2EG5A

The structure of xanthosine methyltransferase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
354
structure length
344
Chain Sequence
GDTSYAKNSAYNQLVLAKVKPVLEQCVRELLRANLPNINKCIKVADLGCASGPNTLLTVRDIVQSIDKVGQLERPTIQIFLNDLFPNDFNSVFKLLPSFYRKLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLQWLSQVPSGLVTELIGTNKGSIYSSKASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCICKGVELDARNAIDLLEMAINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCIVEEEGSFEILYLETFKVLYDAGFSHIKAEYVASSVRAVYEPILASHFGEAIIPDIFHRFAKHAAKVLPLGKGFYNNLIISLAKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthosine methyltransferase
publication title The structure of two N-methyltransferases from the caffeine biosynthetic pathway
pubmed doi rcsb
source organism Coffea canephora
molecule tags Transferase
total genus 120
structure length 344
sequence length 354
chains with identical sequence C, E, G
ec nomenclature ec 2.1.1.158: 7-methylxanthosine synthase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03492 Methyltransf_7 SAM dependent carboxyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.270 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2eg5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2eg5A02
4V0RA 2BH2A 3R6TA 4GBED 1YFLA 2VS1A 3KPUA 2ZCJA 3LPMA 4QQNA 2WA1A 5DXJA 1HMYA 5FWAA 4M38A 4FSXA 5K0CA 3DUWA 2PWPA 3HVIA 1PRYA 4FT4A 4BP3A 5IKMA 3M4XA 4OA5A 4GUAA 4GC9A 1FJXA 2XYRA 3SR4A 4R8SA 1EQAA 1SQFA 3KQSA 4PCAA 3TQSA 2F8LA 2FCAA 5DTRA 2C7OA 1YF3A 3AXTA 1AV6A 2FK7A 2IP2A 3LCCA 3KQVA 2AN5A 4PYMA 4E70A 4E2WA 4ER7A 1AF7A 4GF5A 4R05A 3FPFA 3KR1A 1D2HA 3P9IA 4ER5A 5K0BA 1ORHA 5GIPE 2ONZA 5U4XA 3ER8A 1N7IA 3GXOA 4GC5A 2PX5A 4RTOA 2ZZNA 3QOWA 5HIJA 4AZTA 5KYGA 2GA9A 1JG4A 3FUXA 3GRVA 3M33A 3BUSA 4HGYA 3THRA 5LSAA 8MHTA 2K4MA 3DR5A 2UZ4A 4CXMA 2C7RA 2ZSUA 3KPYA 5BXYA 3OFJA 2Z6UA 