2A 4ZHQA 5AVZA 5LQDA 3L8DA 1J2JA 3F5MA 2AI2A 5EG5A 4ZTZB 1XAHA 3RG2A 1H1LB 5F1OA 3N2KB 3GCXA 2HPHA 4ZK6A 3RC8A 1W8DA 1K0FA 3G02A 4TKVB 3K6SB 4YRDA 4AN0A 2AX3A 1NSFA 5SYMA 1KEEA 3H2IA 1XVUA 3TLMA 4AMZA 3OQMA 2F43A 1TTHA 5LP6B 1OV6A 2YDXA 1Q1QA 1YOVB 4FOPA 5JNWA 4RLSA 3IMCA 2D1FA 3DBRA 3DTVA 3L6EA 3LA8A 4QU0A 1GV1A 4NXMB 4ID3A 2FW9A 2QAJA 5JI3E 3Q6IA 1OXVA 4PRLA 3VOAA 3H0DA 2FEKA 2RHJA 2XYPA 4Z8YA 3TLKA 5JATA 2XVMA 3UB3A 1CHDA 1Z36A 2RGAA 4P92A 1UKBA 1XVAA 1YKFA 4CIDA 1EU1A 1OXTA 1JYFA 1XZIA 2FFAA 3SSAA 1E8NA 2P65A 4P7FA 5LNK6 5D86A 1PS8A 3UB2A 1A98A 1SB9A 2C1EA 5FBRB 2PG3A 2GLTA 2WD7A 4Z54A 2GUGA 3OE5A 4H7FA 1RLJA 1UM8A 2WC1A 4Y6GB 2FEAA 3RS2A 4B4OA 4CLRA 1N57A 2E4ZA 4RPGA 2P6PA 4E13A 2Q2WA 4QVKA 1XTTA 6REQB 1GNLA 1VYTA 3EZGA 1X1QA 1IRIA 1GQYA 2P9YA 1NXTA 1V3UA 4IW3B 4V3CA 5DWDA 5DXAA 2Y6UA 4ZAWA 3NHSA 2XZOA 4N3AA 5FUYA 2C04A 3HEBA 3IMFA 3KYJB 2BFWA 4MCHA 4NZ9A 4Y1GA 5F73A 5J4VA 3F73A 1W2GA 2XE7A 4WA8A 3ISTA 3BDIA 3T1NA 2YR0A 4GPTA 3RYTC 4N3BA 3TTUA 5CLFA 1L4MA 1TJNA 2JAQA 2XR1A 3PVCA 3UGJA 1EUQA 2ZVQX 1M83A 3G0IA 5BSHA 4R68A 3OURA 4TROA 4RYDA 4HKGA 1AG9A 1MAUA 1ZSNA 3CE6A 3KWJA 4HDSA 1AE1A 2E21A 4J3JA 2B0JA 3EFOA 3EAQA 3D3WA 2GK6A 4ND6A 1NVUQ 1RWVA 2KBFA 2ENWA 3NO4A 1YBMA 4QU8A 421PA 3KZMA 1USKA 2AMYA 2WFLB 5DHAA 3SYTA 3VDMA 1T2NA 3CVXA 1Y8ZA 3P71T 4YJFB 3OU2A 3OAAA 1XA3A 4KMMA 3LGSA 5IVPA 5HOQA 4A6PA 3SSOA 4JOSA 1D2MA 4BC1A 1Y8QA 1Q1AA 1T5IA 1P4AA 1QPGA 1UZLA 1E2JA 1TM4E 2XGOA 1T4MA 1XKXA 2I33A 4HQNA 3RT1A 2V7QD 4EVQA 1PJZA 2W6MA 4ECEA 4PLGA 4U9HS 2QZ4A 3A4TA 5EE5B 1M6VA 5H68A 1EWVA 4NBKA 2I5PO 4Q9HA 4BZZA 4CQNA 1EX1A 2FR1A 3VSAA 5EJ8A 3RYCB 4GT1A 1F7VA 2EFDB 5I01A 4D3SA 4NAVA 3KU4A 2H0RA 3KYDA 3D6HA 1DT5A 5ALHA 1ZG3A 5GY7A 3RS9A 3V9PA 5U9CA 5ESWA 2YNMC 1CETA 1Y81A 3JRXA 4DSUA 3L6DA 4FXOA 2H1SA 3D8RA 4WINA 5K8IA 1B43A 2XVXA 3JVVA 3IMGA 1T2AA 2Z58A 3E7XA 3LNCA 3N3BC 3QXGA 5F5XA 3ZE2B 2MYUA 4WOCA 5F78A 5GJCA 2JGKA 2XV1A 3TR6A 1R8JA 1S8NA 3CF0A 3GRVA 3WSTA 4JOBA 4NMXB 1G41A 3VMMA 1XL0A 3P2JA 3W1VA 2BGLA 4POOA 1ZINA 4J0FA 2QN2A 4J0KA 4XVQA 5E6SA 4I4IA 4WMLA 3I92A 2K0DX 5BS2A 5ICFA 4YCMA 4ZTUB 4EDFA 3FCOA 5DI3B 3C3EA 2QG4A 2ZYUX 1FFCA 4C7XA 2EW1A 2OXRA 2C5SA 2VJNA 2QTLA 3RVDA 3WV5A 4GL4A 2ROQA 1LBTA 3KV1A 1PT9A 1OWNA 4H7JA 1OI2A 4ILEA 1PT5A 4AG6A 5EZYF 1MIOB 1XZHA 1XVVA 1S1MA 2ZJ3A 3OKCA 4HWOA 2GNOA 5A04A 2K94A 4V3BA 1X38A 1E6CA 1YWGO 1QFZA 4CF4A 2PO5A 5AVYA 5BOSA 3ONWA 3G89A 2I8AA 3I6IA 4KQ1A 3PHHA 1P33A 1E5TA 2ZBQA 3ACCA 3ZNPA 3TLCA 3T9CA 1I5EA 1VMKA 3PDIA 2BKEA 2VS1A 2D2VA 5HJEA 1REQA 1F2UA 1GXSA 3RIHA 4MW0A 5J58A 4XRRA 1LKZA 3EYAA 4C89A 1T3HA 4DS3A 2J7KA 3CLRC 3D5TA 1PJ8A 4HTFB 4WACA 4DEYA 5JBIA 3EXIA 3DTYA 4OI2A 2OY0A 4BTLA 3W2FA 7YASA 3KKKA 4I1SA 4XUDA 2HHHB 1GPBA 1HE5A 2O5VA 1X19A 4P4TA 2Y1KA 1H8HD 3RKRA 5LPNA 1XPRA 1FSSA 2FSPA 5IAAA 1JEYB 2FEOA 5L6LB 2C0QA 1Z12A 3B6KA 2QN8A 3GRPA 3VR5D 3D2CA 4ARCA 4XROA 3EXHB 1TRKA 5EFZA 4IDAA 3CV3A 3PEVA 4XPZA 1X74A 1HG0A 3GLFA 3DKRA 1AGRA 4FILA 4PZ9A 5DCWA 2HF7A 2CJYA 2CNWD 2VNKA 3KT8A 1IBKB 3LO8A 2VT3A 4OQMA 5AK6A 1R8SA 4MUKA 1H6CA 3ROFA 1J5EB 1FVOA 2R8PA 2QA4P 3EG5A 3I5XA 1AA6A 3H2YA 5ETJA 3T5AA 1GY8A 1BDBA 1JQEA 5SY4A 3WLKX 3KSUA 2C83A 3KHSA 4HPJB 4TMVA 1IIBA 4M0DA 1HYQA 3W6NA 2RBEA 2GCIA 3A6HA 2ZBGA 3NUZA 3Q3HA 1JHAA 3QUBA 1R4NB 4OPMA 4WBSA 3VHQA 1FU7A 1DQYA 4N47A 5CXUA 1DAFA 2GN2A 3WYCA 3TL6A 1WUJS 1AK2A 5K2OA 1VHDA 2ZPAA 3T5TA 1CF4A 1CDEA 1P3Y1 3CLTC 4OJMX 5A2QA 3EXG2 3EIEA 2PQMA 