2EG5A

The structure of xanthosine methyltransferase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
354
structure length
344
Chain Sequence
b'GDTSYAKNSAYNQLVLAKVKPVLEQCVRELLRANLPNINKCIKVADLGCASGPNTLLTVRDIVQSIDKVGQLERPTIQIFLNDLFPNDFNSVFKLLPSFYRKLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLQWLSQVPSGLVTELIGTNKGSIYSSKASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCICKGVELDARNAIDLLEMAINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCIVEEEGSFEILYLETFKVLYDAGFSHIKAEYVASSVRAVYEPILASHFGEAIIPDIFHRFAKHAAKVLPLGKGFYNNLIISLAKKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthosine methyltransferase
publication title The structure of two N-methyltransferases from the caffeine biosynthetic pathway
pubmed doi rcsb
source organism Coffea canephora
molecule tags Transferase
total genus 120
structure length 344
sequence length 354
chains with identical sequence C, E, G
ec nomenclature ec 2.1.1.158: 7-methylxanthosine synthase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03492 Methyltransf_7 SAM dependent carboxyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.270 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2eg5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2eg5A02
4E2WA 5FCDA 3K6RA 4QDJA 2ZCJA 3FPGA 3LKZA 3FUUA 4P58A 4A6EA 2PX4A 4RTPA 4F85A 2ADMA 2O06A 3LX6A 3KR9A 4EK9A 2DULA 2OB2A 4A6DA 1XTPA 3GRVA 3KPWA 3C6MA 2PY6A 5EMKA 4PYNA 3GJYA 2G1PA 2V7EA 1M6EX 3DLIA 4X41A 3B89A 4X61A 4RX1A 4PIMA 3DMFA 5K0EA 5B1SA 3BWMA 4OQEA 5DXAA 2H00A 3EVEA 1XDZA 2QE6A 3MAGA 1UWVA 4PYIA 1JTEA 2IIPA 1KPIA 5ICGA 2PT9A 4HGYA 3UFBA 3FRHA 2AZTA 2ZWVA 3EPPA 4K6MA 5EHIA 5BW4A 1H1DA 1B42A 5EMLA 2AOTB 4CXMA 3OCJA 1RJEA 2JH8A 1N7JA 3S68A 2P35A 1M6YA 1EG2A 2EG5A 4KVZA 3HA7A 4CKBA 5E1BA 1SUSA 3EMBA 5FTWA 2FK8A 3PFGA 3ANXA 3FPEA 2AOUA 5CUQA 4BP3A 4FSDA 3NVMB 2ZBRA 1SQFA 2GH1A 5LQNA 3P9NA 3HVJA 1JTFA 3ER9A 4GUAA 4MIKA 3FTDA 2HV9A 5T6BA 1ZGAA 2P41A 2YR0A 1P1BA 1FBNA 1L9KA 2YUIA 3UZUA 2XBMA 2K4MA 5DTMA 2QM3A 3HVHA 2PV0A 4MTLA 4BP1A 3OU2A 4PCAA 3LBFA 2FHPA 3B3JA 5DX0A 2Q41A 1Z3CA 5LSAA 2UZ4A 1KYWA 2R3SA 3UJDA 4DMGA 4YMGA 3FUTA 4DKJA 3G2QA 3DLCA 1TPYA 2Y1WA 2CWWA 5ICCA 1O9HA 5DWQA 5F2KA 2AOXA 3G8BA 3OZTA 4GOOD 3HCBA 4WVLA 1YUBA 4GC9A 4CKEA 1NBHA 3UJ7A 3IHTA 2IGTA 1WZNA 3TLJA 1KYZA 2BR3A 5E1DA 4AZTA 2PX5A 3OFJA 3FUVA 3GO4A 2BH2A 1KR5A 5GIPE 2F8LA 5GOZA 3GRRA 1YZ3A 3CC8A 3CBGA 1DL5A 3MCTA 1R18A 3BUSA 3GDHA 1TW3A 5GM2A 5T64A 4ER7A 2ZZNA 3KQYA 2XYVA 3GNLA 3SSOA 2QRVB 3OU7A 4OBWA 1U2ZA 1Q0SA 4QPPA 5CVVA 3JWGA 3R0QA 3B3GA 3HA3A 4ISCA 3BGDA 5EOVA 3ME5A 5DM1A 3AY0A 4BY9E 3UA4A 3JWJA 4OQDA 2ZIFA 2PWYA 5HFJA 3KQSA 4HGZA 5DLYA 2UYHA 5EQJB 1G55A 3BKWA 2PBFA 3M6WA 3A25A 2OB1A 1JG1A 5E8RA 1BC5A 3G2PA 2H11A 1EAMA 2G70A 3MGGA 2AOVA 2PT6A 1ZGJA 2CMGA 2JHAA 5DSTA 4C03A 2OKCA 1YF3A 3ELUA 3BWBA 2JH9A 3HM2A 4PINA 3GIWA 5DRYA 1G38A 4KW7A 5CVEA 2NYUA 3LCUA 3REOA 3BKXA 1G8SA 4POOA 2ERCA 5ICEA 3FRIA 5GIOE 3Q87B 2ZBQA 3PT9A 4AUKA 5CM2Z 1FPQA 5KQSA 2NXNA 1NBIA 2P1DA 5FA8A 3D2LA 4M37A 1X1CA 3LKDA 1XCJA 1XDUA 3BGIA 5BXYA 3LL7A 3T7RA 3GGDA 4EKIA 1OR8A 3E8SA 5EIFA 3FPJA 2B2CA 3A27A 3R3HA 3TFWA 2YQZA 1KP9A 3BXOA 5DM2A 5K09A 1HMYA 3UWPA 3MTEA 5DM0A 1BHJA 5FHQA 2C7PA 4MQ4A 2AN4A 3DOUA 1D2GA 3GU3A 4AX8A 3LHDA 3TOSA 4HSGA 4NECA 4ER5A 3EMDA 1VP9A 5EC8A 2GAFA 4PYKA 5DXJA 4ER0A 2NNWB 4RTQA 5K0JA 3KPUA 1RI1A 4PYOA 4RYLA 3KQQA 3I9FA 4GQBA 4HC4A 3TM5A 3KKZA 5DX1A 4YV0A 3KR2A 2ZIGA 3G8AA 3P9CA 3KU1A 1R74A 3EGEA 5F2NA 2P3OA 3MB5A 3H2BA 1EJ0A 3VSEA 3ID6C 5K0FA 1QAOA 2GB4A 2ZZMA 1O9GA 1ORIA 4DZRA 1EIZA 5GM1A 2FPOA 3HP7A 4HH4A 4FS8A 3OE5A 3KHKA 4YV2A 3OE4A 2PXXA 4YV1A 3M6XA 3UJ8A 3MHTA 2ZVJA 4P7GA 3NW9A 4H0NA 2PWPA 2OPBA 3LSTA 4FP9A 2YXLA 4U7PB 5C0OE 4RWZA 4YUVA 5DSXA 3TPZA 1RI2A 4GOLD 4RV9A 3KQOA 4V0QA 2NXEA 5DX8A 4MWZA 5DT2A 3M6UA 3BWCA 3UJAA 2C7OA 1N7IA 2A14A 4KWCA 1JSXA 2XYRA 3HA5A 2I6GA 1JG2A 4RVHA 4EVIA 1RJFA 2VDUE 3AJDA 3NVKI 2I62A 3QV2A 4E2YA 4X63A 1G6Q1 3B3FA 1I1NA 3FPFA 5IH3A 4LWOA 1AQIA 4HTFA 2Z6QA 3SSMA 2ZFUA 2ZTHA 1L3BA 3LCCA 2AS0A 2ZSUA 3DH0A 2ZBPA 3G2OA 3LDFA 4R05A 5HIMA 4Y30A 3GRZA 3VYWA 3U81A 1WXWA 3PFHA 1EJ6A 3NJRA 4V0RA 2Z6AA 3G5TA 1I9GA 4PONA 4E2ZA 2JG3A 1JR4A 3THRA 3GRYA 4E70A 2Z6UA 1P39A 3MERA 3TKYA 4KIFA 2B78A 5D1HA 3UJCA 5K0GA 4E33A 3DTNA 2QYOA 3FYCA 3P2KA 3DXXA 4MHTA 5MHTA 4R8SA 1R8YA 1NW5A 2PXAA 3GWZA 5BW5A 4Z2YA 3UJ9A 5GWXA 2IDKA 3HEMA 1SG9A 5FULA 5CD1A 4E2XA 2AOUB 2XVMA 5HIIA 2UYOA 3LECA 4L7VA 2PSSA 2FYTA 3I64A 3AXSA 3JWIA 3OZSA 3PX2A 3G7UA 1QAMA 4IKPA 4YUYA 3I5UA 4C07A 1XCLA 5LQJA 4FT4A 1FP1D 3BWYA 2CMHA 2YXDA 4GOND 4G56A 2BR5A 1N2XA 5JR3A 3IEIA 1R6AA 4PYJA 3MTIA 1D2HA 3SVZA 3EGIA 4XCXA 1L3CA 3RIEA 4RTRA 2WA1A 3TQSA 3FZGA 1VP3A 1VPTA 4E30A 4FZVA 3EVBA 5DPMA 5EG5A 3EEOA 2O07A 3G5LA 1X1AA 3F4KA 4X60A 3CGGA 1L3IA 5EIWA 5E1OA 4C08A 3P8ZA 3DR5A 3E23A 2JHCA 1XVAA 3FTFA 5KS2A 2WA2A 1NKVA 3QOXA 5EMJA 5K0BA 3ER8A 4RTJA 1D2CA 2OYRA 5CIYA 3DMHA 2GPYA 4CTKA 5K8VA 3B5IA 5CCBA 4RTSA 3A4TA 5E1MA 2OY0A 4EMSA 5C9ZA 1ZG3A 2NXCA 4DF3A 1Y8CA 3AWIA 5HEKA 1NT2A 5E9JA 3M4XA 1WS6A 2G71A 4QVGA 4X1OA 5G02A 2P7IA 1IY9A 2HR1A 1WG8A 3LDGA 4QTUB 3C0KA 