2GPYA 2PV0A 5ICEA 4BLVA 3S68A 3HCBA 2IH2A 3CKKA 1FP2A 3HA5A 2ZTHA 3KPWA 4PYIA 3TRKA 2NP7A 4P58A 1X1DA 3DMFA 2PLWA 1R18A 3R0QA 4PINA 1Z3CA 4IKPA 4E30A 4YUZA 2NNWB 5LQRA 5FA8A 1P1CA 2G70A 3EVAA 4GOLD 4EKGA 2LD4A 4E31A 4DF3A 3D2LA 3B89A 1YB2A 1EJ0A 4E32A 4UOEA 1XDZA 2PVCA 3AWIA 3G5LA 5FHRA 2OPBA 2R3SA 2H00A 5FHQA 2AOXA 4O29A 3GRUA 5JR3A 3LGAA 4P7JA 3OCJA 4MWZA 1SUSA 3PFHA 5FADA 4HH4A 2AZTA 5JUWA 3HCFA 1SKMA 1UFKA 3DOUA 5EVJA 1VL5A 3FUVA 1EJ6A 5ICFA 1WXXA 2AOVA 3B3GA 5E1DA 1R8XA 2NP6A 3IEIA 3OU6A 3BKWA 3P9NA 4DMGA 4PYKA 4KIFA 3EVEA 5HIIA 2G71A 3SX0A 2HNKA 3ID6C 1QANA 3BWYA 3NWEA 3EVZA 1AQIA 3HCDA 2AR0A 4FGZA 5GWXA 4OQEA 4QTTB 4YUXA 2JHPA 5EOVA 1UWVA 1NE2A 3I58A 1ZGJA 2HV9A 5IH3A 1EG2A 3M6XA 4F84A 3FUTA 4PCLA 5DM2A 4GOND 4RV9A 4PYQA 1KHHA 1KP9A 2ZBQA 3CCFA 3KQYA 4V0QA 1L9KA 5E9WA 5FQOA 5E1BA 1WS6A 3P2IA 4Z2YA 3T0IA 1YZ3A 3WSTA 5T6BA 3G89A 2ADMA 5CVUA 2ZULA 5E2BA 4BP1A 2VZ9A 4CKEA 2PT9A 3MCZA 1JG1A 2FPOA 2ZLBA 2Q41A 3OE4A 3OFKA 4PGHA 1HNNA 4A6DA 4BLWA 5K09A 5CUQA 2XYQA 2P3OA 3KQMA 2IBSA 1ZGAA 2NXNA 3HP7A 4CTJA 3R9XB 1KYZA 4M37A 5ERGB 4KDCA 3BGDA 1BKYA 2V74B 2DPMA 3GRZA 5EMKA 1VQ1A 3G8AA 3ME5A 4LECA 4MQ4A 4WXHA 2O06A 4WVLA 3FUWA 3KPVA 1XCJA 3ELUA 4AZSA 1P39A 5EEHA 1BC5A 1SVUA 3Q87B 5E8JA 3UJBA 3PX2A 1XTPA 1SUIA 1I1NA 1ORIA 3CJTA 3SSOA 3UJDA 4B17A 1L3IA 5EZSA 3NWBA 3LX6A 2PGXA 4QTUB 4CTKA 4OA8A 4YV1A 4OBXA 1ZG3A 2UYHA 3JWIA 3SMQA 2UYQA 2PWYA 2QRVB 5DPMA 2ZWVA 1I4WA 2BR5A 1G38A 5FWDA 2O07A 1YUBA 4MTLA 5GM2A 4DA4A 3BZBA 3G2OA 3GGDA 5GINE 5KQRA 3BWMA 4RTJA 4IV0A 3UJCA 5K0FA 5K0LA 3PX3A 2I6GA 4RVDA 4ATNA 5B1SA 4R6XA 5DM1A 3EVBA 4HC4A 2OXTA 3ANXA 3P9CA 1FPQA 4MHTA 1F38A 1G6Q1 2JJQA 2P41A 1VE3A 3LDUA 2YXEA 3UJAA 3VC1A 2KW5A 4CWAA 1SQGA 4RYLA 1JSZA 2P1DA 2PKWA 5LQJA 1KYWA 2EFJA 3ELYA 4RSRA 1Q0SA 4PYOA 4ISCA 4FT2A 3TLJA 2P7HA 3MHTA 3X0DA 2NXJA 3KR0A 3C3YA 3G7UA 4OBWA 2FHPA 1WY7A 3AXSA 3ELWA 