2LVBA 5DWQA 4IFBA 2J87A 3QE9Y 1XP8A 3DW1X 4X1KB 4LGYA 1OI7A 2BBSA 1UC8A 2ECQA 2VH5R 3AONB 5TGDA 3AT1A 3TZLA 4M1ZA 4RTSA 2IOQA 4KREA 3CKLA 3CB4A 3DP7A 1ZNXA 3TRDA 3F9IA 3H4EA 3N0XA 2QRZA 2FVYA 4BDSA 4J91A 4QBGB 5EXTA 2R2GA 3JYHA 2ZVJA 4M0UA 1EPUA 1AH2A 1S2IA 3ZK9A 1CQIA 1A82A 2QRUA 1G63A 2CB0A 1UDCA 4MNTA 5CLGA 5K6TA 1G9XA 2PH5A 3P0JA 3AYZB 3G2MA 5KI6A 4ENWA 3WBHA 1UC4B 2V55B 3FIUA 5DF1A 1I6KA 4R9RA 1V1RB 3ABIA 5DTJA 2VHUA 2XCRB 3ETGA 2Q1SA 4EGAA 1JQKA 3JQAB 1QYCA 4HATA 4MQBA 4EUEA 4Z4HA 3MTDA 2CN1A 1ZBQA 1KAGA 1P44A 1ZSYA 1KAOA 2CLSA 2NO8A 1P9NA 1KZ6A 1G64A 1UR5A 2HU7A 2I2FA 3AUUA 3IP9A 4MW6A 1RBQA 2EG9A 5FL7A 3CSDA 1HE2A 4H4CA 4DREA 3I5UA 2UKDA 3HV2A 3AVPA 5HV8A 1UFVA 5CA1B 4X6XA 4L27A 1C1YA 3OZCA 1E3SA 1E59A 3U44B 1VL5A 3GN2A 2FW7A 3HN6A 4D9KA 2R44A 5K7SA 2G80A 1YCFA 1NN0A 1DZIA 2B8NA 4ZEVA 4YJKA 1I2MA 2P2ZA 1L5QA 1U0TA 3BE6A 1XD9A 3NTOA 1F0NA 3A1EA 3JRWA 4OVKA 4ZAXA 1Z35A 1RI2A 4CHTA 4ZREA 5CB4A 1USUA 2PZGA 1W85B 3M4JA 5LSAA 5LOVF 2O7NA 3SVZA 5G0SA 1ULHA 1DVRA 1M5UA 3D6TB 2BWJA 4LZOA 4YRBA 1QYVA 4ZJUA 1NG1A 1R0XA 4FFRA 5HA5A 1LBQA 2ZVPX 5I7UA 2ZQYA 4DA4A 1CVRA 5DHSA 4Q9KA 3TN7A 2Y0PA 1QRAA 2PH7A 3C6YA 5L6MB 2GPYA 4ESHA 2C7QA 2QD4A 1CY6A 2R7NA 4LJKA 3U4HA 1KYQA 1BXGA 4EKGA 1H4VB 2JCYA 4F5EA 2AJBA 5IK2D 2EJCA 2YYSA 1WMAA 1G291 1GL6A 3LW8A 3S2UA 1H5QA 3MWDA 3T5PA 4MP3A 3ZWQA 2CG5B 2A9OA 3HYBA 1OR8A 2JO0A 2JJYA 2W8ZA 3NVDA 4Q3BA 3IDQA 3VA7A 1MQSA 3FLEA 2DFLA 3IUBA 2ERYA 1IG3A 3FGOA 2C03A 4WDRA 3VH1A 2P2GA 4D81A 1J22A 5BR7A 3R3WA 3W3AH 2Q8QA 4C7JA 5F77A 3FRJA 3CC2P 4QM7A 3L0CA 821PA 4FQ8A 4HBGA 4MKZA 1PEAA 2EZ4A 1Z4QA 3ST7A 5DSTA 1VQMP 1GZUA 2XVYA 3C85A 4G5GA 1HL7A 3KJFA 1PAUA 4MKFA 4UBKA 5DBIA 3UJ8A 3O9ZA 1EEHA 2FW0A 5JYBA 4AFNA 1TAGA 5FPTA 3BFXA 4BMYA 3BMXA 4Y18A 3WLPA 4W5WA 1YB1A 2DUMA 2P9GA 3FCAA 4IXNA 3BC1A 4BO5A 5JC8A 3S8EA 2VUHB 1NQXA 3G8CA 9GPBA 3JYLA 4HAIA 4LOHA 2KG8A 2GTHA 3E7FA 4ZO8A 3L8FA 4ZO9A 4RF4A 4OX9Y 1B6RA 1UPTA 1KKLA 4LHWA 4P5EA 3B3AA 4HJXA 4IG9A 3V4FA 4ZHSA 1KEZA 4Q4DA 1OBCA 4ZPXA 3DMTA 3G6WA 3Q3CA 3SZUA 2WAMA 4MR7A 2RK3A 4XQCA 4ZU1X 3M8KA 3THRA 2K7FA 4N0DA 2YWRA 4KVGA 3U9TA 1V7PC 2P41A 2G72A 5TQJA 2YJ4A 1GJRA 3FDFA 1XU7A 3NCHA 3IOBA 3R2JA 4DEVA 4RMHA 1E58A 1AS3A 1GPAA 4TUYA 2LR0A 1MQAA 2AN3A 2BFOA 2C88A 1D0VA 4NJEB 1JFSA 3UWKA 3D3NA 4FHEA 1FBNA 1OWOA 1X1EA 3RFXA 3R8XA 4TYMA 2H51A 4I1UA 1EIWA 3QHQA 2Q07A 1BA3A 1RXUA 2NGRA 2PHZA 1Y4SA 3SDSA 1U02A 4OQQA 4BLRA 4CF7A 5JJ5A 4CN9A 4C01A 1JEQB 2VYFA 3MOGA 3TI9A 1U9JA 4RTMA 3KQKA 1N33B 4D79A 2RK6A 4UPDA 2P5YA 1R8YA 2REOA 3RSSA 2I6QA 1A9TA 3A3KA 1HLGA 3KK0A 4D46A 5IFLA 1PQYA 4BWFB 4ZI7B 1GG5A 4NI5A 1UJBA 4IX9A 1QPZA 2Q49A 4Y2TA 4ZD6A 3T9BA 2XUGA 4D3XA 2C96A 1SXGA 2HL6A 5AI8A 4RTKA 1DPFA 1T9BA 1JVBA 5EQFA 1Z2PX 4MS4A 2O0MA 4TVSA 1Q7EA 1X8LA 4P86A 4EEXA 1NYRA 1QZTA 5LQAA 1KDZA 3MTEA 3R75A 4CKCA 1HRDA 4MP8A 3JZAA 2HCFA 3K2BA 1HDOA 1EMDA 4IHJF 2XITA 1TVKB 3W8RA 5IJZA 3AOEC 3F1KA 4CM3A 4DDUA 1PJBA 5JSKA 1T3GA 3C24A 1JSCA 5HUJA 3WGVA 1NJ8A 1L1QA 1D9XA 1D8TA 2FUCA 1YXMA 3NS7A 4B9EA 2HWKA 5J47A 3MUOA 1NOJA 1JIQA 2PUHA 4NH0A 4Y2PA 3THXB 1AQUA 2C4UA 2QVLA 1FYDA 3FPCA 4CM9D 4S0XA 3ANSA 5IF9A 2DUNA 4B87A 2CK3D 3HSSA 3BMNA 4MGIR 3ID6C 1U99A 4TXHA 5CD1A 1KPGA 4MWEA 4Q47A 4G9GA 4EJ6A 2UYCA 1S5PA 1DRUA 4ME6A 2E1RA 2AUNA 2X15A 3QP9A 5ELMA 5B6JA 4PFQA 5TR9A 4Z0PA 1HNWB 3V4OA 1JR3E 2BGMA 1P9WA 1Y82A 2C9CA 1J8MF 4HAWA 4E33A 4IIXA 4IH9A 1UDRA 4JLNA 3BE8A 1SA0A 1AB6A 1HQDA 4HZUA 4PBRA 4V0MA 