1YZHA 2HNKA 2P3QA 4RTKA 1AQJA 2PXCA 3B7PA 4OA8A 3NWEA 3R24A 4YMHA 4AZSA 2P3LA 5LQRA 4PCLA 5EZQA 4BLWA 1QYRA 1RI4A 2P7HA 3V8VA 1M0EA 1HNNA 5E2AA 3PTAA 1SUIA 2IH4A 5FWAA 3RODA 1JQ3A 5HILA 5LQKA 3KQVA 3DXYA 5LQUA 3O7WA 2G8NA 3P97A 5DTQA 2GA9A 2IP2A 2VDVE 3LBYA 2ZULA 4OA5A 5C1IA 4QDKA 5FQNA 1KPGA 3T0IA 3NMUF 2N47A 3EVDA 1RJGA 5E8JA 3C6KA 2KW5A 5EPEA 4OX9Y 3DULA 3KPYA 3NWBA 4O29A 3K0BA 4QVKA 4IV0A 1KPHA 4AZVA 3FYDA 1DCTA 2YX1A 4HG2A 3HNRA 3EEYA 1L1EA 4RVDA 5EKUA 1YFLA 2OO3A 2QY6A 5K0NA 5EEGA 2IDJA 3QOWA 3LDUA 2H1RA 3LCVB 2O05A 1KXZA 5E9WA 3BT7A 5BP7A 2ORED 4GC5A 4KIGA 5M5BA 3UA3A 3SX0A 2P40A 1P1CA 2V74B 3KQPA 4PWYA 4U7TB 2ZWAA 1NE2A 1X19A 3TRKA 2ZW9A 5EHGA 5LQCA 4GBED 2UYCA 3CCFA 4E31A 3SXJA 3DUWA 3T7SA 4DA4A 2JHPA 4FR0A 3A7DA 1BOOA 1NW8A 1XXLA 4C4AA 2C7QA 3O31A 5K05A 2VDWA 2FRXA 3M70A 5KVAA 1UIRA 4F84A 4IV8A 2NP6A 3SGLA 1RI5A 2PX8A 5LQAA 3OZRA 3P9IA 3THSA 3VC1A 2IBTA 1VIDA 2PKWA 3P2EA 1SQGA 3DMGA 3GCZA 3CVOA 3A26A 2I7CA 3P71T 4XUCA 2NXJA 5H02A 2AVDA 3X0DA 3OPNA 1NW6A 1PJZA 5FA5A 5HZMA 3TM4A 1NW7A 4FT2A 5T67A 4ER3A 4ER6A 5JUWA 3EVZA 3UBTA 3EVGA 2LD4A 2OBFA 4GOMD 3KPVA 10MHA 3HVIA 2OZVA 2B25A 3KQWA 1R8XA 4M7RA 3IV6A 4KDCA 4PGGA 4BLVA 2AOTA 5DRTA 2NP7A 3EVFA 3O4FA 2IPXA 3FUXA 4LECA 4XUEA 4GF5A 1QANA 5FWDA 3GRUA 1AF7A 1VQ1A 4PYLA 2Y1XA 5EGSA 2C7RA 4Y2HA 2WK1A 3EVAA 8MHTA 3A7EA 9MHTA 4HTFB 4M38A 2BR4A 2VS1A 2I9KA 2B9EA 3KQMA 2OXTA 1KIAA 1ZQ9A 5E2BA 2BM9A 2HWKA 1ORHA 1R00A 1VBFA 3C3PA 1EQAA 3HCFA 3AXTA 4QTTB 1Q0TA 1O54A 2G72A 3NDJA 4EQZA 4RSRA 3UJ6A 1I4WA 4PYQA 4CTJA 3HCCA 3EGVA 3M33A 4M36A 1INLA 4QPNA 4R6XA 4P7KA 3SMQA 3CJTA 3G89A 2R6ZA 3NDIA 2O0LA 4R8RA 3TR6A 2IH5A 1JG3A 3M6VA 4FGZA 5FQOA 5EMMA 2YXEA 5LR6A 2AN3A 2VZ9A 4WXHA 3PLAE 4RTNA 4QQNA 3L8DA 3HVKA 4YUXA 2IH2A 3ORHA 5IKMA 3BGVA 5ICFA 5EEHA 4P7JA 3HTXA 1NV8A 1X1BA 3NTVA 5CVDA 5D1NA 5ERGB 4C06A 3V97A 4CKCA 5E9QA 3DP7A 3SSNA 3MQ2A 2PJDA 2AOWA 2GLUA 3CKKA 2BZGA 3HCDA 3MCZA 4KRGA 4LWPA 1TW2A 4XUDA 5KQRA 7MHTA 1YB2A 2GS9A 3KR1A 2EJUA 2PVCA 2EJTA 4ZTBA 3VC2A 5GINE 1ZKDA 2QRVA 4BLUA 4OBXA 1BKYA 4DQ0A 2BM8A 4RVGA 4DCGA 4R6WA 5U4XA 2FK7A 1V39A 4B17A 4C05A 3KR0A 3SR4A 5DTRA 2HMYB 1RI3A 5K0CA 4UOEA 3ERCA 4PIPA 3TMAA 5K03A 1VLMA 4P7FA 5EZSA 1VE3A 2EFJA 2EX4A 1IXKA 3PVCA 1UFKA 1FJXA 2AN5A 3CJRA 3E05A 4IWNA 5CVJA 1NW3A 4CWAA 1T43A 3OU6A 2PLWA 1RJDA 4AZWA 2ONZA 1DUSA 1IM8A 5FADA 3R6TA 2HTEA 1G60A 1MHTA 1JSZA 3FPHA 3Q7EA 4JXJA 1KHHA 2AR0A 5EVJA 4DM3A 4E32A 5HIKA 5HOQA 2ZZKA 3FUWA 1SVUA 3ELDA 5KYGA 3LGAA 3PX3A 3RW9A 1VL5A 3IYLW 3HCAA 3P2IA 5FHRA 1MJFA 4F86A 1FP2A 4ATNA 4PYMA 1SKMA 3JWHA 5F2OA 2ZLBA 3GXOA 3CJQA 1JG4A 3C3YA 1G8AA 2VP3A 4RTLA 3DXZA 3R9XB 1X1DA 2YVLA 4YUWA 1JQDA 5K0LA 1NV9A 4PGHA 1AV6A 3TKAA 3WSTA 4RTMA 4PNEA 3KPJA 4LG1A 4RVFA 4QQKA 3BZBA 2FCAA 3ELYA 2AVNA 2XYQA 3HCEA 1PRYA 2YTZA 4GEKA 2JJQA 5P8WA 3E7PA 4DCMA 3G2MA 1YFJA 5GP1A 1F38A 5HIJA 2CKDA 5DM4A 3FTEA 2E5WA 3G88A 2B3TA 2IFTA 3LPMA 5FUBA 2DPMA 3T7TA 1WXXA 5CVUA 2UYQA 1WY7A 2ZIEA 4FSXA 3EVCA 4YUZA 4EKGA 2XVAA 3FTCA 5K01A 3I58A 2PGXA 2O57A 1JQEA 2ONYA 3SM3A 2P8JA 2CL5A 1F3LA 3I53A 3PS9A 2ESRA 2IBSA 1XJ5A 4C04A 3KQTA 3OFKA 1QZZA 4HRAA 2PX2A 3PB3A 4RTOA 1ZHFA 1P91A 3UJBA 1QAQA 1XDSA 3ELWA 4KDRA 3P9KA 5CCXA 5EKXA
chains in the Genus database with same CATH superfamily
1D4AA 4DXDA 1I2DA 1NJ6A 3VRLC 1T3HA 1UAYA 1Z3IX 3K5IA 4QDJA 4EJMA 1QF9A 5DHAA 1KSJA 5LXTA 2B1IA 2PN1A 1U2RA 3RI3A 4JSRA 2JFOA 2P6UA 1EWQA 3B3QA 1P7ZA 3PNPA 2VN8A 3CC2P 2ICAA 2QL9A 3VH4A 4U9IS 3O8DA 4KFSA 4O2BB 1V6CA 1PT5A 3QE3A 4QQ8A 1W36B 3A6LA 4I9FA 1JXOA 4JI2B 4DV1B 1UWVA 4P33A 3HYTA 2JFVA 2ZROA 3WB9A 1X39A 1TRHA 2DAPA 3FTPA 3LZCA 1T29A 1Z6ZA 1USKA 1BFKA 1L6RA 1YZKA 2NT4A 3RVNA 1CEEA 4HEQA 5M34A 1CF2O 1BMTA 3JASB 2JB0A 3O8OB 4WESA 4GPZA 1WSWA 5IAOA 3IAHA 5CK4A 1USWA 4KO2S 3L0PA 3COSA 3TWOA 2QGNA 1HQCA 3GZJA 1GNPA 5A0TA 5EWMB 3ROTA 1P4SA 2HLNA 1GTL1 3PEEA 5KNCA 1SHJA 2PNGA 2Q8QA 3VNRA 4CL0A 1SQFA 1YAJA 4K6KA 4BNDB 4RY0A 4Y6SA 1QVVA 2WVJA 5BSRA 2F8SA 4OFZA 4Z4QA 4MIKA 3MB8A 2XB6A 3NH9A 4RM2A 3W3AD 4LYHA 4F2GA 4AJKA 1BS9A 1ZGBA 3K30A 1VG9B 3HVHA 1Z75A 2HBQA 2SHKA 5ES3A 1IHYA 4JP3A 3UGQA 1M2NA 3ZCVA 4BQSA 3BULA 3CX3A 1FYWA 1GQRA 1YJCA 2JGDA 2WIAA 4P3PA 2WINI 4TLLB 5F12A 3SCZA 3R6DA 1YR6A 1M66A 1YQDA 4RSGA 1ZSVA 2J0SA 3ITNA 1HDYA 4L0MA 3RK4A 2DWQA 2IBMA 2QUBA 4JP2A 3JSXA 2AOXA 3HN7A 4MA5A 4TUYB 5BUCA 3EWAA 1DC7A 4WINA 1YZYA 2AI3A 2WF9A 4MUNA 5T4EA 3TW4A 1XZCA 3YASA 3QELA 2PV7A 4RFSB 2W2LA 3C1UA 1PBTA 2FE4A 3PT5A 4HAUA 4M22A 2CF5A 3DE7X 2V8OA 4X90A 3V8QA 1XAJA 3KOUA 2R44A 2XOXA 4LDZA 3WRYC 2XYVA 4LV6A 4F1WA 2D13A 4LUCA 1YBVA 4C21A 4EPWA 3HVUA 3WYEA 3CUUA 1U2ZA 5BN5B 4TKVA 5CDTA 1QIEA 5DM1A 1RFLA 1SOUA 3L1HA 3M1YA 5EJ4A 4ZGBA 2WTAA 4B75A 3E7XA 4ILEA 1X1SA 4J6FA 1GZVA 1AN9A 4HX2A 2Z83A 3AF1A 3KXPA 3P9ZA 1Q1GA 2X9GA 1BE1A 2QTHA 2PBFA 3EF0A 5EYPB 3V4VB 1QYCA 1WX1A 4LHVA 2HMWA 5IBPA 2GWHA 3X1WA 3KBBA 3GAZA 4FGJA 1XQWA 4BGIA 2C3PA 2OKCA 3DZ8A 3DGEC 2AYXA 2JH9A 4FE7A 1OILA 3DKRA 1OHHA 4YJFA 1G38A 5BR8B 4F06A 1C7ZA 2I6UA 2OGUA 3LWZA 4DR6B 2E7ZA 1OA1A 4WCFC 4G4JA 2M6KA 4ZT6A 2E4XA 4KG7A 5D7BA 4Y2SA 3WLQA 2WKQA 4GKAA 2WU8A 3W8EA 4BYGA 3R5KA 1WXHA 2EW2A 1M74A 4M37A 