4PGGA 2HMYB 2O0LA 5EIFA 4KIGA 5HFJA 3B5IA 1JG2A 1NW6A 4MIKA 1NV9A 4Y30A 3LHDA 1U2ZA 4NECA 3REOA 5GM1A 1TW3A 3A27A 1FBNA 3LKZA 3BWBA 4L7VA 3EGVA 2Z6AA 3KU1A 3MAGA 2PY6A 3NDJA 3M6VA 2ZZKA 4FSDA 2IFTA 2JHCA 2OYRA 2XVMA 4POOA 2PX4A 3BGIA 3KQPA 2CL5A 3Q7EA 4C03A 5MHTA 1PJZA 2GAFA 3E7PA 3UJ6A 3HA7A 3V8VA 2ZVJA 4ER0A 4F85A 3B3FA 3M6WA 5HOQA 3ERCA 2E5WA 5DT2A 1X1AA 3T7SA 2FRXA 2OY0A 1KIAA 3G2MA 2P35A 3NVMB 5DX0A 3LDGA 3KQOA 10MHA 5CVJA 4KRGA 2VDWA 3FUUA 5EIWA 3TKAA 1M0EA 3A4TA 5DRYA 2WK1A 3EGEA 4H0NA 1RJGA 4EQZA 1JTEA 3FTCA 2P3QA 3OZRA 1AQJA 4JXJA 2XVAA 3PT9A 2ZFUA 3OZSA 1YFJA 2AOWA 1RJEA 5K0NA 4BLUA 4E2XA 3KR9A 5FA5A 4RVFA 4X63A 4CKCA 2QE6A 4XUCA 5LQAA 5T64A 1R74A 2PXCA 3H2BA 4QQKA 4ER3A 2C7PA 3BT7A 5T67A 3P71T 3TFWA 3VYWA 1I9GA 3IHTA 4PYJA 4QPPA 5K05A 3DULA 1G8AA 5BP7A 3HCAA 3CJRA 5DM4A 5DSXA 2ZIGA 1NKVA 1JSXA 2Z6QA 4HRAA 5LQCA 1JQEA 2CWWA 4EVIA 1O9GA 3P2EA 2H1RA 1NBHA 4GOMD 4QVGA 3GIWA 2YTZA 2XYVA 4GQBA 5HIMA 2G1PA 2JG3A 3GNLA 3P8ZA 2VDVE 5E8RA 2B25A 4EMSA 5K03A 3UBTA 5DX1A 3QOXA 1FP1D 1X19A 3A7DA 1N2XA 5BW4A 5HEKA 3T7RA 4PIMA 4DKJA 1MHTA 3KQQA 1VLMA 2JHAA 2OO3A 3LCVB 1ZHFA 1VP9A 3FPHA 5FULA 3DXZA 3BXOA 5C1IA 3M6UA 5E1MA 2GS9A 1NW7A 4RVGA 1DUSA 5G02A 3LKDA 1QAMA 3A26A 5BW5A 5DTQA 3E8SA 1NW5A 4GEKA 5K0EA 3BKXA 3G2PA 2I62A 5EMLA 2I7CA 2QRVA 1INLA 3B7PA 3HVKA 4XUEA 4AUKA 3EVCA 3SSNA 5DTMA 3SGLA 1P91A 3O31A 4X41A 4RTSA 2ZBPA 2B3TA 3L8DA 5K0JA 1UIRA 3E05A 3KQTA 4HTFA 4C06A 5KQSA 2C7QA 4E33A 5K8VA 5EPEA 1JTFA 5DLYA 5GIOE 4RWZA 2ZZMA 3CVOA 5KS2A 1Q0TA 5E9JA 4QPNA 1KXZA 2AVDA 2H11A 2OKCA 3I9FA 3HEMA 2NXEA 3PFGA 1O9HA 1KPGA 3EVGA 4P7GA 5FUBA 5K01A 4EKIA 5P8WA 4YMGA 3NDIA 3DMGA 4YUYA 3TKYA 1NV8A 3HA3A 3IYLW 5D1NA 4X1OA 3RW9A 3P97A 1R6AA 2IPXA 4DCGA 5C9ZA 3GO4A 3UWPA 3LL7A 1EIZA 4ER6A 3UJ7A 1RJFA 4X60A 4E2YA 1TPYA 4RTNA 4GOOD 1RI4A 4XCXA 5CVVA 3C6KA 1QAOA 3EVDA 3OE5A 2JH8A 3NMUF 2HWKA 1WXWA 