5E4FA 2NSLA 3DHWC 4EGSA 4PZZA 4OLBA 2BDTA 5CYFA 2EAUA 3L0SA 3PQ3A 3QVLA 2N9UA 4RTOA 4JGGA 3W6UA 1M2NA 3VVBA 4KI0A 4G0UA 2VH1A 3G2IA 1BHSA 4PLYA 2WJZB 3MRTA 4J7AA 2NTJA 1P62B 3KOYA 1Z7YA 1SZCA 2OORC 5IJ0A 1QX3A 2PSSA 2W2PA 1ECGA 1UKAA 2G63A 3E5MA 1DCMA 5THQA 4G07A 3AP1A 1J21A 2PEMA 1HYGA 1KJJA 1G5QA 1Q5PA 2WVGA 4P3PA 3VH2A 5LKRA 5HQTA 2EKLA 2Q1UA 3HSKA 3PLRA 1IB6A 5C3UA 1D6NA 3IQXA 4Z3KA 4MKXA 3S1LA 2OXTA 3BWMA 2GARA 2CL0X 4HWKA 1L5GB 3F74A 4A5SA 4MIEA 5BUQA 4QBTA 1SXHA 2A78A 4RK1A 4X1YB 3COYA 4TTVA 1N1MA 2WB4A 3OT1A 3EW9A 1J33A 1TXGA 2RGNC 5DLQC 4UCFA 5F3DA 4CU2A 4RDHA 5KNDH 1R6DA 2X5NA 1YA6A 3NOXA 3Q9LA 4PZEA 1YH3A 2CDAA 2AFIA 2FJ0A 2X76A 3OMLA 4NDAA 3ZOKA 2WA2A 4MRMB 1C30A 1PUJA 3QNMA 1IN5A 4BUCA 1EKXA 1NRJB 4MOWA 3QUCA 1RLOA 1E3WB 1XMPA 1TIBA 2F9LA 4MW7A 1A5BB 2PMDA 2QT1A 4G4IA 3BDVA 4JQZA 2BW0A 3GCDA 1DV2A 3LZCA 4EYGA 4BO4A 4TT3A 2OC4A 1QQ5A 1OGJA 2OKGA 3JQEA 4DLAA 1U1CA 3OUUA 4P4LA 1QH1A 4JLKA 2BRUA 2GZAA 1RM4A 1VFPA 1Q91A 2C2HA 4MA5A 3ZU5A 2YQZA 1CRZA 1TJPB 1KR2A 1AVTA 2A7XA 2CXUA 1WB5A 3M70A 3LX6A 4IYJA 1MTZA 1Y1RA 4TXNA 1NW4A 2F62A 1FF9A 2JAUA 3A31A 4MEAA 4QQ8A 5DX0A 3WHIA 1XQ6A 2G9RA 4FFPA 1Y6JA 2OV8A 1H4QA 1RSZA 3LYUA 1ZI9A 3OWHA 2F64A 1JSLA 2PEQA 3WXBA 1QH9A 2RK4A 1N6NA 4JLSA 1DHRA 4GI7A 1T8SA 2B1GA 2W42A 2FG5A 3FPLA 2GVNA 1MFPA 2RARA 3NT4A 1E5XA 4BYMA 5C9ZA 2ZJ7A 5IXYA 4QM6A 4JX8A 1LBIA 2FK7A 3LWDA 5AKYA 5IK2A 1P5ZB 2GZMA 1KY4A 5LMCA 1KBQA 1G66A 2PMWB 4R8MA 1W52X 3NJRA 1JHXA 3SIRA 2ATIA 3LVFO 1PX2A 1Y8RB 3H9GA 2WJJA 1VLJA 3AY6A 4R3UC 5CYPA 3SF8A 5DTMA 1B0AA 4B40A 3E9QA 4PPNA 4XVHA 3LWBA 1QIDA 2PA3A 4UVIA 5LCXA 1C9DB 2WW8A 3WFIA 3NHZA 4KR9A 2XNKA 1RFGE 2C5HA 1XZPA 4F46A 4HXFB 3CUKA 1YU6A 2C7GA 1FMFA 3AB7A 1W44A 3W3ZB 4WHMA 4PNZA 2GLUA 4DDKA 1NYTA 3AY0A 3K5PA 3OIVA 4Y2JA 2DNWA 3RTDA 3WGMA 5KO2A 4N76A 1A76A 2VHJA 2FSFA 2X1HA 4F9EA 5JAMA 3ZHOA 4EL5A 4DMGA 1DDOA 3WMFA 3NXSA 1BHJA 1YI1A 3HKEA 5DN6A 1ZITA 1DBVO 3MS2A 4GOXA 4HDRA 2YJ5A 1KVQA 5C3MA 1E69A 4QOGA 1DWPA 4LJ5A 5K51A 3E03A 2C9DA 4GLFA 2OAP1 2HWWA 4UZFA 1F60A 4KL8S 2CJWB 4GX2A 3UG6A 1IMQA 3SEQA 1AF8A 3FYUB 1XDUA 4N54A 3B12A 3SDBA 4KP7A 1X3LA 1MGOA 5CTAA 1XHEA 2JBAB 2WZQA 3PZRA 1K68A 4U2DA 1LEHA 4TXJA 1G18A 4V0OA 2GMWA 3HFJA 4E2WA 1NVXQ 4II2A 5REQB 2IBSA 3E3NA 3M6LA 1P0QA 1ND5A 2VHVA 2VQSA 3N53A 3QG5A 3PDJA 4RVCA 5FIUA 2C7OA 4KE6A 3KD2A 1W0KA 2IZ7A 2LCFA 3HJAA 1TCVA 2PCJA 3IBSA 4G81A 3TJMA 3TSZA 2P5SA 4BLTA 5JUWA 2LV8A 1A04A 1H0SA 1STOA 4FGUA 4R0VA 4RTPA 1XZQA 3KEFA 3TRFA 1C3VA 3L0DA 3EGIA 3ENKA 1V6AA 4I8DA 4X95A 1QP4A 5EXEA 2VLIA 1U4OA 5A6SA 3JQQA 5JR3A 1OROA 4X1IA 2M6RA 3DE6X 1YE8A 3Q2KA 5FJIA 2CMDA 1CUGA 3JU3A 1DGQA 3UUGA 3VMFA 2GF0A 2QL6A 1U81A 5KTMA 2EERA 2NVBA 2BISA 3BJEA 3CSUA 4LVNA 4YV1A 1QRSA 3E18A 4YXWA 2QWXA 4HD8A 1S2LA 2J3LA 2I55A 1G5RA 3E8SA 1JFLA 1Q0RA 4UNPA 2EZTA 3C8UA 2WUDA 3JARB 3SAJA 4W8OA 5K8CA 4R2JA 4EI9A 1VGRA 2PD6A 5HR5A 2J08A 4DMFA 2V54A 2CC2A 2QRHA 4Q37A 4DT1A 3GFRA 5AM3A 3GJ3A 1MGPA 4RY8A 4UDYX 1E9VA 1U8XX 2IPOA 2IS4A 3K09A 1GUFA 2C1ZA 1ISSA 3DD5A 4O4LF 3U48A 1V8OA 3RW9A 1NF3A 1ZGJA 1LRLA 1C81A 1NWCA 3NPMA 1CP3A 2ZTUA 4ZZ1A 1E2UA 4A2WA 4JNCA 4WKPA 2AFIE 2W2OA 3RYIA 3O8QA 3RHFA 2FVXA 3R9IA 3STYA 4RORA 5CU7A 2VYND 3ZZTA 1L5OA 2PUJA 2C5BA 1ONPA 1ZI6A 4BVGA 1J5XA 1L4YA 4CZ2A 5JZMA 4QTYA 1ZDMA 3ZHVA 1QR2A 3IDZA 4BB9A 1SZDA 1KP9A 1RZUA 3EJDA 2IY7A 1QVWA 3BA1A 3GDFA 3SQDA 3UWDA 5JDIA 3CEPB 4Y9TA 3BILA 4I9NA 4AZ3B 5ADVA 1QZXA 1QOZA 1PSDA 4MRSA 5DSZA 