5IUKC 1U7DA 4FDVA 3UFXB 4ZKDA 3RYCB 1FFXA 4R8VA 5LOVF 5KWSA 4AZ0B 3NO4A 2W0MA 4OB8A 2CD9A 4RNDB 2R7LA 2W6JA 3BXOA 5K09A 4CT0A 2ZQZA 1FYDA 1HEIA 1L5HB 4FCWA 4MRRA 3IKJA 3PIDA 4FD3A 4IAOA 3H2SA 3SC3A 1H3EA 2P6NA 2I9PA 3TK1A 3KL4A 2H0QA 2X4LA 2QMOA 2AMVA 1Z16A 3ZZMA 3TW8A 2QWXA 1TK9A 2LWIA 2MYNA 3L9XA 2P3OA 5F5LA 2XUPA 4B8YA 2G76A 4V2IA 1ZVVA 1SULA 1A96A 2J07A 2RJ3A 2HMUA 2JGLA 3PPYA 5LBIA 2GPWA 2DR0A 4BO1A 3G26A 1IIRA 1MJNA 1XD9A 2ODPA 2WUGA 1YS2X 2VSYA 3IEXA 3KKEA 4FYKA 4QXPA 2FVFA 4RJKA 2JKYA 2ZYGA 2L22A 3KFXA 4HQ6A 3SXUB 4A2CA 3L0BA 1GNSA 2AEEA 4DJEC 2Q3MA 4ZCRA 2BBWA 2VAXA 2PXXA 1AUXA 5EJGA 4LDAA 4KPFC 2E5LB 2J30A 3UJ8A 2Q7OE 3MJRA 3QUCA 5JH7A 2FPWA 2PWPA 3FSEA 4C03A 1TO1E 1FLNA 3MNFA 4QJBA 4BE9A 4BNGA 3NBUA 2QN3A 4BNLA 2GO7A 2QJOA 2Y1KA 1KU0A 2XYHA 4I8DA 5FLEX 5DCWA 3UJAA 3BC1A 1JRLA 2IZ0A 3CU5A 3HY4A 4UC0A 2REQB 3IE0A 3QZUA 4YCDA 5ETJA 5BN1A 2I62A 4MLPA 3NC0C 3IBCA 4Y6RA 4AJPA 4K8RB 3SF8B 4O2LA 2XH8A 3QOYA 1JKIA 3ORYA 5AW4A 2JAZA 1KVUA 1F2DA 1SVWA 3G0CA 3JVEA 2AS0A 2ZSUA 4KXUA 1DXQA 1T13A 4Z9BA 3U81A 2IEYA 2A30A 1EDBA 4QHSA 4RXUA 5LDDC 2I66A 3LHKA 4FJ1A 4KQIA 1EQUA 2QPAA 4QO7A 3E22A 1O6CA 4DIEA 5INTA 4NCBA 5IMSA 3FR7A 1A5TA 3LRYA 1TZ2A 4KIFA 4NJMB 3T3EA 2FG5A 4LNHA 2QMEA 1IVYA 5CFRA 2YC4C 2J85A 5H1YA 5KWIA 3CKLA 3PEFA 1MZVA 1QE0A 1R8YA 3DBVO 2EDCA 4CM8A 4I66A 1U3CA 4U6SA 4I14A 4EI8A 1XUOA 4U00A 4E4RA 2HDNB 2UYOA 1WKCA 2PX3A 2Q6VA 3STWA 1UPAA 2GYUA 2C83A 5CXQA 3I12A 3PX2A 4BNTA 2XCSB 3ETLA 3EQ8A 1E4YA 4YUYA 3D4LA 1E2DA 2HD4A 3BFXA 3C6XA 1NSYA 3WHIA 4J2OA 3FYHA 3SC4A 4LVUA 2XV6A 4FGKA 1KEKA 4GOND 2BR5A 3B1KA 4GLLA 1KL7A 2ZE6A 3F46A 2H65A 4MKGA 3O8CA 2BGWA 4RF2A 4F1KA 5HOEA 4UCXA 3TSYA 4TROA 3HZRA 1QOQB 2Q4OA 4QPCA 2Y3IA 4N65A 1ZNYA 2Z3WA 3G1UA 3CT4A 4QFBA 3TQSA 5LNK6 5J3JA 4G0WA 3EEOA 2B21A 3G5LA 4I08A 3STUA 3TBFA 4BQNA 5IKXA 3I32A 2W83A 3JCZA 2HLHA 1PYGA 3G4SP 3HE3A 4X7MA 5HCUA 4WERA 4UARA 1QKJA 3FTFA 1ZISA 3THXA 3HXKA 4INJA 1QGUA 3EZGA 1QH0A 1U1FA 5IHXA 1IQRA 4AJ9A 3ZGNA 4C0HA 4S1WA 3HUFA 1WXQA 1KP3A 2G82A 2OY0A 4WDRA 2Y0BA 3EXG2 2VSNA 3HU1A 2DR3A 1JFRA 2JIPA 2PR2A 1ADFA 1HO3A 1H2ZA 3IAEA 4JEIA 3DUFB 4II3A 5G02A 1SCJA 2GYWA 2ZBEA 3KV3O 4KYIB 2QZPA 4HSEA 2G5TA 2Q8NA 2CDCA 4PCVA 4QLAA 1HYBA 2AUMA 4XQGA 1XPRA 4E09A 4CFYA 1SUPA 1KVRA 2QYHA 1OBCA 2JASA 1RI4A 3NLLA 5B36A 4XYLA 2YRFA 2JJMA 2IH4A 4KREA 3CPJB 1JQ3A 2WD7A 3L7YA 3BXZA 3IVRA 3JQDA 4DXAA 2G8NA 4B3MB 3IUPA 3RUHA 4ARCA 4FGSA 3LUJA 2A2ZA 1DB3A 4Y1EA 4L6IA 3S4YA 4JBHA 2XT1A 1IDOA 2BELA 4KLRA 3T4EA 1JB9A 5JXJA 1UKAA 3VR2D 3C6KA 3HY3A 3VOBA 4Y1GA 4GPTA 1VQNP 4JODA 3WA6A 2COEA 3WTCA 2RGCA 1Z6AA 1Q92A 3V42A 1SXJE 3DFFA 2VJQA 4EB6B 4X92A 4DDWA 4IV0A 3EZXA 1EZ4A 3K0FB 4TXNA 4PLTA 4DYHA 3NHBA 4RH1A 4KQJA 2OV8A 3IAXA 4IS3A 4I3GA 3QBVA 3Q3GE 1DBSA 5AMXA 5CDFE 5JCPA 1OZAA 1T0UA 2IDJA 3AM3A 4QICA 1PW5A 1YQQA 1I6WA 3F1KA 1II8A 1OT3A 3HHPA 1POWA 4N7JA 4CM3A 4CNQA 4IZHA 2ZRHA 4GC5A 2XB2A 2C9ZA 3ZWCA 2BP7A 3ZQ6A 3E2MA 4MOWA 4Q0MA 3GBPA 4BASA 5HW0A 4JGGA 3ZS8A 3HDTA 3EOBI 4BFXA 2XXMA 2X77A 3FMVA 4ZOLF 3URKA 4OMCA 4AXBA 1XXLA 3AUKA 1Y4SA 3IKMB 2EWVA 1FDRA 1WVIA 1CQPA 2Q2VA 3CEAA 3CFYA 1FSGA 2KE5A 3TDNA 4KO4S 1BG6A 1XKXA 3KXIA 2GF9A 2GTHA 3H47A 3A9CA 2XLBA 1PIWA 4RK5A 3RREA 3NAMA 3B1FA 4YT5A 2I2XB 2JC3A 3W5VA 4WJZA 1OC2A 1X42A 2CXRA 2WRZA 4LJ6A 2KGCA 2JIZA 4RM3A 1QRUA 4QU5A 3X0DA 1VFNA 2ZDQA 2CFCA 2QNBA 3HB4X 1G20E 2GJ4A 3KEQA 1XALA 3N05A 4KOAA 3T9FA 1ZM3A 5JYCA 3OT4A 2ZE7A 3WMRA 2PCJA 3NR2A 3CV3A 1U1DA 1QZ3A 4HNAB 4IGFA 3L0CA 4QUJA 4CL3A 2ZIZA 1CD5A 2X5OA 4WVFA 1JXAA 1Y3HA 4XFYA 1Y3FE 4U0BA 3S27A 1K8QA 2LBPA 3GVPA 4TZKA 1NI4A 3CF2A 3EVFA 2OP1A 4WZBA 2X5NA 5BNTA 2DGYA 3G21A 1E8MA 3EEQA 4P36A 3VPBA 5I7HA 2DH5A 1J8FA 3WNVA 2YV4A 4Z3KA 2HRDA 3HC7A 1RWVA 2FLWA 3KEOA 2J45A 4ZRNA 2RI1A 4C0KA 4BN5A 5JCOC 4A0SA 1QS0B 1YS6A 2ES4A 3FOFC 3NASA 4EB8A 3V4SA 1UNKA 2H1WA 2GBCA 4FM9A 3QE2A 4QD3A 3VHLB 1TU0A 3OIWA 3IEKA 2X42A 5EHZA 2PUCA 4K2HA 1E7YA 4YRNA 5KYWA 2I7VA 3L02A 1QRTA 3HCCA 3OTGA 3HNPA 4XCVA 2CYCA 5HG0A 2JJ2D 4MKIA 2K2QB 2YZKA 4ROTA 3EAQA 2JEOA 2QRQA 2X7JA 1XCOA 4HKGA 4I4IA 4B6RA 3QMMA 5ER9A 1TM1E 4B4WA 1WCYA 3ZIAD 4YMWA 1DJNA 3B6ZA 1XEAA 1XNGA 4M1MA 1Y1SA 3KLMX 1FP6A 1JXMA 2UUPA 3EASA 1JIUA 2X9VA 4PU0A 1R6VA 3DJYA 3A9VA 3GT7A 3L41A 4P0TA 1PEYA 3DE6X 1H6BA 3FM9A 3OECA 1OLXA 5K45A 2J08A 2Y0PA 2DU8A 5ALZA 4EW2A 1QP7A 1Z6TA 3CWCA 2YY5A 5KQRA 1T1GA 2A1TS 2B20A 2PQ6A 4BHTA 4N82A 4EEZA 3RC7A 3VC2A 1P2FA 4GP7A 4M1KA 1ZKDA 5KYNA 3LBNA 2VO1A 2KG6A 1S5PA 3C6QA 2BKEA 1GDTA 4LC0A 2IF0A 4QBGB 3JY6A 2QTVB 1DAHA 1SU8A 4KAJA 2JU2A 4J9VA 1DO2A 4MW6A 4B6EA 2F48A 2I65A 4C0QC 3VISA 3AVUA 5DNAA 5LYJF 4QDZA 3I61A 4RF5A 1UBUS 4Y0AA 3ZDQA 3C2QA 4DGQA 2QVBA 1F6WA 5IK2A 3N5KA 3TMYA 3CLKA 4MO2A 2VPYA 4IWNA 1Y48E 1U1GA 4Q3OA 2PUJA 3F6CA 4GI5A 4QSHA 3MJ4A 4PH1A 3LC7O 3HKBB 1FXSA 3PCXA 4JC8A 4DTCA 5ILGA 1IM8A 3TCKA 3C70A 3V33A 1VE6A 1YNOA 2GKOA 2I2DA 4IJ5A 1G4HA 4AY3A 1IRXA 2XWJI 2CMDA 4M9UA 4Z5XA 1RXWA 4MUHA 3ZW8A 3OZAA 3II6X 4US2R 3PUXA 3F9IA 1HE4A 3S1LA 3TD6A 2IYZA 2IXGA 4ARSA 1X1RA 2B34A 3ELDA 4EW1A 5EJ9A 3LGAA 4IG9A 3TSOA 3TJZA 2NUPB 1AZSC 2ISQA 2OZKA 3P2IA 4RKYA 1MOQA 1ZL0A 2EQAA 2F3QA 3MWGA 1NYTA 