4HTFB 2O05A 3TMAA 3K6RA 1MJFA 3AJDA 4CKBA 2JH9A 3UFBA 2BR3A 3PVCA 3MTIA 5HIKA 5F2OA 2CMHA 1VP3A 3CGGA 2YX1A 4P7FA 3EMDA 1L1EA 4RX1A 3T7TA 2A14A 1RI1A 2AS0A 2IH5A 1JQ3A 4IV8A 1SG9A 5CD1A 3FRIA 1QAQA 5CM2Z 5DRTA 1XXLA 2ZW9A 3G88A 3KR2A 2PX2A 5CVEA 3EEOA 3OZTA 2YR0A 2OBFA 1KPHA 3IV6A 2XBMA 5GOZA 4YUWA 2B78A 5FTWA 2EG5A 1NW3A 2B9EA 3R24A 5CCBA 9MHTA 5EC8A 4C07A 3LECA 1DL5A 2Y1XA 3OPNA 3OU2A 3V97A 2AOUB 3ORHA 3I53A 1D2CA 3LSTA 2OB1A 5CVDA 3LBFA 3PLAE 5EEGA 4DQ0A 3VC2A 2AN4A 4BY9E 1IXKA 2AVNA 3BWCA 3G5TA 3F4KA 1R00A 4FR0A 3A7EA 4LWOA 3C0KA 4YV0A 4P7KA 2G72A 2YQZA 1V39A 4FP9A 2OZVA 3A25A 3G2QA 3ELDA 3UA4A 5KVAA 4PONA 5EHIA 3O4FA 4PNEA 3DXXA 2PBFA 1ZKDA 3FTFA 3EMBA 3C6MA 3FPEA 4KDRA 2HR1A 2ERCA 3JWHA 2I9KA 2IBTA 3HTXA 4HGZA 3KHKA 2HTEA 5H02A 1KPIA 3RIEA 3SSMA 5C0OE 3TR6A 4PWYA 4HG2A 2AN3A 2PJDA 3DP7A 4M36A 1OR8A 2QY6A 5K0GA 4RTRA 3O7WA 3JWJA 4RTKA 3EEYA 3HVJA 3NTVA 4EK9A 5F2NA 3B3JA 3LCUA 1XDUA 1XVAA 2CMGA 5DWQA 5EGSA 3SXJA 5CCXA 2ESRA 2AOTA 1L3CA 1YZHA 3U81A 3PS9A 4LWPA 3GJYA 5LQNA 4C08A 2IH4A 3FTEA 3MERA 5E9QA 4PYLA 3SM3A 1IY9A 4Y2HA 2NYUA 3MGGA 4K6MA 1G60A 2R6ZA 4U7PB 3FPGA 3EVFA 3NW9A 5D1HA 1DCTA 1X1CA 3CBGA 3FYDA 4RTLA 4ZTBA 2IDJA 4KWCA 7MHTA 2YVLA 4OX9Y 3PB3A 2YUIA 2ONYA 5EMJA 3CJQA 3TM4A 1TW2A 3TPZA 4KVZA 2V7EA 5EZQA 4RVHA 3C3PA 5EKUA 4E2ZA 4F86A 5EG5A 3DH0A 3EPPA 4U7TB 2ZIEA 1VBFA 3JWGA 1VPTA 1O54A 1XCLA 2P8JA 2PXXA 3CC8A 4LG1A 3OU7A 1N7JA 5F2KA 1ZQ9A 3RODA 5LQKA 5E1OA 4HSGA 4DZRA 4AX8A 2AOTB 1JR4A 3VSEA 1D2GA 2ZWAA 3M70A 4PIPA 2G8NA 2IGTA 3DLCA 4RTMA 1WZNA 2P3LA 3MQ2A 2FK8A 5M5BA 4A6EA 2P40A 1WG8A 4RTPA 1X1BA 1BHJA 3GDHA 5DX8A 4QDKA 3UJ8A 2N47A 3DTNA 2BR4A 3HNRA 3AY0A 2GLUA 3UZUA 1EAMA 2GH1A 1JG3A 3TM5A 4C05A 5LR6A 1KR5A 3DXYA 3QV2A 5DM0A 2EJUA 2WA2A 5DXAA 2ZBRA 3HVHA 2NXCA 1QZZA 4FZVA 4PYNA 5E2AA 3FRHA 3GU3A 4R6WA 3I5UA 4YMHA 1G8SA 1H1DA 3DMHA 3NJRA 3P9KA 3FTDA 3MCTA 1T43A 