1ARZA 1XV5A 2P5TB 4K9OA 3OJLA 4DLXA 5AUOB 4JD5A 3GPIA 1JRLA 5D7BA 2Q3DA 3C1UA 1UBTS 3PDWA 2FFJA 2XUHA 1DXQA 3AM3A 4B33A 4F6LA 1XMJA 4BPBA 4B4DA 3C3WA 2G0TA 4UMEA 4IDNA 2ACEA 2YYAA 4ZOAA 4U1RA 1FY2A 3VUEA 4NCAA 4JI8B 2XGGA 2IYPA 1E6UA 2JJ2D 3F6PA 3UBTA 1PJ4A 2JGDB 1NUQA 4YIKA 1PR1A 2EKPA 3QYFA 3HFRA 1E9DA 4YH1A 1SBHA 4C88A 1J5PA 2AC2A 3VO1A 3L46A 4FUQA 1CB0A 2JBHA 4U0AA 1JKXA 1I0ZA 2HOQA 2IEBA 3ZWWA 1E2KA 5D84A 2XZLA 4Z5XA 3S7ZA 3S5JA 1QC5A 1BROA 3DGEC 5DSXA 1J23A 1ZGBA 4UAUA 2V6BA 2C4HA 1T5LA 3SJZA 5GZ6A 2BFCA 3G2JA 1VDMA 1ZS9A 2FHPA 2PTGA 2VYQA 2KGAA 4KUGA 1WZUA 4RESA 3TE6A 1P31A 1EJBA 1ZK3A 1CRWG 3SBOA 3ML1A 4BRZA 2Q3FA 2RMKA 5J23A 5BV2P 1PZXA 1Q11A 4PRZA 5HIJA 5IEJA 3RSHA 3PLAE 3O8DA 1X1AA 2HFKA 4I1OA 2BZSA 3C5CA 1NJ1A 1P1HA 2WP8J 4PSKA 3RCBA 4TMZA 4D9NA 5B36A 2DJ5A 3K1AA 1IAVA 2IS6A 2O1EA 3OQVA 2C2MA 3A8TA 3IJ5A 4K9PA 1CQPA 3GQBB 2Z4SA 3OBBA 1G4HA 1GNSA 2EGGA 3RNLA 1ZLYA 5EE3A 5C31A 3NM5A 3UT5A 1EFKA 4DFDA 1GN9A 2DU8A 2QVGA 5FAXA 1RPJA 2AKEA 4YAIA 4WGGA 3HB5X 1GCAA 3OJEA 3FTCA 1LC3A 3Q3IA 1C7ZA 1ZC3A 4LW8A 1IK6A 2FN4A 4YRQA 2VP3A 4H15A 4IINA 4N82A 2R5NA 4KIFA 4RAOA 4DC1A 1QDEA 3HLTA 4BMOB 1RQNA 2BVNA 2UZ3A 3N70A 1W19A 1KK1A 2DRIA 1KFKB 2R8ZA 1NLYA 1P81A 1UBEA 4LK2A 1B8OA 2XWQA 4DWOA 4D8VA 5HGJA 2XCSB 1NBMA 1AKNA 3DLCA 3I8OA 3D3KA 3SHVA 2E4YA 4F72A 3O75A 1A8HA 1TC2A 4LZLA 1HY8A 2GM5A 3MUNA 4RCZA 2JEZA 3K9GA 1SPBS 2NXWA 2JLWA 2GO1A 2Q5HA 3DT6A 2PWBA 3MRVA 2OTLP 1V5IA 2ZI3A 3SK0A 4F8JA 2GZFA 4N7BA 3Q15C 4RD3A 5DTIA 3ZWMA 2QRGA 3ROXA 4CCWA 1DLJA 1O5OA 4Q7LA 1KVRA 2OENG 3P9SA 4FYXA 5DJ5A 3GA0A 1ZVJA 2V45A 3FB1A 3V33A 4LCJA 3WI7A 4M88A 5DHFA 4CTJA 1Y63A 4EM6A 2P27A 1TC1A 2R2AA 1W5BA 2HSJA 3DCYA 3BK2A 4ZYLA 1UOPA 1NP7A 4OTZA 4RL6A 3PHCA 4MUYA 3TFOA 3OU6A 4XFKA 3RS7A 3RPEA 1DIGA 1PBNA 1YQWA 3CEHA 1G55A 2BGJA 3TFQA 1EXVA 2YV2A 1FX0A 1FXSA 3A3NA 3UJNA 1JQJC 2J5BA 1NR5A 1QV6A 4FZRA 4JDUA 1MU0A 4Q15A 2I4NA 5FNVF 3GJ0A 4QVGA 3OQ1A 4EPTA 4UNRA 4E2XA 3UJBA 1AS0A 4U0BA 2CXTA 3REQA 2ZTLA 5ERGB 4CIWA 3FFTA 4YUYA 4PWZA 1XU9A 4XE5A 4HYQA 1T36B 4RK6A 1IM5A 1IK4A 1NRWA 2FZWA 2VLNA 1GIAA 1Y6RA 2E55A 3P9NA 4KQHA 4Y2UA 1LVGA 1P1JA 2RGBA 5KIAA 2C9OA 4Q48A 5EIHA 2WQ6A 1C4KA 3V9AA 1PHPA 2VNJA 1WPXA 1U0BB 1YQ9A 2VJYA 3OM9A 4NL4H 1CJSA 4FFSA 3G9XA 2B35A 3G9TA 3I6ZA 4ETIA 3LZDA 3WR5A 3R5KA 3UHFA 3NETA 4PVCA 2PXHA 2OHFA 2JH8A 4OOEA 4F2PA 1KZ4A 4DWJA 4B3RB 4LXTA 2W6NA 1KRXA 2ISQA 3I04A 1ZYUA 2OOSA 3CO5A 3C1TA 3DWEX 4I08A 4YECA 1SHJA 1TM1E 3GLHB 4BNTA 1DG1G 3C14C 3WKAA 1E3TA 4OCZA 2F6RA 5C80A 1N1DA 3BL6A 1KH3A 2GEDA 3HYCA 4KNYA 2BYTA 1Z25A 4CG3A 2ZIWB 4W6QA 1NZJA 4NSNA 4R1NA 3L7BA 2FUNB 1NRXA 1A8OA 2QYSA 4B2IA 4PINA 3EGXB 4N40A 1I3CA 4PWYA 5IPFA 4PHHA 1RTTA 4IP0A 1M34B 2COKA 1F0PA 3PNPA 3QKUA 3RJ9A 3CGWA 4MW4A 2FUEA 1VGVA 1E7MA 1HEUA 1U0NA 1F14A 5KTTA 3LFUA 3ZZ0A 1TT7A 1YZNA 3PITA 3IC5A 3VOTA 3ELWA 1UBFA 4N9WA 5EZQA 1XQYA 3LQ1A 2X2OA 3W6OA 4XDZA 3EGOA 4EF6A 3DYBA 4CV1A 1Z2AA 3SY8A 5K3OA 1EWKA 1JIIA 2WICA 3IKTA 3WWCA 5HJ5A 3PGA1 3V2IA 3EPPA 1OR5A 5CBPA 2G40A 2Q3LA 4GM0A 4G1VA 4RBNA 4HAZA 1Q44A 4QAQA 3G71P 5A2GA 4FHZA 2QF7A 2XTMA 3FXAA 3KD3A 1DP4A 1JECA 2OQ2A 1CUBA 5THKA 2GJAA 4II3A 2FJPA 2OE2A 3W5JA 5DP1A 4LGMA 2LF4A 2ZUCA 4MRRA 5EIWA 1FMCA 2GJ9A 1HKHA 1SC1A 2ZPTX 4L3WA 4K9NA 5CG2A 1XL1A 1TMKA 1L5VA 3A4IA 1U8CB 1NX6A 4KVZA 1KO7A 2HRCA 4P1ZA 3GJ7A 3FBTA 3IULA 1OCEA 2H08A 1AN0A 2OCXA 3FWYA 3H9QA 3MTAA 4P3YA 4BE9A 1DI0A 5LUAA 1UXHA 2AD5A 2AMJA 2II6A 1MC8A 3AUYA 