1KH1A 3OESA 4HS9A 4HUQB 4E5VA 2FR8A 3C3YA 3AEQB 1NF2A 1VQOP 2VP3A 2Y68A 5K6AC 4F92B 1X1DA 2IPMA 2Z8YA 3X2SA 1Y1LA 1KMIY 1FNCA 2GXUA 1RWBA 4RTMA 4RPHA 3B1XA 3E9NA 5KNBA 3KQKA 4G5FA 4F6RB 2G07A 2L2QA 1ZJJA 3P2JA 4D80A 1EK1A 1SXHA 3MF4A 4RPGA 5F4ZA 2A9JA 2WQZA 3DVAB 1I4DD 3IUEA 4UOQA 4ZJYA 5EJDA 1ZS9A 2YFHA 3L1IA 1JWLA 5KNCH 4RA9A 3OZWA 3V48A 3FTEA 2GETA 3ANNA 3KLNA 3O2SB 2JBWA 2P2SA 3V1NA 4EA6A 4FUQA 2XHZA 4L5AA 1MC4A 5TQJA 1SHLA 1GZ5A 4PANA 4IDAA 3WNZA 2YYSA 1GA1A 1OKKA 4O1MA 3EGDA 4FNGA 2QX9A 5BPHA 3W06A 2CSXA 2HHJA 1RZRD 4N40A 2WTNA 3WE7A 4TVBA 3ZN2A 1GNQA 1GGVA 1GZ4A 1NQOA 1WJGA 1S8FA 2CN1A 1Q3KA 3PPWA 5DCUA 2JW5A 1YRYE 4OF4A 3K0HA 5IAGA 1A69A 5LYYA 2VC2B 1HZZA 2EXXA 2PU7A 3RU9A 4V1CB 3GEHA 1HDGO 3SEAA 2BGMA 1L4LA 1ABEA 3H5WA 5CCXA 2TMKA 3ED5A 1KEEA 2WDPA 1HQDA 2ZCJA 2QS9A 4XR4A 1Z73A 4RTPA 1RWOA 4Q00A 2ADMA 3ZWVA 4IHJB 4AN0A 2WG0A 4OQXA 3T4UA 2PKQO 3DDHA 4E5KA 1CZHA 4PAMA 4JBNA 3PFWO 3JD2A 3VKGA 1F1JA 3Q2OA 3DCNA 1WZIA 3E53A 1N2GA 2D3WA 3OHPA 1KP2A 4IIDA 4CMCA 4D2IA 2PUHA 3T1VA 4BN0A 1XDZA 2I76A 1IU9A 4AJLA 5COBA 4DMHA 3W8RA 5K6AA 1W5SA 2E0IA 2IIPA 3I3OA 3TTTA 3ZHTA 1D1PA 2PT9A 4MI9A 3IT1A 4FGWA 4KFCA 1QZUA 2R60A 4YAIA 5JLJA 1B0UA 3WRXC 5KTPA 1GXHA 3HDGA 4DG9A 2BISA 2OKGA 2GBLC 5KVQA 4UTVA 3FRJA 2VUIB 2IXDA 2OVBA 4ZO8A 1XZDA 2VPTA 1Q57A 1YZFA 1RJEA 1JBQA 4DT1A 5E7QA 2OESA 1OMOA 3KETA 1LPNA 4P4GA 4FFWA 1T8KA 3PXGA 1H4VB 1TU4A 4Y1RA 1YZNA 3VNSA 1DU4A 1SEVA 2DBYA 3HYBA 2FMHA 1SB9A 2HHLA 1S0UA 4GUAA 5HGMA 1UP7A 2QG4A 4XWKA 3OX1A 3N70A 1DKOA 1X7XA 1H2BA 1P1BA 3NHWA 3PE3A 4YJGA 3JAMA 1HX7A 4Y18A 3QV1A 4PGMA 4LJ4A 1WHTA 2PSHA 2PZLA 3MJDA 4IPTA 4KFUA 4BP1A 2VQDA 4FWIB 1WSDA 2BJWA 3UQYS 4IDPA 2C59A 2O3SA 1GAQA 1P7WA 5CEFA 5HX7A 2MR8A 2UZ4A 2WYUA 2XYPA 5GZ3A 4XLLA 4EVSA 5JALA 2QN7A 3FE2A 5LYJB 2FWIA 2F62A 2XCIA 5EMNA 4C7XA 2M1ZA 2WYWA 4ZOBA 2GZIA 1GZUA 2A9RA 2QNWA 3BIXA 2ZTSA 4HDRA 3H5IA 4FGUA 4RLHA 3R9WA 1NBHA 2VP5A 3AW8A 4L57A 2NU7A 5CA1F 1TK2A 3MOIA 2OILA 4XWAA 3CPEA 1CUUA 4R71A 2BH2A 2N6ZA 1JF8A 3OCVA 1P6QA 4K6GA 1YZ3A 1A5SB 4F5EA 5JCXA 1U3GA 3EQ9A 1HY3A 1ATIA 3DTVA 4CI9A 2Q5CA 4XLZA 4CIYA 4MZXA 2ZE5A 3AJ8A 3GMIA 4F8YA 2WYOA 4Z4IA 2G80A 2KOQA 1ILWA 1H2FA 1WO8A 2OBNA 3ZE6A 5EP1A 4N5NA 4WCDA 5KBYA 1YO6A 4UKDA 2QUAA 5H5JA 1GXSB 2GHRA 1KDPA 1X3SA 3Q41A 4JI1B 2DUJA 1F8FA 3F5MA 2NZYA 3M5WA 5AK4A 3WL6A 1CY6A 5HHTA 2PPVA 4PZYA 3CN7A 3VDXA 3RYFB 1IBKB 2QXTA 5EQJB 1O94A 3RVRA 1M6NA 1GP2A 4FINA 2YMPA 2HBYA 1S72P 1QHYA 2H11A 2XTMA 2FPSA 3P0JA 4PAWA 4U3JB 3A2MA 3WBBA 1ORDA 3MAJA 1H05A 1MVOA 1RRKA 3HM2A 5HRAA 1KETA 5DRYA 4G0YA 1QV6A 2XI4A 3DB2A 1E2NA 1BDJA 1E2IA 2OT3B 2XLCA 3HI4A 4GZ5A 1QFMA 4OP3A 3QQ5A 1EDDA 1RVV1 2V1UA 4BFYA 1G5RA 3RU2A 3PEVA 4TXLA 1TUEA 3NYQA 1T5DX 1Z2AA 4U63A 2CDBA 4JJGA 4F86A 4CM4A 5FA8A 2AFHA 4F6CA 2ZSKA 3JWPA 5ESDA 1SZJG 2XT0A 4DMCA 3PVSA 3I2JA 4L0DA 3OOEA 3H6GA 5EIFA 1KA9H 4Q1AA 5F9HA 4E4TA 2PLFA 2Z3VA 4MI6A 5CTAA 5DXFA 3C7DB 1B4DA 5A4DA 5HUQA 4QFCA 1TJYA 2C8LA 1B23P 3BRWD 2XT9A 1F4PA 3N8KA 4JIMA 3BJEA 3LLUA 3PKIA 3V00A 3LHDA 4DG8A 3ADPA 3E35A 3L82B 4D26A 3T9AA 2MU1A 5KEIA 4BVJA 3DCYA 3EXHA 1MPXA 5EP4A 4LXYA 3WIBA 3WOVA 1DG3A 3DS3A 4R3UC 3AFOA 2IGBA 4JOQA 4WN3A 3EJBA 2DSTA 3MUNA 3NJ8A 3R5XA 4B8ZA 4TS4A 4D6XA 5CYPA 5ANRB 3WLFA 4RD1A 5LD2B 2D7JA 2ODBA 2GAOA 4XYMA 5DK4A 2QQGA 3H2BA 1YRQA 3ID6C 3O92A 2WD8A 4DLPA 2VCEA 3FPAA 3IMEA 4EA7A 4Y2TA 4AYXA 4BNVA 3ZWKA 1ZJWA 1DEHA 1O9GA 2IYTA 3QM1A 2JB9A 5FPSA 3HP7A 1P44A 3QVGA 2HA6A 4UJ3A 2YVQA 1ZA1A 2PRJA 3K70C 3NHAA 1E2JA 3KUUA 1SOWA 1Z38A 5JSYA 2QT1A 3IPYA 2CCGA 4P7GA 3UJ6A 3LSTA 5CK5A 1U2EA 3C3CA 3ZW7A 1QG0A 4XROA 3VOSA 1Z6MA 2HDHA 2JAHA 1H4SA 4BB9A 1L5VA 1UDXA 3T9BA 3TNLA 3BWCA 4RCYA 1CB7A 2GDZA 2N6YA 1N8NA 3FIJA 3OD1A 3OLWA 4RETA 2H1IA 3AJDA 1YR8A 1I1NA 2KYRA 3VNBA 1J1IA 1NSFA 4LJAA 4Z1OA 1NYLA 4NYIR 4D8XA 4DDKA 4BVHA 5G53C 4CCYB 2ZT5A 1E77A 3ZR4B 3SHWA 2PKXA 3QK7A 3KFLA 3DHWC 1H2EA 4IH1A 5JO0A 3SHQA 1PV2A 3P0IA 3PGJA 5BSEA 4N39A 3SWWA 5DN9A 2FI1A 2R25B 1P39A 2WM2A 3F9RA 5DHQA 4MS3A 1OGYA 2B78A 3E48A 5HUHA 3KP1A 1EE2A 2C3MA 2QYOA 3FYCA 2H85A 3MWKA 1J90A 1FU7A 3JQ6A 5IP5A 4PWVB 3W77A 4JHLA 1PQUA 1R16A 2PXAA 5ALNA 3OPYB 3M34A 5FXMA 3LCJA 4JQYA 4QO8A 5G3ZA 3GROA 1HPLA 4NBRA 5CA1B 2C77A 4W5OA 2AD5A 1NQVA 1LW7A 3N5CA 4FFDA 3Q6IA 1JHVA 3SOPA 3IMCA 4X1IB 5CXXA 5D3QA 5J23A 3H1TA 3OWOA 3DPIA 4HNRA 4OQFA 5A1TA 5KJFA 3G2NA 3VGJA 3L7BA 5EE0A 2BVNA 3F5SA 1U0FA 5E2IA 5BNFA 4CUJA 4URXR 3Q8XB 1GRVA 4BWYA 5BWMA 1A50B 4D8YA 3BXFA 2FWBA 3OKPA 3VX4A 4ERXA 2V0GA 1QVGO 4MWGA 3FTQA 3E5RA 2WWYA 3TX6A 5EXDA 1FFCA 3GUCA 3W7BA 1V37A 2P5TB 4RTRA 1TT5A 3DE5X 4W6ZA 1MC8A 1CLUA 3RLIA 2EL9A 2R65A 2GK6A 4JMLA 3MC1A 1X7YB 2O2CA 1IXYA 4WKOA 1RM0A 2WF7A 3UMRA 2ZJ3A 4UEOA 3ELBA 1ICIA 1X74A 3H9JA 3UXMA 2AR9A 3A9UA 1DAKA 3E23A 1M1NB 3BYZA 4KI0A 1Z08A 4X44A 5KS2A 3L4BC 4I7EA 4D42A 1NBOA 1UOQA 4F4IA 3DDCA 2DKFA 1MFZA 1Z0SA 2PZEA 1JHQA 2F00A 2M6RA 3DMHA 4GR5A 4WXPA 3B5IA 5EXXA 2EEPA 3VMMA 4TSKA 3RYHA 3CZCA 4G5XA 4YDHB 2O48X 1U02A 1AKTA 1P74A 1ZD4A 2AI2A 4NU6A 1P1RA 3EFHA 1PNRA 4BFCA 4D4JA 2R751 3GHYA 4GM1A 3L4KA 1Y9EA 4QTUB 1YZHA 1EFVA 3C4VA 1YJBA 1DO8A 4R2LA 4EX6A 1P4GA 1Y9ZA 1WVMA 3F4BA 4OA8A 5JFGA 