1B42A 1XJ5A 1JQDA 3MTEA 1NW8A 2BM8A 1M6EX 2VDUE 4M7RA 4QVKA 5ICCA 2ZIFA 4DCMA 3FZGA 3HCEA 2FYTA 1QYRA 2GB4A 5DSTA 5ICGA 3GCZA 3FPJA 5HILA 1F3LA 5CIYA 1BOOA 5LQUA 2BZGA 2UYOA 3GWZA 3LDFA 3FYCA 1XDSA 2PT6A 3KKZA 2EJTA 2P7IA 2EX4A 2PX8A 3P2KA 5EMMA 5FQNA 4XUDA 4C04A 4X61A 2AOUA 2YXDA 1RI3A 3EGIA 3R3HA 3E23A 3SVZA 2CKDA 5GP1A 3UA3A 4DM3A 3THSA 1G55A 3GRRA 3KQWA 5EQJB 1R8YA 3TOSA 3NVKI 3HCCA 4YUVA 3BGVA 1NT2A 2Y1WA 5EHGA 3MB5A 2ORED 3I64A 1IM8A 2VP3A 4IWNA 4YV2A 1NBIA 2QM3A 3K0BA 2QYOA 4AZVA 1VIDA 2PXAA 1M6YA 2IIPA 3G8BA 3PTAA 1RI5A 3ER9A 4C4AA 2B2CA 1RI2A 2O57A 3UJ9A 3HM2A 3LBYA 4QDJA 2IDKA 2UYCA 5FCDA 2BM9A 3GRYA 4RTQA 5EKXA 4R8RA 4AZWA 5HZMA 1Y8CA 2YXLA 3DLIA 4OQDA 1P1BA 2PSSA 2DULA 3KPJA 4G56A 2OB2A 1RJDA 4FS8A 4KW7A 1L3BA
chains in the Genus database with same CATH superfamily
2VTBA 4KL8S 3G2HA 2VLIA 1RHRA 2IYFA 4N8EA 3SJCA 1YFLA 3G9XA 2ZCJA 4QJ3A 3K20A 2AD5A 3KYCA 3WNDA 5CX4A 3PC4A 5JJIA 1ZN7A 2C4MA 1KI2A 3GLHA 4LOAA 3QEOA 1FOEB 3O4IA 4FQ5A 3U4DA 4GUAA 1O5OA 3QLVA 1XZQA 1XLVA 2F8LA 1HE1C 3LV8A 4NEQA 2PA0A 3DLHA 1WIWA 3IKTA 5CNJA 3C3WA 5H81A 3JRNA 2O8DA 1MUUA 4R05A 3PRYA 2AZMA 4ER5A 4QT4A 5KWJA 3CZAA 4HX2A 3BTUA 4AL4A 1ZJ6A 1ST2A 1ESZA 1R9JA 2IZZA 1DTWA 1KYQA 1L4MA 4U0AA 1E60A 2QDXA 4L76A 4WGGA 4L6IA 3WZ2A 4UTOA 2X5JO 4AZTA 4MUFA 2IXGA 4RVOA 4UHKA 5BT9A 2K4MA 5IJ9A 3AY6A 2O23A 4KAXA 5FFFA 1QWSA 3EJEA 1XZMA 5JT1A 4F92B 2JLUA 4UMDA 2VWPA 4V02A 3UHFA 5CFMA 3CNQS 1CUDA 3R23A 2G7MC 4K03A 3TQTA 1E2DA 1N5JA 3Q6IA 3CEAA 4TOIA 1R16A 5H16A 1R18A 1B1CA 3FCCA 1C1DA 3LYLA 1C9NA 3ZH9B 1P1CA 1YB6A 3ZWDA 5I7OA 1E61A 1MNAA 5EA2A 5LMNB 3RSCA 3E4CA 4BIIA 2B4RO 1UMDB 1G8KA 5LA6A 3AWIA 1XLUA 2FPKA 1ZD3A 4NBSA 1N32B 3IDSA 3D7RA 4P36A 4X62B 2UUOA 1YRLA 4HFMA 2KOSA 4H27A 4QLAA 3OCJA 2MYUA 3PYXA 1GU7A 3MWKA 4ZIRA 3JAKA 1JA9A 1QHGA 4OXNA 1ISSA 1QKIA 1DTEA 2EAUA 2PEKA 3HA2A 4HH4A 1P2VA 3GARA 2R6AA 5FADA 