2LKDA 3D81A 4G0MA 4LZNA 3R7AA 2WHEA 2IC5A 2MTBA 3ZGVA 5KNBA 3LO5A 4E2YA 4BQSA 4EKIA 3K2IA 1L4HA 5EP2A 2JIPA 4Z0NA 1LDEA 1A7AA 1TO6A 1CR4A 1U8EA 3GPDG 3K9HA 4YP7A 1OLXB 1S2DA 2ATXA 1CB7A 4R81A 4IDPA 5TB5A 3U40A 2C5LA 3REFA 1C1DA 3IUSA 4IGAA 1RZRD 1BRMA 3IQGX 4BPFA 4BXOA 4AN4A 4DJDC 4EO9A 5FA8A 2C2WA 3ND6A 1L6IA 3PNVA 3QOWA 2XTZA 4GZ3A 2JZCA 4LCBA 3PEWA 1L3BA 4JELA 5LD2C 1V11A 1D1DA 1EI9A 3CINA 1WCYA 1A8IA 5ELLA 1V8ZA 1VJ1A 2D0PB 4A26A 5L95A 1N77A 2AOWA 1EA5A 3JZIA 1LSOA 2ZE6A 4U2EA 4KLAA 5I8PA 2UUPA 1CUZA 3OCZA 1GARA 4XLLA 3CMMA 1Z6AA 2QLFA 5D1HA 4U7FA 3AFHA 5IBQA 1BDHA 4AJKA 3F6EX 1DNYA 2FMXA 2VQ6A 4BO2A 3IJPA 3R44A 4O0LA 5C5IA 1K8QA 1Y0BA 1Z8NA 3PXXA 3QYAA 4C3ZA 1R0SA 1SOMA 4LECA 2QP4A 4OOFA 4Q4LA 5AOBA 3HDTA 4URZR 5EIOA 4KXLA 5T4EA 4A8JB 4AM8A 2ZJAA 4G36A 5FCDA 1YR1A 1PR5A 3HYSA 1NC1A 4OP1A 5HW0A 3VJRA 1WVIA 3BD9A 2NLOA 3AL2A 2YFKA 1F06A 3CCMP 1CERA 3HY6A 1A5SB 1O2DA 1Y37A 3RRXA 3MTBA 1J25A 1FSGA 4IIGA 1IY2A 4G37A 4ZIRB 1G8MA 4JN6B 3D7MA 5FI0B 2R47A 3GRKA 4JJKA 2O2DA 1MB4A 1QDLB 4N65A 1K92A 1N8NA 2P3OA 4HLQB 3LT4A 2CNNA 1OI4A 2HSZA 2OBNA 2AYZA 4GSLA 2PEOA 2C5AA 3V80A 4IS3A 5BWMA 3L1UA 1GUZA 2X2BA 3B53X 4G5FA 1M74A 1LLQA 4AX4A 4UFPA 2X19A 2NYUA 3VTAA 1C80A 2CWWA 4PS1A 2H4JA 3K1JA 4F6RB 3QU7A 4QYXA 2R60A 1N6OA 5GWXA 1ZWKA 3G0CA 4RABA 4ZVNA 3PQ6A 1QRTA 2WF7A 2WYVA 1ADBA 2VF5X 3OLXA 3TL3A 1IN7A 3ISVA 1KMQA 3P9PA 2J3MA 2XOKA 2XSZD 4GEGA 3EXHA 2HRBA 1XDZA 4UHEA 1VQ7P 1E2GA 2PX5A 4CF6A 5K0SA 1EZZA 4E3WA 5T67A 3RF6A 3ENVA 2QROA 2DFTA 3NATA 1VHWA 2V7BA 2CLIB 4S3MA 2VAPA 4W5TA 4R16A 4G4JA 2XUKA 1I9GA 5EJ9A 2AJTA 4ZOLB 1IPHA 1YJXA 2IFTA 5BN1A 2HU2A 4WW0A 1JLLA 3JSAA 3J7TA 5EUCA 3GUZA 5HZMA 5IT4A 5K45A 5DTRA 1JPUA 5F51A 3D31A 3W5BA 1R0YA 3A9TA 2RBGA 5AWFC 4UM7A 3SX4A 4KQJA 5JH7A 2WHPB 2J0QA 3DE3X 1Z9BA 2V8OA 2YMMA 2YV4A 3NHBA 3NPAA 4U2GA 3EPLA 4B9AA 3AV3A 3SMQA 2F59A 3AJDA 4YI5A 2BZ0A 1P2DA 2JJ1D 3BHJA 5CB0A 3L4EA 3EWSA 2C4VA 4GZ5A 3RVNA 2X22A 2CCKA 3VM6A 4JVSB 3CSSA 2HXSA 3X1ZA 1RZVA 4YUWA 4J0HA 3PUWA 1VIDA 3OIWA 3EVFA 4IAOA 4IEEA 4W1RA 3H17A 3RU9A 2RHTA 3WB9A 1ZU4A 1KWKA 1D2HA 2P40A 1QO0A 3LVBA 3QH4A 3QVSA 4JS0A 1BOOA 4RVSA 4LOLA 4X1KA 5KSPA 1EVEA 4ITUA 5B6IA 1XLUA 4RE5A 1Y1LA 4O6VA 2O1SA 5LB4A 1W0JA 4QECA 4TLAA 1H5NA 2VZ8A 4U0DA 3HXLA 3TI7A 4MPPA 2TMYA 4GYJA 1HXHA 1OXXK 2OFXA 3F2IA 4PX2A 1LJUA 3H1GA 5H8WA 3SX0A 2FFHA 4CVNA 3BXZA 3G8BA 4DQDA 1L5SA 1XHFA 2OB1A 2W6OA 2YHUA 3IAFA 4KXQA 4URHA 4JUCA 1GEGA 1NL3A 5CVJA 2QJFA 3QELA 4Z53A 1V1RA 1QHSA 2WM9B 4GR4A 2GZEA 4EZBA 1HT0A 5LU9A 4BFTA 4L7VA 1X0VA 4M99A 4ENQA 2WA1A 2YMPA 4PSUA 3UY4A 3W9BA 4RVFA 3ZD8A 4EGCB 1UWLA 4D4HA 1NI5A 3QE4A 2WVHA 3FR8A 3NWEA 3G5TA 3F67A 3R5XA 3TAHA 5LQKA 2JFFA 2V6IA 3MJEA 3Q7RA 4HZIA 4IMJB 3R5HA 4XGNA 5IJXA 3ZH9B 4A0HA 1IN1A 4RHCA 4BFUA 1AXEA 5FF9A 3U44A 5EP4A 2HA4A 3IHTA 4OHWA 4DQUA 1G8YA 1Z5ZA 5JO0A 1T5TA 1P0IA 3PT5A 1JIVA 4O2LA 2VNAA 5KJEA 3T4UA 2EIHA 2OB2A 2CKMA 3OIYA 2DGYA 1NA5A 4DILA 3F6CA 2HJWA 4ZEWA 4IGEA 3FOEC 2AW5A 3RJZA 3O4JA 1W85A 5D85A 2DF8A 5TMEA 1GG8A 4ES6A 5C8YB 3CVWA 2C95A 3SR3A 1EM8B 1E96A 3KV3O 4B3SB 1R9GA 5D3KA 1UK6A 3CE7A 1Z6YA 1ZK0A 3NGLA 1W25A 4ZQGA 4ZALA 2JFQA 3OZBA 4PZCA 5DO9A 3I2HA 3DEJA 4HUQB 1BN7A 2PX2A 4RWEA 5KKAA 3T54A 4LXGA 2ZIGA 1Y8AA 3T38A 3RK1A 1M2WA 3LK7A 4EW6A 4I2VA 4UTPA 3NBKA 3T34A 4F5YA 3B5EA 1YR3A 4C7BA 1CUXA 1UMCA 3SBXA 4BX9A 5FWYB 1CV2A 2R87A 4CLOA 2PUDA 2PGXA 4GLJA 2IITA 3L7MA 4XIYA 3F78A 5ITSA 4PQFA 5A4AA 1N6HA 2AN9A 3HZOA 