2C98A 2I7TA 2XQIA 1ORRA 3WLNA 4RQBA 1HNNA 3SFZA 1PGJA 1H2XA 2BEUA 4B47A 2R8ZA 2P65A 2NAFA 3T5PA 3PU6A 4WN9A 2GCEA 3E5HA 4RKRA 4PG7A 3V9PA 1P62B 1RAIA 3M89A 3MD9A 4H59A 4GNKA 3QVKA 3H2HA 1AB5A 1M2JA 2FMUA 2QUZA 3F78A 4QDKA 3T0IA 1H4QA 1RLTA 1T6YA 4FE4A 1WLSA 4JI0B 4NENA 3W3ZB 2ENWA 2YZ7A 2GVDC 3A1EA 3W9YA 3RU3A 4E13A 4GGPA 4Q4DA 4N9QA 3T06B 5JISA 1BMQA 1JYEA 3JAWB 4OGKA 2CYBA 2PD4A 4CM5A 3IAFA 2QR2A 3D1LA 1DCTA 3D43A 1Z5PA 3HNRA 1QDLB 3GJ8A 4PLPA 4ZQEA 3RVJA 2PUVA 3ZHCA 1HQKA 1OAOA 4ZCSA 4ZYYA 2GM9A 4K28A 2A84A 3UANA 3FJOA 4D43A 3LCVB 1V3QE 1QJ4A 1ZXBA 1SCAA 4KIGA 5I7WA 5K0TA 3UA3A 3U6BA 1ACPA 4OU4A 4ZO7A 4B32A 3L6RA 3IKLA 5L6LB 2R8PA 2PLRA 4R01A 3A37A 2WVAA 3D0KA 2XCRB 3A7DA 5A3SA 1BOOA 1ZY2A 3RS9A 3RVQA 1KMCA 4DR7B 2ZI4A 2FRXA 4RZUA 3TW0A 4CQLA 5HR5A 2YJ4A 1I2MA 1ZIPA 2AFEA 5EWJB 2XA1A 2NP6A 5COAA 1RXYA 5CLLA 1F6DA 3AFNA 3GR6A 1YA8A 3IXLA 4S1TA 3EEFA 4LDJA 1HTWA 1JI0A 1MB9A 1JTVA 2Q4DA 1XCGB 3P71T 2BFDA 2NXJA 4WDQA 4N41A 3H04A 5JDCC 3OPNA 1NW6A 2OQ2A 1SOVA 2R1TA 1S4QA 2VCYA 3SX4A 1CP3A 1JH8A 1EG7A 2G17A 3M6FA 4YY3B 5KOIA 1TIPA 1D4OA 4Y2YA 4DYDA 1I5RA 1E3TA 4GDMA 2ZBVA 3IV6A 2Q3HA 3HZQA 3NOXA 3OEHA 4J16A 4TT3D 4DLXA 4EHNA 2QRUA 1IBMB 3IPRA 3GUVA 4FCCA 1WM1A 4QX6A 1W35A 1YL6A 1U1EA 4MPRA 4OQYA 2ODQA 3AEUA 3TG8A 1R6DA 3IP6A 5EGSA 2CFTA 4Q5IA 4YJHA 3SKYA 4H1TA 1IXRC 4QUAA 4QJ5A 1Q12A 3PHIA 1ZQ9A 5A4MS 3AESA 3ANTA 3HCFA 1SC3A 4B8WA 1Q0TA 2IYWA 1SXJC 1T9KA 4L4RA 1KYQA 3LXXA 1F0NA 5TB5A 1E6CA 3RSHA 2DFNA 3R3XA 4R6XA 1SUEA 4GFDA 1W6UA 2P2NA 2V7TA 3M4YA 3NDIA 3NHYA 4GOXA 3FYUC 4F93B 2WKPA 4HWGA 4OYRA 2QQFA 3WQRA 1Y5NA 1EXVA 1VKJA 5EMMA 3RV4A 1M7GA 4KR9A 2EC5A 1DKRA 5FI5A 2I54A 4J2TA 1EEHA 2XUGA 3BXEA 2JLVA 4FFMA 3H19A 2XGGA 1KDVA 1D03A 3UPDA 1Z26A 1JIIA 2QTWB 2LV8A 1VSQA 4XVHA 3O2QB 4K3UA 4C7OA 1BDBA 5I9IA 4NV0A 3PGA1 3PNBA 4C5BA 4ZTUB 2QXUA 3AVOA 3TLKA 5C8ZA 2BBTA 2QTRA 3FOCA 3PTZA 4KXLA 4L22A 5FOWA 1LJ8A 3UG7A 1I9CA 5LP6F 1UMBA 3C8DA 1M2GA 3KR1A 4H6PA 5K3FA 4LXHA 4D98A 5AVWA 3K6SA 4F0JA 4BV3A 1AKYA 5B57C 4IDHA 4WCVA 4YAJA 3TTSA 5TQ0A 3U62A 2ABWA 2C7VA 3TL3A 5CLFA 5BUQA 1TCVA 4BNUA 5JLAA 2F90A 2BHNA 2HI0A 4ILKA 1JDPA 4NBSA 3VQTA 3WX0A 1GZ6A 3SC2B 3ZCSA 4DCVA 4HYQA 1PJQA 1WETA 3TLXA 2A9QA 1MQ9A 2QGZA 3PVCA 4PZZA 3H4IA 4LJ8A 2GM3A 5C1BA 5IJ0A 1AJEA 1VHNA 1UUFA 1OGIA 4ZVMA 3W4JA 1RWPA 1ZD1A 4AZWA 2GHTA 4L6AA 4TQAA 4NEQA 3KQUA 3L7LA 4MUAA 3ZDFA 5CPFA 3A6FA 1QPGA 5JU6A 5JZSA 1RP7A 3V6MA 1ONSA 2E3JA 1JSZA 2OC9A 3VZRA 3WLJA 5E7MA 5L4NA 3UUGA 5BSGA 1YCDA 1VMKA 4ZEXA 4NTZA 3RC2A 2YHIB 1PL0A 5I8ZA 3SM9A 1Z6XA 4TLMB 2EKBA 4D0SA 3PUZA 1WP9A 4C20A 1L8OA 2XMPA 4EI9A 5T5QA 1EXMA 1F1BA 1OOEA 2WG1A 2VNSA 2Z6VA 5AUPB 4Q9LA 4RD2A 4ALKA 3OMLA 3AB8A 2PE5A 5KTKA 4XASA 1IHOA 3KB8A 5FX2A 5CM8B 5BSVA 1D8AA 1GZ7A 1T8UA 3DXFA 3O8BA 4PLFA 1BQ4A 1JHZA 1UK9A 3RADC 2D1FA 1P2TA 3U4CA 1OV4A 4OAPA 4AF7A 2FPIB 4L51A 1KQOA 3V4RA 1SHKA 4EA8A 1N7HA 4PR0A 4D0RA 2IX3A 1XCMA 4IW3B 3A2NA 4CR8A 3KTOA 1KJYA 1W94A 1CQIB 1X7ZA 2JFQA 2ZYTX 3QUAA 2G9NA 5K3AA 4MWBA 2UYQA 2WMOB 3KCNA 3IE2A 4NZYA 4JQOA 4EGSA 5CFNA 2Z09A 2XZDA 1QOZA 4KE9A 3T7KA 2KOSA 4BVFA 2XIQA 2ZB8A 1HFEL 1OAKA 3D31A 2NU8A 4E15A 5A4KA 5JDIC 3GCXA 6NULA 3PS9A 2Y1DA 5EIEA 1RAGA 3QWAA 4P0QB 4GX2A 3O4IA 1QZZA 3BH6A 3DQQA 3PB3A 1GO2A 1BN7A 4IDBA 4O33A 1UK7A 4EUNA 3PEYA 1P91A 1WABA 1XF9A 2ZYRA 3FNGA 1K8YB 2CB0A 2KMLA 3SJUA 4EFDA 2JA2A 5H8WA 3KSMA 1WDMA 3L2OB 1Q1QA 2WILA 3GLHB 4LRUA 1NR7A 4DE5A 4WZAA 2XTJA 1NFQA 4QWWA 1Z6YA 2N1BA 1JHMA 4M9SA 5E0OA 4E0BA 1RRCA 2QMUA 3KWLA 5ENVA 3CVJA 1RMQA 3P27A 5DWDA 4TM7A 5FBWB 4HWPA 4F2PA 5ARDA 3U4MA 2IX9A 4DPMA 4D41A 4ABYA 2V7GA 2B30A 3IX7A 1MPTA 4Q4HB 4C7KA 1BVUA 3LY7A 4GGMX 2R8BA 5K9ZA 5K5EA 1U6JA 1XIVA 1SVOA 5ALDA 2XUOA 2CXPA 4GPBA 2Q27A 5IT4A 1EK0A 2OV6A 4W8OA 3ZY5A 4BNJA 1J2YA 1P0IA 1HLDA 1Y8AA 2GWRA 4TTIA 1LWNA 1FRZA 1M6YA 4R41A 1PQPA 4ED9A 1O08A 3WKAA 5AHKA 1S1MA 1SUSA 2BGJA 3D2AA 1U9ZA 3FPEA 1CRQA 1E64A 3WV4A 4LF6B 2MHCA 1JAXA 2WBLC 4ZYLA 1V1MB 3WZLA 1N6IA 3EYWA 2I4LA 1NHGA 5KWVA 4RZQA 3S2ZA 4KRYA 1BD3A 1C7IA 4NI5A 5LP6B 4I1RA 1ZLYA 121PA 1IZ0A 3AEXA 1ZH6A 2VKTA 3MYRA 4K9SA 2RGDA 2M1XA 2QJRA 4MTLA 3MYYA 1QQBA 3PGLA 2H7XA 4GH5A 2R7KA 3AR9A 4RFSA 1D1QA 1Q11A 3LX8A 4KQ2A 4WYMA 2FWAA 4LZZA 1S2MA 3C3MA 3FF4A 5FBKA 2H7VA 3AHDA 1K0FA 4ETMA 3ZV7A 1Y4UA 1IEWA 2GBFA 4PPFA 2XCQA 2Y1WA 3LIIA 4DM4A 4Q1DA 5JVDA 4KIJA 2E4ZA 1O9HA 2WTBA 3OP4A 1EFDN 1YUBA 3VTKA 3AETA 3O6VA 1L7MA 1JDVA 2HC9A 1FTYA 1VA4A 4ZT2A 5LC1A 1BMDA 1SCQA 1G21E 4CW7A 3GO4A 3VSDA 4Q9AA 1KR5A 4MUBA 3KQLA 1Q86Q 1Y7TA 1JSLA 3UCFA 2YWHA 3TIGA 2P2DA 3LUDA 1R18A 4G63A 3AUAA 1TW3A 3RARA 1CDOA 2E6KA 3ABOB 5ITWA 1LFDB 4GG1A 2J9YB 3GEEA 2QSJA 3S3TA 3QU7A 2OZPA 4GPAA 4OL9A 3ZDZB 3UJ3X 1LPAB 2IEIA 3C41J 3KNZA 4FOOA 3M4JA 2JHGA 1K2WA 5T4HA 3SIPA 1XEXA 1FMTA 1FDUA 1HRKA 3DDUA 1OIVA 2ZWIA 3C5VA 4FHEA 1KBQA 4IWXA 2ZIFA 4Q4JA 3MRXA 5BYBA 5KDLA 3UM9A 3OTOB 3U3JA 2QIPA 3OJFA 3EN0A 2WOOA 1RC0A 3TM4A 3LYLA 4EFMA 7ADHA 1JG1A 1U2PA 4BUZA 5AW3A 1ZI9A 2G70A 2O7SA 4CT5A 4II7A 2NMVA 2CJWA 4JLSA 4NBKA 4DIUA 5IDVA 4Z4FA 1T36B 1TYEB 2XKJE 1S7GA 1OXVA 4FC6A 3MWLA 2WJ6A 1SCDA 2V6GA 2NZJA 5ICEA 4IVQA 1IUKA 1CJBA 5KNCD 2R4UA 3UICA 2ZBQA 