4RENA 1Y89A 4GW3A 1GGMA 2VDWB 3ND5A 3L4BA 3TQQA 5BPFA 1XO1A 4HNAB 2PH1A 3EQ7A 1LBHA 2FLKA 4DMGA 2Q3LA 4IJ5A 4NYMQ 5CH8A 1T4GA 1FVOA 4N0EA 4N7RA 1OX4A 3ODPA 5DBIA 1QZUA 3OFSA 4IPYA 1M7GA 4YUXA 4KXQA 4WBSA 1JALA 2KGCA 4QLOA 4RK5A 4BU0A 4UREA 1Z18A 1EP3B 2F3RA 1Z75A 3DF9A 3RIXA 4BNKA 2R1ZA 5EWJA 1G7SA 4Z2YA 3FOAA 4UEJA 1W2BO 1YZ3A 4AZ3A 2X86A 5EY5B 2IIBA 1ADJA 3CFYA 1FJXA 2IZOA 2ZLBA 3GOHA 1P1IA 2OPHA 3TRFA 1GITA 3CLSC 2AJ8A 1VYTA 1X14A 4M8IA 4NJMA 4P1ZA 3STVA 4BL5A 2K2QA 3KTDA 2NXNA 3U13A 3ZJUA 2WD9A 4R1NA 2IEDA 4XKJA 3RJ9A 2HO4A 4BNIA 3R9XB 2YC4C 5C51B 2MVVA 3ZW7A 4BC0A 4D41A 4HQFA 1VQ1A 5C1OA 3OJ0A 2ARKA 3OE7A 3TW6A 5DNAA 2Q3HA 1XMXA 1OLSB 3LC2O 1F8UA 3F49S 3E1SA 1KQNA 1N77A 2FP4A 3QVXA 1YVEI 1QVGO 2G4VA 2YZKA 3SN6A 2IXEA 3GFPA 1GGJA 2Z8ZA 4FMPA 4BVFA 5DV9A 4AROA 4LGCA 2REBA 5AM4A 3U3ZA 3Q7QA 2QX9A 4CIVA 1ZESA 3GRPA 3A0RB 3KKKA 1MG0A 4JQOA 3SDSA 2GN2A 4GXNA 5B6PA 3V3TA 3BG5A 1A88A 1F2UA 2XSZD 3ONWA 1VGVA 5DPMA 3BGSA 4UMFA 1I4WA 2FAEA 1XKQA 3AL3A 3IQFA 3NJ8A 4ZU3A 3IDAA 1NF8A 4LDNA 3SNHA 3Q8MA 3PEFA 5ALTA 1ZDMA 5DK6A 4L2IB 2ICAA 4O4HA 1IHYA 4E6EA 2XXMA 2I6GA 3LCRA 1H4VB 2NZXA 3JQPA 4R6XA 3SDBA 5JO0A 3T8YA 2XGOA 3QE0A 5JDIC 1Y5RA 4PS1A 3UIEA 3ANXA 3HUUA 1GGEA 2M6LA 3L01A 3SVLA 2ZSFA 3V55A 3AFHA 4CWAA 4P93A 2I3AA 3EA4A 2BGMA 5T5QA 4PG4A 3C98A 2C3OA 1NI3A 3EGCA 3ELYA 3R5TA 5KPJA 1RAHA 3IVMA 4ISCA 1E66A 3AUUA 3LHIA 3PFCA 3GJ6A 3LBAA 3PUIA 1GSAA 2H29A 1W2WB 2ZCVA 4Y9RA 1CY2A 1XMJA 5HFJA 4OQFA 5JTTA 3RYCA 1H6BA 2I99A 3HU3A 1DAOA 2CXXA 2R1TB 1SCJA 1V7ZA 2HUPA 2I6FA 2QD1A 3KTAB 4OHUA 2NWQA 1GCIA 2J46A 2QTVA 4ZT5A 4CEHA 3QJYA 4QECA 3C3KA 1RBYA 3BHMA 2BSQA 1LSUA 3IEKA 1IN5A 1RZ3A 2GN9A 4TVBA 1AKEA 3TSWA 1A2BA 3DZDA 2QG4A 2ZRNA 3GA5A 4Q7MB 5LU9A 3EX7C 3WLSA 4J0FA 4XASA 3IP1A 5DO9A 5TQ0A 3E7PA 3I30X 4K3UA 2X76A 4ZVKA 3M6WA 4TYQA 1NBME 5KREA 4DLXA 1U94A 2R68A 1UC8A 5DX0A 4GI1A 1D7AA 2TS1A 