4R51A 4EATA 4CEIB 3RM3A 4TLDA 2ZS9A 1KSGA 3I0ZA 4ARSA 1KYIA 1KH2A 4HDOB 4DM3A 3EDCA 2GFIA 3GKLC 3MGGA 5KWIA 5JSUA 1MMFB 3PQDA 3G0GA 3JD1A 4KX3A 3VU0A 3G5UA 5SICE 3J81A 2GZRA 4MZXA 3I9KA 4O8ZA 4C4OA 4J0CA 2QJTA 4ENVA 5LIRA 3MOSA 1AKMA 3G0OA 1RJDA 3DOJA 4HUTA 3HR8A 4ZANA 1CX9B 2VDRB 3VV3A 3ETDA 4P93A 4KQCA 1HGXA 4EJ2A 2XGJA 3P05A 1S9HA 1VE1A 2HWUA 2PX8A 5LA6F 2OGUA 2IV7A 3TG2A 1LK0A 1AK1A 2BJWA 3KR0A 1D6MA 1WAMA 3CFYA 2WE7A 4KXMA 3RUPA 1W36D 3A6EA 3QFCA 5ALDA 3C16C 3GR6A 4TQAA 3JATA 5CPFA 2DT8A 4BMZA 3COWA 4ZU3A 3FMGA 2IYAA 1SCNE 2A1IA 2D8AA 1Q1GA 3F3SA 3MN1A 1E3LA 3ZZ1A 5H82A 2ZRDA 3I2FA 1D0SA 2P2YA 1WHSB 2IUSA 1NR7A 3GVXA 3M33A 3BRWD 4U4AA 1R88A 3BCSA 1KZYC 3RD5A 3OHSX 1UDXA 2XUAA 1QE3A 5KNDD 2JI4A 4C05A 1X3OA 3GNLA 4HFNA 3SXJA 1VHJA 1V8PA 3DVAA 4MVJF 5FOVA 1M72A 4XM0A 4LF5B 2ZU6A 1LW7A 2FZVA 4QHSA 3K9NA 2EFYA 1NJIQ 4DLWA 3PR3A 1ZD4A 1DC7A 4RADA 3QJGA 2ZI6A 3WO1A 2CNLA 3EJ6A 3HB9A 5LZ9A 3MWFA 2AKAB 4LNUB 4I9FA 4IG4A 4IIBA 4BVBA 6GPBA 3S2GA 1H3EA 3A27A 1QP8A 2QTZA 2WKWA 1AQYA 3STHA 4IY1A 3TLJA 3K4QA 2MR7A 3GQVA 4ARVA 4HNAA 1F0KA 4C0BA 1P60A 1RMYA 2IUTA 3AERB 1VYHA 3JR7A 3B4QA 3KXKA 3UBMA 4ACBA 1WLYA 3ZLBA 4BNZA 3E7DA 5FOXA 4J94A 1RIIA 4GBMA 4D9FA 2PMCA 1DC6A 1QF7A 2QTAA 3NHPA 3UGKA 4DNQA 1T8KA 3AILA 1T1RA 4RPJA 4ZXFA 2GHRA 4RCVA 1TIKA 3BD7A 4EMBA 2VXCA 4WZAB 4YRNA 2JFUA 1DO8A 1Q1EA 1TF2A 5JJCA 3D5EA 1NLZA 2GWRA 3PUKA 1A4RA 1JXQA 2NO0A 3MSCA 4MITA 1TQDA 2PEIA 3PGXA 2AEEA 4FZ5A 4PO9A 4QPCA 3RABA 5AVVA 3FZGA 3I9MA 5FV4A 2X2EA 5IVHA 5J59A 4ZT5A 2C8LA 4ZQBA 5JQGB 3RYHA 1OLUA 1P2TA 2IT1A 2CQ8A 4Y0AA 5DN9A 3VVLA 1D2RA 4UCQA 5IAEA 1TA9A 1Y3HA 4PLPA 1I9CA 3NJ8A 5HDBB 1Z5PA 5HIIA 3MJFA 1U2DA 3CURA 1R37A 1G21E 4G24A 1AD2A 1HZZA 1P9OA 2ZRNA 1MA3A 1NU8A 4QXMA 2QBYB 3U37A 4KN5A 4LF7B 2DM6A 2VF7A 2K4MA 3DUFA 1F5SA 4GEKA 3THXA 5GOZA 2NO1A 4IQ4A 2JNWA 1M7GA 1NQWA 1P1CA 1SU8A 1ZSVA 1J7KA 5E3JA 1WF6A 2SHKA 1V7ZA 3EOAI 2IU4A 3MS4A 4G8BA 4H0CA 1F38A 1WPGA 2WR8A 3CNEA 3CZRA 4FEYA 2AXNA 2PMFA 1EFPA 4KRXA 3TO5A 2OSBA 1R0BA 3AP2A 3SYNA 3WGUA 4DMRA 4KE7A 3MCWA 5J5VA 2HRQA 3SOPA 4L51A 3QF4B 4A0GA 1BN6A 1NN1A 2ZG6A 3AR6A 2PJRA 2QN9A 3HY4A 5JAQA 4TV8B 3VSEA 2IYFA 2VRCD 4MUFA 2HA3A 3H9EO 4FFBB 4J3NA 4BRWA 1BIFA 2RC6A 3OCWA 4LZZA 1KMHB 2RIPA 3CX7A 3WLEA 1URPA 2WM2A 4IUBS 3EIFA 1D8AA 2R8OA 4J16C 4OV6B 1FFWA 1UBLS 1H2WA 4YAGA 1VP9A 4X9XA 5D3QA 3PR2B 2Z6UA 1EVLA 3KLBA 2X40A 4FR0A 2M32A 4RWZA 3VPHA 4F7DA 5ALXA 2JFXA 4JA2A 5E8JA 4F3YA 4FI3C 1SQFA 2UYOA 1U3DA 1ZRNA 1P45A 2F9MA 2FPOA 1ACLA 2FSVC 2FZ5A 2HMWA 2IHJA 3K1ZA 1EP2B 1NXVA 3LFTA 4I5IA 3ROEA 2Y1WA 1LUAA 1DV5A 2P1ZA 1GQOA 4FEGA 1P2FA 4OKIA 5ENZA 1W1WA 2V6MA 3ZIAD 3I1JA 1U3TA 4OJQA 1PQ4A 1PG0A 1VPEA 3A1UA 5KQLA 3FWKA 1FJGB 3ERCA 1Z82A 4RLQA 4JJ7A 9MHTA 3QE0A 1JQAA 1A72A 1NW9B 2CV0A 1VJ0A 3CN7A 3U7GA 4Q4HB 4H08A 2ZR9A 3KQOA 4OBBA 4XI9A 1O6GA 2NT4A 4HX5A 4O4JB 2BJHA 5T5QA 3ZE1B 3BXPA 4MMYB 4BLVA 5J4YA 2IOFA 3ORFA 1GTSA 2KLHA 2QG6A 2DJIA 4Z86A 5IHXA 1WB9A 1TMOA 4BP1A 3SJUA 1TA0A 1U2ZA 2V0NA 3I73A 1E3WA 1PGPA 3QI2A 1ZD3A 4TKUA 2AZXA 1ETHA 1ODFA 3C15C 2FZ4A 4KX5A 5EESA 1MH9A 1OILA 3QHPA 4JT4A 3FCXA 3DQPA 3WLRA 4ZMBA 3K09C 3TSOA 1I2BA 2B4TO 1MX3A 2HIHA 5ALKA 1NW6A 1NXOA 4X93A 1P4SA 3GEIA 5J4LA 3QITA 4L1KA 2WY2D 3MWJA 3RSCA 1HNZB 1QANA 2I87A 4BLPA 1NMEA 2B7BA 1CFJA 1SKYE 4WXRA 2FWAA 3M81A 4QASA 4XTRA 1P5FA 3GAFA 4CQJA 2IHTA 4YRRA 1PQWA 2V9CA 1P5HA 2A84A 3MXOA 1XYYA 3MERA 4LJ9A 4QFBA 5KYWB 4OMDA 4IDDA 4R41A 4QG3A 5J2TB 