1YOBA 3OQ6A 4RA6B 3UB3A 2CLOB 2F43A 2Q3EA 3D2LA 4YB8A 5CD9A 3JQEA 5HP4A 4H7HA 3GGDA 1FDTA 2ZANA 1IEVA 1L5ZA 3FPJA 3O3MB 3KZOA 4HB3A 3R3HA 3SHFA 3BDVA 3RTEA 3TFWA 2P2CA 1GSAA 2X14A 3ITEA 4ZVKA 2N5HA 1BHJA 3GJSA 4DQDA 3L9WA 3WP0A 5LZ8A 5TQ2A 1D2GA 3GU3A 5IG2A 4A6XA 3EG9B 1OZ0A 4GT1A 4CODB 4M0DA 4UU0A 3KXDA 1PS9A 1HDIA 1RHQA 1F9EA 1OZGA 3ILXA 3QXHA 2WE7A 5CT4A 4CJXA 1NXVA 2GASA 2R8EA 3OFSA 4S0XA 2OSBA 1C3XA 2C4HA 5FLXA 2OENG 1SQ5A 4HEHA 3EGEA 5HF6A 4U1RA 5EP3A 3SQOA 1IMQA 1DC3A 1TMGE 2X5JO 1J49A 4NARA 4YIKA 2DSNA 2KOPA 2ZZMA 3FBTA 1LGYA 2W2LD 1PD0A 3CZ4A 1I3OA 2JCYA 4ND8A 5JAZA 2GDWA 1A0OA 5GM1A 5IAEA 2FQ1A 1E59A 3GEIA 2RIRA 4O4IA 5F5XA 3KDAA 3CVYA 4BO9A 4LFBB 2DFDA 2O5EA 4DTIA 3PJEA 3CLHA 4ZCQA 3UH1A 1W76A 3KFVA 1Y3CE 1JSRA 4FP9A 2N42A 3LU1A 2JBHA 2Z58A 4KXVA 2A4KA 4RE5A 4E5NA 4Q16A 1Z28A 4Q9KA 4MQ6A 3LXUX 1FFWA 4D9KA 1HE3A 3AR8A 3DT9A 4LGCA 1R0RE 2XMBA 1UMCB 4NS1A 2JAQA 3SZ3A 4EVIA 1CF4A 2IOQA 1QO7A 2WJYA 2DHCA 1DFGA 2RHRA 4FC7A 2IXTA 3Q7SA 5DZSA 4XOIA 1IBRA 2A3NA 3K4QA 1T5TA 3OJCA 1MJGA 4MLCA 2IY9A 3ZVRA 5K3EA 3IVMA 1Y8RA 5BS1A 2I0FA 4R2MA 3T34A 3QPWA 4C4PA 1MW8X 3GFTA 1TCBA 3GRZA 1IQUA 1OHHD 5D5PA 3W4IA 2LTEA 1XP5A 2HIAA 2WSSA 4IR7A 4QC2A 3DWEX 5ALIA 3G5TA 1I9GA 1AF8A 1JR4A 1MNAA 1R6TA 2AA3A 3CSDA 4HQOA 2VJNA 2X3UA 4IIBA 5EJ6A 2PH5A 4IXDA 2ZS7A 3B82A 4GZLA 3QPBA 2NUBA 4UU7A 4PGFA 2L9FA 1MORA 2JGKA 4H15A 1G2IA 5D1HA 3SQMA 3TPFA 5K0GA 4LDQA 5KOHA 5H9WA 2A1UB 1QH8B 1ACLA 2XIJA 4L8YA 4ZHSA 4EOGA 4BV9A 3MJEA 4G24A 4GI7A 4YQYA 3S2UA 5MN6A 5SZIA 3TGPA 1NUSA 3G6KA 3SJCA 1BJRE 1P9WA 2W6JD 1UBGA 4GI2A 1JIVA 2AOUB 3FZNA 4K46A 5D3KA 5GAJA 2P9XA 4F21A 2GUGA 4C2TA 1ELOA 2MSWA 1V3VA 3I3SR 1QC5A 1EP1B 1PYOA 5HF5A 1PE0A 2YCLA 3FFAA 4HVTA 4NYIQ 3K70B 2PNFA 2F2TA 2GVNA 1LPBB 1Q1AA 1NW9B 2NPOA 1J0XO 2WTEA 3PQFA 1VPDA 3R5HA 1B43A 4G56A 4Z86A 1Q0ZA 3PL5A 4H7IA 5KZMB 1OXXK 3I6QA 4ZJZA 3EGIA 3C6YA 2HKIA 4JSYA 4BNHA 2O2GA 3IS3A 4UOZA 4DUYB 2BI7A 3Q0TA 2BFAA 2O8CB 1NMYA 1JSCA 2KX7A 3TCNA 3ZHYA 1E4OA 1SQSA 2O07A 4HCJA 1KZGB 4YTEA 4X60A 3MWJA 3ZE2B 2R62A 5FO0A 4BX9A 3FHCB 4YRAA 3P8ZA 3B6KA 3I8OA 2GZ3A 3D8NA 3B2NA 4UEQA 3UT0A 1DAOA 5ED0A 3IPAA 4TX1A 5EIBC 4KUHA 3BFPA 4AO6A 2OYRA 1NAIA 3TG2A 3ZNPA 2D5BA 1BQEA 3I04A 1N6RA 3BBLA 3MTBA 3LYHA 4TTVA 1J0AA 1DC8A 2LGJA 3C16C 2QMQA 1RYDA 1E4EB 1ZG3A 2W2OA 1IY1A 1I80A 1SHUX 2HUPA 2CXTA 2O5RA 3FMOB 3GEBA 5DGDA 1M34A 5I5EA 3OLXA 3K4HA 2WFLA 5JCJD 2HR1A 1BMFA 4J2HA 2LUOA 3UT5A 4I4NA 1I7NA 2D8AA 3PSAA 3LVBA 1O8BA 3HJUA 3R7BA 2XZLA 5BT9A 3ZZ1A 3KL2A 4H9GA 3OEWA 4QXMA 4R3NA 3S1AB 1LBIA 1O96A 2XUHA 3WHPA 2X4GA 1DG1G 1E3IA 3I6YA 3PUWA 3O5AA 1JWAB 5B3JA 3K0FA 2X9NA 3ULKA 3HYLA 4Y2UA 3H9BA 3KQVA 1ESZA 2IXAA 1XOIA 3P97A 3SZGA 4EBFA 1E99A 2OM6A 1Z6QA 1UDCA 3G6EP 2AZ4A 3C15C 4AB1A 5KNDA 3PDIA 2NO5A 1YI2P 2I5PO 1M7HA 2VJMA 2B1GA 2O0JA 1VRVA 3EB9A 1V16A 1Z7EA 1CF9A 5FBLB 1FP4A 5LPNA 1JW9B 4GRIA 1KO5A 4MXDA 3KPYA 3IT3A 4WXEA 1F9AA 3FGPA 4O29A 3ZHOA 1WU8A 1UC5B 1ZM7A 2QM8A 1E9SA 2JAXA 5LUBA 4JI6B 4DCTA 3RAEC 3U56A 1L4GA 5HFNA 5ILOA 1Q81Q 4QYIA 2IHTA 3RSZA 1E2LA 5AQ1A 5EEGA 2WT8A 1UWKA 3G1IA 1VQ5P 5HGOA 1P4RA 3Q0IA 3ZGXA 3TR5A 2VZ8A 4D9GA 3MIIA 3JQFA 1IPFA 4COPA 1ISJA 1KQSO 4LNAA 3SX0A 4DLNA 1YDHA 4PWYA 2WHPB 1RTKA 4EW6A 1FE8A 2FPPB 2JGJA 4XD7D 1SXPA 1FDIA 4PF1A 2V9ZA 1TIBA 3DUWA 3PFNA 1XNJA 3GN1A 4LXIA 2PKCA 2GZDA 2PZ8A 1QG6A 2PD3A 5B1EA 1X7WB 3GLRA 1C8KA 1PNTA 2AWOA 2ECOA 2WWTA 3M70A 5HJEA 3PXXA 5JECA 1E89A 2D4AA 1U4NA 4EUHA 1SEPA 3OZRA 5AVKA 1GU1A 2Q3BA 4PHTA 2YW9A 1EZ1A 1ONBA 1IOLA 2YOGA 4YJ3F 2AXPA 2TSYB 2CXQA 3O38A 4G0UA 2VF2A 2AFIA 4QGAA 2X6QA 1H42A 3TOVA 3U61B 1RJWA 3B8EA 3GHHA 4ZZ1A 1TYAE 4NCAA 4A91A 3BQNB 3WTBA 2X1HA 1A5ZA 5F3WB 5K4AA 1GPUA 1OV6A 4U7WA 4F1JA 3HUEA 1DO0A 2P4SA 4GYYA 2R1UA 2QP9X 3R7AA 2FHSA 2WPDA 4HYYA 4MKZA 5ALUA 4FHGA 2OZVA 2ASEA 1U9YA 2CHEA 3GDOA 4BLVA 3H9CA 2HB6A 5KHAA 4AJ4A 1TE2A 4GICA 3VH1A 1KQFA 2TMDA 2W4MA 3FOBA 5C51B 2X8JB 4HLNA 3G28A 3LRTA 1OZFA 1YTLA 5C4MA 3I9LA 5F52A 2W2PA 3HL4A 3WLHA 5DNYB 4HQ0A 1ZH0A 1M33A 1B8NA 1ONOA 3CE9A 4N5DA 4ND3A 1FX0A 1XLWA 4MLDA 6LDHA 3VYTB 3G9UA 1X0VA 1E8DA 3QVJA 4HDNB 1ECPA 4N4AA 5AVJA 4EQZA 3NCTA 3VOTA 4UUBA 2JIBA 3EGVA 1PFUA 5LMZA 3SMQA 4O2AF 2PEOA 1QHSA 3EXG1 3NWOA 4R8RA 2HIHA 5HTOA 4GVLA 3S5JA 4CVNA 4F7WA 4B73A 2ET6A 2X15A 2FEAA 1N4AA 4QTXA 3CF0A 5A62A 1V96A 2QN8A 4DBLE 5DEOA 4YUXA 1G3RA 3AEKA 1L8LA 1TKBA 2V6FA 2JQ4A 4MUKA 3AB3A 3IA7A 4QUGA 1XJQA 3SJBA 3GZLA 1GR1A 4KBGA 1PK7A 3SICE 3SK0A 2F55A 4KTVE 3D1VA 4OYLA 1A9SA 3MIZA 5C3MA 2NGRA 3L40A 3C3WA 1ZRHA 2CLLB 3B9RA 3K09C 3MCZA 4H77A 4M8SA 4N3GA 4D9JA 3BILA 3DZIA 4UCWA 3BIFA 1TVCA 1AO0A 4Q05A 5IAJA 2P9HA 4HVLA 1DEKA 3A0UA 3U7RA 2OCLA 3WYFA 4XJTA 1FVFA 4R6WA 1V39A 4ENWA 1RI3A 5D5QA 5IHPA 4CLHA 4KQKA 3KX2A 4LCBA 3EHDA 1I0LA 3OF5A 3F49S 1VLMA 3N2GB 4OQNA 3TLGA 1VE3A 3G13A 4EY6A 2F64A 3OZEA 5HRUA 1U0TA 2FX5A 1JMVA 2J7KA 2MT9A 1RABA 2QL6A 1FRVA 1YS4A 4PZUA 4BJ6A 5K2MA 2QIOA 1HFKA 4YP0A 4FKZA 2PLWA 5TX7A 1T9HA 4ZRMA 5G0WA 5J2UA 3GBSA 2CMFA 2L6EA 4B4DA 3DCJA 4KFTA 4HDOB 5WRFA 4CKYA 2JLQA 3PWZA 2A78A 1GY8A 5CFQA 1DMRA 1AE1A 2EZ9A 1PJ3A 3FYUB 1W75A 3Q7EA 4HAZA 4OLJA 4D3DA 4DJDC 2DECA 5HOQA 3GZNB 2W6MA 