1JFVA 1IRXA 3CRMA 3Q6NA 4R31A 3ZJ5A 1SBQA 5I8ZA 5ISMA 1VQKP 4YREA 2BSXA 5B2ZA 1K7SN 3R8FA 4N8DA 4M7OA 2A33A 3TW6A 2ZAYA 3HXQA 1XMQB 3FPKA 4NDNE 1VL0A 5EWMA 1M1XB 2JA1A 5JCZA 3JXEA 2BFMA 2V4MA 2XXMA 3M5PA 5AW9A 3AM1A 4EFKA 3FETA 3BZWA 1ID8A 3EDMA 4L0CA 4CCAA 4BTEA 3P0IA 2NUPB 4YROA 3HZZA 2PUGA 4MVJI 1LLDA 3WHKA 2A1TS 4COKA 5KVCA 2GN0A 2K7ZA 2WP0A 1V8FA 1KVSA 4CEHA 1NVWQ 4DCTA 3CC8A 3F7MA 2C9YA 2O2IA 1E6KA 4EWLA 1DTWA 3ZHCA 4E14A 1K8AQ 4MYUA 5E7QA 1IY1A 4OJNA 3UHOA 4RU1A 5B55A 2WJGA 4J7CA 4OQFA 2OBLA 2OT3B 3IHKA 1XCPA 4C03A 2C59A 5BOVA 5LYJB 2WMYA 1G1MA 4M1OA 4AW9A 1NKTA 2AEFA 1N6KA 1N8TA 1DMRA 1QHHA 2OWEA 5LWHA 1JHYA 2XTNA 2FEPA 1GNVA 5BWLA 2PGLA 5P21A 2QT0A 1LX6A 2ZSAA 3KCQA 2WWVD 1FDOA 2CJWA 4Z1MD 1WMBA 1AKUA 1LPNA 1EFLA 1NHGA 3IPAA 4XUCA 2MIIA 1Q77A 2ORWA 3OEEA 2I80A 4G3XA 4HV4A 1M6HA 3DFFA 4IQGA 4EKEA 1LB1B 2FRXA 5BW5A 3UIEA 1Q19A 2R85A 3IBTA 3AI3A 2CHGA 3IAAA 4B3FX 3R20A 1PR6A 1Z7GA 3I32A 3IILA 3M6VA 4P4GA 4Y1EA 3QXSA 4TL8A 1LY1A 4BGUA 5JXJA 4LJRA 2Z5GA 4HXYA 3L41A 1V0JA 1V26A 2Z4TA 3GZTB 2H4ZA 4PYJA 3KE8A 3P9CA 4IOLA 5JY6A 3ZLJA 1XQ9A 1YIAA 1DAIA 2C9ZA 1YMUA 4U6QA 2A1TR 4CR6A 3WAGA 1NFRA 3NQ41 3KKMA 3T4XA 4K1LA 5LXTB 4K40A 4WADA 2EQBA 1KI1A 2XQVA 5JISA 4ZGGA 3FUTA 1OFIA 1NPTO 1PK7A 2C57A 4GWKA 2OUKA 3WLLA 1BVHA 3DD1A 2X0DA 4IBOA 2JLZA 1ZD9A 2BGUA 1FK8A 2DSNA 3WSVA 1PR4A 3KIPA 1SCUA 1LQUA 4GMHA 3WGHA 3AVQA 4DAOA 3C5VA 2JBGA 2FHSC 2EHJA 4RO0A 2B30A 1AUPA 3RH0A 5ALPA 5CAEB 5LQSA 4CM8B 1THTA 2N42A 4XD7D 5TC4A 1VCHA 1QTIA 4MDYA 2QZJA 4OAPA 1IB0A 3OZIA 4MCAA 1K2WA 1VPLA 1GLNA 3ABSB 2I3ZA 1VBFA 2Q4OA 3UFBA 2PNJA 3B6ZA 2RI1A 1KJIA 2P9TA 2QT9A 1XD8A 3I64A 2CJXA 4TRNA 3WYAA 5G40A 4RNCA 4YMVA 3UJHA 2RD2A 1WETA 1QB7A 3QUAA 2CMHA 5FR1A 4PZYA 3W5SA 3AVUA 1DXYA 2PLWA 2L69A 3AIIA 1BWRA 3C7DB 3E2PA 3ONVA 3S4YA 4JUDX 1Z73A 3DM9B 1FS5A 1YONA 4XJTA 3X0DA 1EWYA 1QNLA 2WIKA 3WHLA 3V7WA 5KCMA 2OV6A 5EWLB 1O97C 4HYYA 4MKIA 1NIJA 4O1MA 1BEUB 4PXYA 2OPHA 4AZTA 4CPDA 1PKEA 1XZLA 4GYWA 1YJBA 4MJXA 4NPHA 2GOYA 5BMVA 1CIJA 1YB2A 2GEKA 4Q3LA 2J09A 2Y6VA 4P35A 2IUYA 4QGFA 2UUBB 2HRRA 3OJFA 2V7VA 3HKDA 4MUMA 3DO5A 3IX7A 3SHWA 3IAEA 4GBGA 2GK3A 3ZIDA 3OJOA 4US0R 4XSVA 1JLMA 4BO8A 4Z4FA 4OA8A 2JI9A 1ZJ5A 1CUIA 2PGAA 2NZVG 5PNTA 1G3QA 1T13A 4IYRA 3TLXA 4AZ3A 4B7XA 2PY8A 2FNAA 2JRCA 3FLAA 4B4KA 5B3KA 1RYYA 3G6EP 3PV0A 5BN4A 5CDGA 5LP6C 1GYRA 1L7MA 4N4AA 2CNWA 4MYSA 4DWVA 2H3EA 2VSNA 2F3PA 2XB9A 3U7HB 4FGLA 2GLXA 1DBQA 2YNMD 3HADA 2BUOA 2PEKA 1A9OA 4JGBA 4BO3A 5HNKA 4H31A 1R8QA 4R1UA 5T3YA 5FBVB 3Q7EA 4RGQA 4L5YA 3J80A 5B1EA 1JG6A 4WCFC 2HLDA 4P08A 4YFYA 1TE2A 3C6MA 4EPRA 4YRCA 1SVUA 1YS7A 4QNMA 3PCTA 5CK5A 3EXAA 4BLQA 1DKUA 5EJGA 4DNOA 3PCRB 4RKWA 2J0VA 1CQZA 1RKVA 1U4NA 1KDYA 5JMOA 4BS9A 1AUMA 5I9NA 3IFSA 4LE0A 5GONB 1N5LA 2EVWX 2X0JA 5CXQA 3VDQA 5JPCA 3TIVA 2VHXA 1H2BA 5ALOA 4CMEC 5I7EA 3T1HB 3EG9A 3O3CA 3TL2A 1DO2A 1T6XA 1W34A 3WV4A 1FLNA 2ID7A 2ZBUA 5A4KA 4WBNF 1QS0A 1YGYA 4A1OA 1XAGA 4IFEA 5BV1A 3BJRA 1XEXB 3OX4A 5BVHA 4QZVA 4DR6B 1CEYA 5CIYA 3FDIA 3I37X 1CE8B 2AHOA 4WKGA 3M3DA 3QXJA 1U9CA 2AA3A 3N1UA 4XDHA 3U7EB 3I61A 4BZWA 4HQOA 2FSHA 1J07A 3WGTA 1M2GA 3IDFA 3AEQB 5I3CA 3DL7A 1ZOIA 4I50A 2POQX 1W4LA 3UXYA 3IT3A 3N76A 1WV1A 4YCSA 4UMVA 3NHRA 4M54A 5JD4A 5EYPB 3RSOA 3TTWA 2NVWA 3VU1A 5IHPA 1GKIA 2HO4A 5AUQA 1E1RD 4JP2A 2JL1A 3DCIA 2OO3A 1W46A 2Z56A 2Q4DA 1L5YA 1RWNA 2ZULA 3NTVA 4HLNA 2XT9A 4AWBA 3SYRA 3IRUA 4MI6A 4LOIA 1T4GA 1Z18A 4KQEA 2QMYA 2IUUA 2Q29A 2WTBA 2RAPA 4ID9A 2PS0A 4OY3A 2FQ2A 1QFJA 3AX6A 4P3NA 1ZAKA 4EI7A 3WO0A 3TQIA 1KSHA 4J43A 3GGPA 3MELA 2YRWA 4JI1B 2OQVA 4XYBA 3OI7A 3U2QA 4HNRA 3W9YA 3K94A 2PMEA 1BD3A 4CKYA 3AWIA 2DHRA 1GTVA 2I8LA 4C06A 4L4RA 2Q6VA 2O0LA 2CKDA 3Q88A 4U0CA 4J07A 2PWAA 3ZQ4A 4BL5A 3M6XA 2FEWB 3M49A 5IN4A 4DIEA 1D1TA 5CLQA 5G02A 4P22A 4PG4A 1ZUD1 4DR1B 4IOJA 3EA0A 3CE9A 3QFHA 4ZCIA 2IH4A 5KVVA 1XZKA 2HCRA 3F7TA 4BIIA 1HDEA 1JDPA 1TDJA 4D99A 4PC7A 2EBUA 2FYTA 2ZPUA 4X7RA 1C3JA 5EHZA 2UUCB 2A30A 1U98A 3IKJA 2XVZA 1E20A 5GQSA 4ZDWA 3R8CA 4IMIB 1CFZA 1RIFA 1TECE 2DPXA 5F7XA 2XZ0D 1MO4A 3BSSA 3N58A 3EDQA 1DKLA 4M37A 5FPKA 1DARA 3U0BA 4NK4A 3B9PA 2Y1GA 4D4JA 2V0CA 4W7SA 2WD9A 2EDCA 1GR0A 3UUWA 3H3XA 4B3BA 3S2FA 1Z0FA 2EHDA 3HBAA 3PXBA 4O4IF 1RYBA 5L4NA 4HMOA 1T24A 1RO0A 3OEHD 1T36A 3KUKA 1DIRA 5BV7A 3KAPA 4LSMA 3AB3A 5AHXA 4BFXA 3GARA 3UMFA 3W7VA 1K27A 3QY0A 5KJFA 1B23P 1L7DA 1T2CA 3H2BA 4WL0A 1U04A 2V7TA 2J9GA 1IZ9A 1E1QA 2Q3CA 3FE2A 1F8XA 3IA2A 4M8SA 4F12A 3AGPA 3NT5A 1G2IA 4IHAA 1J06A 5CX4A 1GRNA 4XD2A 3NTXA 3KUXA 3B20A 1MFZA 4M83A 1YC5A 2H4HA 1VCNA 1ISFA 2FETA 5C1IA 3UTCA 1QU2A 3UEOA 2Q46A 3ZWVA 2JLAA 1UQUA 2R96A 2NU7B 1L7AA 1IQUA 2XUZA 1W5FA 3JQFC 2BMDA 3CPEA 3E5HA 3F6SA 3KLPX 2AG1A 2D7JA 4FSHA 5CLLA 4F38A 5A9RA 3ADOA 3U0VA 1OJLA 1MUUA 3QW2A 3AUTA 4D98A 2Q6OA 4WEOA 2DAPA 1V4VA 4IDEA 2Y05A 4QBKA 2VTBB 2C2GA 2PE5A 3GW8A 2CNRA 4MW5A 4Q19A 3EGXA 4S2EA 10MHA 4DLSA 2W2XA 4GE3A 3EJBA 1M34A 3PC8A 4PM4A 4YALA 1ADFA 1RI4A 5GGXA 5HQ3B 5C4IA 5JYDA 1HT1E 2XMGA 1W9MA 2V96A 4CWAA 3FDXA 4G67A 3P2KA 1RLTA 2H5IA 4U7WA 3ZBUA 5KTYA 5JIBA 4PGHA 3JWHA 3KZXA 2WWGA 4Q1EA 1Y5IA 3OZ7A 1X1TA 1Z07A 3P9XA 3KAJA 4MR9B 5JE8A 1XPJA 3AGQA 3GOQA 1DFGA 3M4NA 1A8QA 4IKOA 1B14A 3MGAA 4PAQA 3PNMA 4G1FA 2VQFB 4Q24A 2N5IA 2W0MA 3NNSA 1QQTA 3B6EA 3NTLA 4GC9A 5L3ZA 4R54A 5SZHB 3TE7A 3TZQA 1P4GA 2I29A 2BUBA 4YT2A 4RD6A 1H6AA 1NWHA 3RS3A 1RAHA 4XSHA 4AG3A 1E9RA 5AKJA 2NV0A 1CUFA 3WK7A 4DCSA 4RTNA 4BU0A 5F21A 2R751 3RTAA 1KTIA 3PE3A 5TY0A 2HSGA 3KB1A 3DO8A 2P2CA 4DMCA 3DNMA 4MVJG 4H7EA 3PU6A 3D4LA 3OLYA 3KZKA 4LJ6A 4ZI2A 1JS1X 3A1WA 1PL8A 4XQ9A 3FB4A 5AKLA 3ZE7A 5FH9A 1BFUA 3S8YA 5G1PA 2HMAA 3C8HA 1EUDB 4N5LA 4P2BA 2ZUSA 3Q98A 5FWDA 3SQNA 4BECA 4DRXB 5ALWA 2ZIXA 3K0CC 2WF5A 1C9NA 4I19A 2P68A 1QO9A 2VYCA 1A69A 3OIUA 3PX3A 3TSAA 3IGFA 3WKCA 2J07A 1ZJJA 1RC1A 4CKEA 2LZ0A 5A5EA 3Q7TA 2R84A 4CM9A 3BWDD 5JBQA 5KNLA 1KIAA 1BJKA 2CK3A 1SUPA 2QTGA 4HWTA 1VQ1A 4K7JA 3EXFB 3GBVA 1T29A 3DVRX 4RHXA 3SIWA 2G9UA 2J6HA 4Q4CA 1OLXA 1GZ6A 2JHCA 4FYYA 1DT3A 1K4YA 1HEIA 2YV3A 1XZJA 5AOAA 1F2TB 1UBMS 4F85A 2HK6A 3MT7A 2PUTA 1MPTA 3TPZA 1YZGA 5KYYB 1J20A 1M90Q 5E0OA 1LFAA 2PTHA 3BL5A 5C81A 2F7SA 4I4TA 1E1YA 2QI9F 2X0IA 1VPVA 4I36A 4OUDA 2YZ2A 1CIPA 1GTG1 1PN3A 3UHAA 3W6PA 1M5RA 1CU1A 4AI6A 2RGUA 5JZBA 2QL7A 3L07A 3IS3A 5EHQA 3NHYA 2AFDA 4BV8A 4DMUB 5AICA 2QMZA 1QTRA 1EDOA 1E2FA 1X42A 3SZMA 1MT0A 1YDWA 3LGXA 3ND7A 5BV8A 2I4TA 5C53B 1FFAA 2EL7A 2BE7A 2W8BA 3LCJA 1LDGA 4M7PA 1TEVA 3T3PB 4RS4A 2Z98A 3NTEA 4GQBA 4E03A 5KX5B 5KYKA 5DGTA 1VL2A 4PWVB 4C6SA 1PS0A 2DSTA 3B82A 3LX4A 4GZLA 4LE1A 3SC6A 3UUFA 1US8B 2NXNA 2P0YA 2Q8PA 1DC4A 1T0PA 2X2PA 3W2GA 3X1YA 5DWVA 3THYA 1GTRA 1L8QA 1KJWA 4QTUB 3DBVO 1S72P 1D2GA 1XZFA 3UG7A 5JXHA 3RYFB 5DIFA 3PFHA 3IESA 3A9WA 3L7YA 3S2IA 3TCXB 3TX2A 2JLXA 1EMVA 4ENRA 4HNVA 3M3PA 2VUTA 4OHCA 1IN6A 1MJ5A 1N2CA 3CCVP 5B64A 5I4KA 4B6EA 1RP7A 3G49A 3KSDO 4L7QA 4E1BA 4CTMA 5LQUA 4RW0A 5E6UB 1U94A