1MP0A 1ILEA 2O59A 5J59A 5LWQA 1K4YA 1L6IA 3BG5A 4TL9A 4LSWA 5IXJA 1BH2A 2QSUA 4QM7A 5TT1A 3T12A 2PO5A 3E0QA 1B8PA 2WAMA 4BAZA 1NA5A 2DH6A 2GYYA 5DI3A 5F7ZA 3GXOA 4BS9A 1V11B 5JS8A 1A72A 2P1RA 3F3MA 1KE2A 4KPUB 4BZPA 3NFRA 1G8MA 1T4CA 4D56A 6YASA 3GWGA 1AV6A 2W6IA 4NZMA 2OHOA 1UEIA 1LPPA 1W52X 1REQB 2EP8A 4H27A 2VTVA 4CRWB 3OTIA 1QGZA 1NLYA 1DHRA 2DQZA 3INYA 4BC1A 2C5HA 3FFWA 4LISA 4K40A 1ABBA 3VR5A 1ST2A 1HOXA 4Y7DA 5F64A 3PGXA 5CB4F 4YJ3B 1I32A 3QYAA 3EIEA 3WI7A 2BGGA 1G20B 1YHYA 3MLEA 2GPJA 2R96A 1PR2A 3Q3EA 1FSFA 1W5EA 3A11A 4QASA 4IZ6A 3INNA 2YN4A 1OUMA 3DF9A 3UMCA 2Q5HA 3VR4A 1ML4A 4URZR 4JGIA 1X1EA 2CUZA 2XUKA 4EL0A 2P75A 4KE7A 3V5NA 1IZ9A 1C30A 3QVTA 2EKQA 4JT2A 4A92A 4H1UA 1QIKA 1DXYA 5D01A 1PL8A 3ZG6A 3FETA 5BN4B 2APJA 3K96A 1AY0A 4FK8A 5EKXA 2DC1A 1USIA 5AJZA 5FCDA 3MSXA 1UQTA 4Z49A 1OLUB 2FX2A 3IP7A 4GYKA 4X6LA 3WKDA 4GKKB 3VC7A 1AVTA 3WGHA 2NTNA 1P0PA 3KKKA 2Q62A 5G2OA 1SKUA 5L3ZA 3AJ9A 4C5AA 5HM8A 5HSGA 2B8WA 2BEVB 3ZHBA 1J2RA 3KKMA 2Z95A 1LJUA 3I01M 3K8YA 2H00A 5A04A 1MO4A 3PDWA 5HKLA 4YCMA 3PC8A 3EXIA 4MW7A 4ZOAA 2OLKA 1JAZA 2NO9A 5D85A 4O2AB 3RVMA 1HDZA 3E84A 3FDFA 3U0BA 4P3NA 3RRBA 4HDMB 2GN8A 5H59A 2P9ZA 1NJSA 1FXWF 1UM8A 4CR7A 2AOTB 3LQYA 4YRGA 2JH8A 1RQLA 1NAHA 4U7FA 3VOAA 5F3DA 4L72A 5HNKA 2OHIA 3RUPA 2FPUA 2R6R1 5LFAA 4KVZA 3TSWA 4BUJA 4EARA 1L4FA 2EZTA 1A8SA 2C20A 4NMWA 3QEAZ 5DWVA 1O0BA 5A3JA 5HXAA 3EH2A 5AM2A 2R6AA 4HWKA 4IINA 2N75A 3ER9A 2E1MA 2GZ1A 5B12A 3D7SA 2P0EA 2VBCA 3QLEA 5CYFA 2V03A 1JEYB 2YR0A 4YT8A 3GRCA 3LP5A 1A8HA 4CDRA 3QEMB 4G6ZA 3VU1A 4QECA 3I2FA 3U44A 3O8QA 1NDQA 7CEIA 2NO1A 1DNPA 2PUFA 1K06A 4B33A 5J40A 1M1XB 1A82A 5IC6A 4D3XA 2WVGA 4S12A 4UQLA 4J91A 2QU8A 3RIYA 1JIKA 2OOKA 2H0AA 4PO3X 3I8XA 4Q7EA 5KQMA 2E37A 3CA8A 1RKUA 1OKKD 1P5ZB 4G5YA 4WBNF 3WR5A 2M32A 5HFAA 2GEVA 3O4VA 5CT6A 4UHPB 1XJWA 4N3BA 3GJNA 1EE1A 2D1TA 1M2FA 1Y6FA 2NTVA 2QPOA 4MQMA 1FQOA 1Y6JA 4HATA 3P45A 1PUXA 1K7XB 3D59A 2PKQP 4CLRA 5GOZA 5KKNB 2JBGA 1DL5A 1CEIA 1TCCA 2QD1A 3AY6A 1OCEA 3M0EA 3MCTA 4NCIA 4OHRA 5T64A 5C80A 3QA3E 1Y4ZA 4RXTA 3SYNA 3TTWA 5A4JA 1BW9B 3GLGA 1DSSG 5G0UA 5B58T 3ESZA 1GG5A 3H8WA 4QPJC 1EWRA 2IUTA 3G2HA 4BFLA 3TJRA 1KY4A 2VSXA 3GGOA 3IFSA 4LX0A 4BY9E 2O3QA 1LV8A 2A67A 4IOMA 4YMLA 3R0ZA 1ZAYA 1X1TA 3TLYA 4Q12A 2PWYA 4ZAXA 3V8PA 5FR2A 3BJRA 1UBMS 4KEAA 3OC0A 2GD1O 1HETA 3HDHA 2Q0XA 4P5DA 4BLPA 2E48A 4ND5A 2IU4A 4AJHA 4N6NA 1MIHA 3BK2A 4EFKA 2JHAA 2VJYA 1YF3A 3HK2A 4DVGA 3ICPA 4GE3A 4TMYA 1LRKA 4CEHB 3MBKA 3RTCA 2WHEA 1O2DA 4QBKA 2OG1A 4I81A 3K8ZA 3GPDG 4ITRC 5CVCA 5CB4B 5E4FA 5IJ9B 4W7SA 3ROGA 3QKUA 1SU4A 3WRYA 3R6WA 1KAEA 1WR8A 2IKSA 3HJTA 3V55A 1HGXA 2NTJA 3DVLA 1P72A 3ZWPA 3LL7A 3T7RA 1Y3DE 3X3HA 5AK6A 3FVQA 3BRCA 3H0EA 2YQZA 3R7WA 1WV1A 3HKEA 1KNXA 3IUSA 4Z0NA 5ES4B 2D5AA 1S7CA 3CX7A 1QMPA 5JPIA 3TOSA 3RSGA 4UE6A 5FOXA 3VR6A 4JP8A 4AJEA 3CGWA 1GV0A 3LPAA 2I6FA 4RJTA 1J8DA 1TFRA 2OARA 1TD1A 1GCOA 2C42A 2YDYA 4PYOA 5IJAA 2XUFA 3IMKA 2HZ7A 1YB7A 3KR2A 4TV9F 1PKEA 3LGXA 3K3PA 1R74A 3KVOA 4QIHA 4ZVUA 4KLNA 1ETUA 1N0VC 2LW7A 4WCFA 3N58A 4I4TA 1EP2B 3UBMA 1PJTA 5J5AA 4K87A 1WQ4A 2NSDA 3DOJA 1E3QA 2O0HA 4UFPA 2XQKA 3WLLA 3DTVD 4DJFC 3TQFA 2ZP1A 3BIWA 4B84A 4XARA 2EGHA 2LNDA 4YV1A 1ESCA 4P86A 2B8JA 3BMCB 2AZDA 4HUTA 1E9BA 2O3TA 4Q66C 5HGJA 1A8PA 1KQNA 1FMCA 5C34B 4FX2A 4AO7A 1PFVA 2CXUA 1JYSA 4UDOA 5H81A 1X38A 1BHQ1 3BEDA 1VG8A 1W9HA 2HX1A 3EWIA 3N0WA 1ZIXA 3CF4G 3Q8WA 1XQXA 4G0OA 4NE7A 5U4QA 5JMTA 3JRNA 2WB4A 4A26A 3LQQA 1ECFA 1JG2A 3A1VA 4LOAA 4U2BA 4DMMA 3VV3A 4M99A 5E6UA 3LV8A 3ZLJA 2A7XA 1O94D 1IJFA 1T0HB 3IPCA 1VPVA 2BUBA 1CT9A 4TSRA 2GLTA 3H0KA 2XY4A 1U8CB 2I6QA 1RWKA 2ZJYA 1OFVA 4NK5A 1BDIA 1P3Y1 1WTAA 2CLFB 1W44A 2CL6X 2KW2A 3LDFA 3S2YA 4E5PA 2QK4A 4NBWA 3HV0A 1PWXA 3HKDA 3KOWA 4QPDA 3HYRA 3V1KA 4F96A 3B9BA 1LA2A 4OQMA 1BYUA 3GEDA 3I92A 5AKGA 1SOMA 1SK8A 5A2QA 1BGWA 1SA0B 2C00A 3ZGZA 4DXHA 1JU4A 4M0LA 1SIWA 3NBYC 4WBNB 3CRMA 1ZK0A 5DW3A 3D4PA 3UJHA 3ZZNA 2QX8A 5TMDA 4Z2AA 4JT4A 4AJOA 3E81A 4P84A 1NL3A 1XTQA 5L3SA 2PAFA 1A4RA 1P33A 2RHDA 4HL6A 3W79A 2CHFA 4F3TA 2CLHB 5CD1A 3IIJA 3K9QO 2WP8J 5HV8A 2CXHA 3MM4A 5A71A 1MV8A 4OHFA 3OPXA 3BX1A 1QV9A 1DKNA 5KNDH 2NSLA 2VUTA 4U8HA 4F8EA 4FSHA 1YOVB 1BXGA 2AYZA 5LQJA 4PSUA 2ZUBA 4I4CA 3BWYA 3SYMA 1PZXA 3TQTA 4XWGA 1MDBA 1M73E 1NBMA 4BO6A 4IDNA 1FUYB 5GJCA 4C0AC 4PYJA 3EA4A 3QFTA 5G4KB 2A0YA 1V9LA 3ROZA 1UBLS 2HJ9A 4KRXA 3RJTA 1RZVA 2B83A 1O95D 2IOFA 2LCFA 4QL3A 5F1YA 2JIOA 3MPOA 3ZU5A 1WUKS 1XYVA 4UBMA 3UVEA 3UY4A 5K0SA 3CUWA 3D64A 2XRFA 3F7MA 1RRMA 2Q1XA 2Q3JA 4HGPA 3WYGA 1SC4A 4CKEB 2GXAA 4J6EA 1JECA 2J3LA 3BE8A 1DAIA 2DM6A 3ZE1B 1N78A 1U4OA 1G3MA 1K98A 1C9NA 2VK2A 3KK0A 3PP8A 4YVFA 1QYDA 4A2WA 4DIBA 3RAGA 4CTKA 4OSOA 4NFLA 2BUAA 5JZMA 1RPNA 1JJ2O 2Q4RA 2COKA 3AI3A 4X6UA 1PVVA 4A0GA 4BQQA 5IUJC 1YUMA 4DF3A 3FOWA 3RJ5A 4L9AA 1WS6A 2G71A 2J9XB 3DBIA 4XIYA 3G8YA 2WQ6A 3AB7A 4M53A 4BPRA 3COVA 4FFRA 1AN0A 3I23A 5AKXA 2IL1A 3PXAA 1EPUA 4TKMA 4DMFA 4JLUA 3R24A 3H99A 4GO1A 4PBSA 2WTXA 1BVHA 3BFJA 1OH7A 3MWDA 3EVTA 2O4CA 2E55A 4AF8A 5DHPA 4B7XA 6REQA 1YQEA 3VPCA 5DNVA 1R5BA 1CEQA 3AR7A 4NPCA 3IEUA 5FD8A 1YZLA 1WDKA 2HHCA 2IK8A 1RCTE 2X41A 3E9CA 2PEMA 1GKYA 1V7QA 4FN4A 1C0PA 3KBOA 4LOIA 4MR9A 1BKDR 2YJ5A 5AVOA 1J6UA 1DKQA 4NR0A 1HDOA 1RMTA 4JBIA 1KI8A 3W5UA 2VCHA 1XVLA 1DDIA 3K9LA 1V5WA 4FZ5A 4R69A 2LKDA 5JRJA 3U43A 4IVRA 2O7VA 4LI0A 4CTNA 2DHRA 1GZDA 4OUDA 4TV9B 4UBLA 3ZH2A 4AO8A 5LWHA 1PJBA 1KPHA 2X58A 2P9JA 3FYDA 4RLSA 4S0ZA 3T52A 1LDMA 4ZK6A 1H1LB 4ZOQI 3ZD7A 1KJ9A 2B61A 2VP9A 1GFZA 4IQGA 2WAYA 4XTRA 2BHSA 3DBRB 3DT6A 1B76A 2FMTA 2YWCA 5IT9A 3S8YA 5AH0A 3H17A 1KI2A 2XUIA 3LAWA 4FMDF 5E9WA 4DWOA 3D8BA 1PJLA 3SSAA 5BWBA 4TYWA 2H5JA 2YIJA 3QYJA 3M9LA 1QF7A 2QDXA 4Q4CA 1BCRA 2ZWAA 3P5BA 3HUUA 1EGQA 3KIPA 3WGVA 1ZM4A 3QEBZ 2FQWA 2PGLA 4QNRA 4MMYB 3Q85A 4ZQHA 1ZGHA 1KAHA 4R3WA 1ZI8A 4M55A 1EK6A 2HNBA 2MR5A 3B60A 3N0TA 5J63A 5JT1A 2A5DA 1QVFO 1MT3A 1U7ZA 3RSQA 1Z4JA 4V0MA 1VOTA 3TPCA 3LX4A 1QKIA 4GDFA 1DKMA 3JQ9C 5G0SA 4BN4A 2HK8A 3QKSA 4MR8B 2UVPA 3F97A 3W5HA 5EUQB 2FMFA 2JCGA 2O5VA 1UJCA 1J20A 2WM3A 3PKZA 3PR1A 4I3FA 4QYWA 5DCKA 2PT5A 3L0SA 3KOZA 4K1XA 4XUCA 3LOPA 2KGAA 4A8PA 3AOEA 4DRZA 2UXDB 1VHDA 1NR5A 1YRHA 2J3DA 1M1KQ 1IQ0A 1Z88A 1IPHA 1U7WA 3FDJA 4I1VA 1K75A 2J5KA 3EVZA 3BHIA 3F8TA 4LDPA 3AILA 2HQ1A 4ER6A 4CHGA 5DIFA 2FVXA 1PWYE 4DCJA 3BTUA 2CZQA 9ABPA 1QCZA 4KE6A 2HQRA 3PPVA 4ROSA 4YBRA 5JI3E 2WR8A 2X2FA 4TPKA 4ZOEA 1AZWA 1DLIA 2BEJA 3FUXA 3WRVA 2QNIA 4GF5A 3S44A 2GK3A 3D5QA 4ZVQA 4A8JB 5FWDA 1YQGA 2XUAA 4FJ0A 1P2DA 4XYGA 4D3FA 4DC1A 3R3VA 4AJ1A 1U0GA 2QYSA 4EUKA 4CEJA 4AKIA 3KEMA 5CGZA 3U4QA 4BPFA 1YRWA 4LJLA 1RYMA 1VBFA 1S2LA 4IIJF 1EQAA 1KOJA 2VXYA 3FAZA 3ZNOA 5IDQA 4WJLA 3OJOA 3V4OA 4HR7A 4ZZ2A 1T34A 3SS8A 1E5LA 4D45A 2VHEA 3H18A 2X8LA 2WIFA 4U9HS 4JJAA 9ATCA 1UPUA 2HF7A 3LPCA 2B8TA 3ZY2A 2W4QA 1JZTA 2AE2A 2YJ6A 2IHKA 2E1PA 2XVXA 3Q12A 4WXHA 3OM1A 1QGDA 3O1IC 2QLTA 4BWGA 1LF0A 1ORVA 1KXJA 1HZJA 3RTGA 4H4EA 3OX2A 4M1QA 2MMGA 4TL7A 3HTXA 1AK2A 5D1NA 3DM5A 2VTEA 2O4UX 3ESAA 1LLFA 3FAKA 4G1VA 4N18A 3C43A 5ERGB 5HK8A 4E2FA 2HO4A 1EGHA 1KAMA 1CFJA 5K20A 3ZWWA 1C81A 5JCOA 4EPYA 4ZKEA 4RK1A 3U31A 4IVPA 7MHTA 4QNMA 2F67A 1GTVA 4QOGA 3M1AA 2IHJA 1DBIA 5KJCA 4FDMA 1WU7A 5GINE 3VR5H 4GGOA 3D6HA 3N87A 1YA6A 4GBGA 4RVGA 4PBRA 1GAWA 5EWLA 3MBOA 1DIRA 3BIOA 3CH7A 1RPJA 5K0CA 2XSZA 2X5XA 4NMMA 4B6OA 1BE0A 3ERCA 1TCUA 3TGWA 4Y1FA 1TGVA 2WI8A 1G19A 2OMKA 1QM5A 2R48A 3ABSB 2WFZA 3C24A 3R5SA 4WOJA 4ZVLA 4YCCA 5JXWA 1U0BB 5KPJA 4X65B 1YB1A 2CVZA 2C2YA 1ZCAA 4ZT4A 3OU6A 2JIQA 3BJMA 4CLEA 2ONZA 1LI5A 4EYSA 3OEHD 2FG7C 2VDLB 1YT5A 4HQNA 2R6FA 5FOVA 1JVSA 1ANKA 1NWHA 1WXGA 2E85A 3CT6A 4KVFA 4UM9B 2OP0A 1RPAA 5AKJA 4AS1A 2ZZKA 4LBWA 1E92A 4MS4A 4ARUA 2VSQA 5EW5E 4XR9A 1IAQA 1WAMA 2YY7A 1DUIA 1TZBA 2J6CA 2XWSA 3KC2A 2Z43A 2VHQA 3REFA 1PSDA 4BBJA 2HMVA 4BGEA 1NP3A 1YHNA 1A9OA 2A0XA 4FMDB 4G8DA 4I6GA 4RGQA 4XM0A 3EGOA 2O8BB 4K03A 2J31A 4US0R 3ZGLA 1FFEA 1XRPA 2UKDA 2RHCA 2YOHA 1IY2A 3IQZA 4AQYB 1FUEA 1NV9A 5FEMA 3BF7A 2POQX 1T2FA 1F4LA 2JFYA 4QQRA 2ZYUX 4COKA 2I4IA 2HRCA 2FWMX 3BM5A 2FSSA 3B48A 2QT9A 2X2BA 4EG4A 4RK6A 4JXKA 3GRAA 2XXBA 5B1DA 3B85A 4QQKA 4A8TA 1JBEA 4JUFA 1JPJA 3ELYA 2AVNA 2QW8A 3LC0A 3UTCA 3L6UA 1PRYA 3NORA 5FYQA 4EYEA 2BZ0A 4G0MA 3T7JA 5KOJB 1RKQA 1PVDA 3JZIA 3ABRB 1IWOA 3QLJA 4FOTA 1AGYA 4IVNA 5GP1A 1GCGA 4RAQA 1RYHA 4BLQA 1MB0A 2IFTA 1KJQA 4NSNA 4UNIA 4DDTA 5CVUA 1V0JA 3ZHRA 1PU2A 2VTKA 1UEJA 2ZIAA 2ZTUA 1ND6A 2Q0SA 2CHQA 1PFQA 2Q8PA 4EABA 5GZ6A 1OSNA 3GEGA 5JS2A 1AGNA 1K6MA 1Z37A 3I58A 4HAWA 2AYYA 2YV3A 1U0SY 4OO3A 4PRYA 1NVDA 3DFKA 4K9NA 4B3JA 5B1HA 3A4YA 1DAGA 1NNEA 1UMKA 3KQTA 4ZVTA 3OFKA 4HRAA 4E12A 4LMRA 5ITZB 5THKA 5A4IS 1TVMA 3DC7A 4PPYA 2IYFA 3GDGA 3EWNA 4WXRA 5GONF 2PLAA 4DFDA 5DLEA 5ALEA 3VNAA 3FR8A 5CLHA 2ZM6B 4HZGA 5JXGA 5CT8A 2XBLA 3IAM1 4EDHA 4IMJB 3T5MA 3HR4A 2A5JA 4RBNA 4B40A 4DAEA 5LZ2A 4EO7A 2ZAMA 2WKWA 2IIQA 3CWZA 1E2PA 2DULA 4D4IA 1XTPA 4BKRA 3FWKA 5EJEA 3BZUA 1C3LA 4M9CA 5I3ZA 4YXWD 4WOPA 2G1PA 2FEXA 1G7RA 2V9CA 3KUCA 4X61A 3NVDA 4IIJB 2DY1A 1NG9A 5FTLA 4PC1A 1QTQA 5SYNA 3GPIA 2WIDA 2IYLD 3EIXA 3NBXX 5TS2A 4OGWA 1JA1A 3I37X 1WUIS 4MVJF 2I6SA 1TYBE 3DM9B 1UR5A 2WIJA 2ALJA 3ZNQA 1WKBA 3B9PA 4QHTA 1SBZA 4MINA 5BW4A 3LWNA 3RT7A 5TLSA 1N92A 5JW6A 4G37A 1KZYC 5JASA 3OCJA 4L8VA 3FDZA 3HJNA 1E0DA 2CDRA 2R4TA 4JY7A 1UQUA 1UWCA 3HA7A 4CKBA 5BQFA 2XGJA 2IXFA 1R64A 4H2YC 5F76A 1KI6B 3WFZA 4BWFB 2ZS8A 4EATA 1PVOA 1ZN8A 2XWQA 5LDGA 2AKEA 3LYAA 1E3DA 1KFJB 3LT1A 4DG5A 4MYRA 3IHWA 1VLVA 5AUNB 1I1QB 3HFJA 4KX3A 4P54A 4R2IA 5F78A 4A7PA 3OIYA 4MVJM 1LUAA 5FBHA 1JZQA 2JYLA 2FHPA 1VLHA 4XDZA 3WV5A 3CE6A 2Z45A 1PJ2A 3AONB 4KQWA 4BFWA 4F2WA 3N2KB 4QGSA 5LU8A 3LUCA 4U0KA 1B41A 3WRXA 2GBLA 1BXRA 1FUKA 3GLIE 2W2XA 5DWQA 2F8TA 2R6CA 1NUQA 1C80A 1ESDA 2VJBA 3EF3A 3QQPA 2EJBA 3NTQA 3WRWA 4DR2B 3TLJA 3U4HA 3QF4A 2DWPA 1T9GR 4B3CA 3N28A 4TYMA 5D86A 1JB1A 3IBTA 4ZQBA 5J5VA 1P17A 3BRQA 4C0SA 1PG2A 3K1AA 4B4KA 2PZBA 4D6PA 5BWLA 2W0SA 2PX6A 2Z5GA 4GOKA 1TZCA 1N8SA 4DV3B 3OU7A 4RPJA 4EG1A 3TVDA 4YAGA 4X8LA 1Z7BA 4HDSB 1CY8A 2HRZA 1U0NA 3B9QA 1Y4DE 2IUYA 2FLVA 2QB5A 3DA8A 3IA2A 2ZSJA 2PZGA 4FEYA 3IOYA 1R0CA 4ZIRB 1S01A 2FN7A 1ZD8A 3OTHA 2MSDB 3LMKA 3QUSA 4X7BA 5EQTA 5CJJA 4EKEA 1S3GA 1KERA 3NDBB 1FBTA 5J4LA 4AMYA 4AZ3B 2GKSA 2WJZB 3V1UA 3K4PA 1MG0A 4XEUA 2XUQA