1UJ6A 1S2NA 1KZYC 1NM5C 5BNTA 4TYMA 2J0SA 2RHHA 4W9NA 2QN7A 3NP7A 3OKCA 3AJAA 1ZINA 5DRYA 3TXYA 5B1IA 1XEXB 3DE5X 1OIXA 2NZ8A 3DGFC 2NU9B 1JHMA 3RVSA 1VE6A 2RC5A 2ZJZA 3KXKA 2VUIB 3GN2A 4JXJA 4QT0A 3ZPXA 3VNUA 3NCHA 1TF5A 2KOQA 1Z35A 1FSPA 2R8YA 1JYSA 3IQIX 3RAPR 1M8KA 1OYVA 3BMOA 4LXGA 4HN2A 4B09A 3QPBA 4D3XA 1DOHA 1QS0B 3QX7A 1JHVA 3KDSE 3CU5A 3H2BA 3LYHA 4J1QA 3H13A 4I14A 3NUQA 4Q4CA 3NBUA 4MQ6A 1I9GA 2G9ZA 3FF4A 3OT1B 5DM4A 1TDJA 3DE4X 3HR8A 1QVWA 4Y8VA 1CUFA 4QUIA 1UC4B 2HZ7A 2L82A 2GEKA 1DARA 1E0DA 1U0EA 1YBMA 3B1JA 4G2NA 4GQBA 3DJYA 5JAZA 1E2UA 3AH8A 4JI4B 3UWSA 4F4FA 2AXEA 1GZSA 4BNTA 5BQ3A 3EZLA 1GD1O 1KVSA 2HRRA 4YACA 2LCFA 3M1YA 1X19A 5B5SA 4EJ0A 4CLOA 5ALIA 1ISIA 4D5EA 2HMWA 2O3RA 1CEEA 2OD9A 3E3NA 4N54A 1E1RD 4PS0A 1X0XA 1XMVA 1VHNA 5K3CA 1UFQA 3FSGA 2O2JA 3OLXA 3ORYA 5M04A 4OP2A 5I8WA 2EF1A 4MYSA 4JI8B 1RQGA 4BNJA 2IYWA 5G02A 1JKMA 4JYCA 2OFFA 4DHEA 4KPUA 4HO1X 1JSLA 1X1SA 3LFTA 4LZAA 4R1LA 4QGAA 4ZZ1A 1JDBB 1FMJA 5D6OA 3L6RA 2E4XA 2HGSA 5J4KA 5DTMA 2B61A 1M6HA 2J8ZA 4S1PA 4O59O 4WERA 3THXA 1XTUA 2DPHA 2IT1A 1SO8A 2DKFA 3LCMA 4R9SA 3A3KA 3QKSB 3E05A 2CLOB 2P5SA 3K1TA 4MHSA 3SQMA 2C7QA 4HNQA 4XDHA 3GLRA 3V4RA 2CD9A 3TZQA 2J59A 4QPNA 2Y92A 3DBVO 1YKSA 3EFEA 4DIOA 1XEFA 3PCXA 1YTUA 5BR8B 3PFGA 4JY7A 5HGOA 1N2BA 1P9WA 3DE0X 1MZVA 4HMQA 2BKLA 3RUDA 3ZHZA 3FMOB 4IAOA 2A0XA 1FLDA 4QQ8A 3DMGA 3JTMA 1G8FA 1QF9A 2AE2A 1NV8A 2AI1A 2R8EA 3L6OO 1OXMA 1YZYA 2OHHA 2E4WA 4N48A 5DH9A 3BN3A 1I0IA 2V0CA 1O0BA 3GO4A 1IZ7A 2IWRA 3UQZA 2OV1A 3THYA 3RYHA 1YMUA 2PZ8A 3BIOA 2N6YA 1GZ5A 1YRHA 3U80A 3M3HA 3TD9A 1KJNA 3T9BA 1RW4A 2MHCA 1IE3A 4NDZA 1CKEA 3FAKA 4KNYA 1E9EA 4NNJA 2ZSAA 4Y2XA 1DRVA 1Y8ZA 1T3LA 2WFZA 2PL9A 4HB2A 4QUAA 4J1TC 3RIMA 2JZCA 2BR3A 2DFNA 1LF0A 2H1WA 7AT1A 4FXPA 4MPTA 4NCBA 1P1HA 4RA6B 2LOLA 4CCYB 1VJ0A 3DS2A 2AS0A 4X7RA 4YDSA 1JT9A 4L95C 4LJ9A 2FPWA 3Q3IA 4GVLA 1A9RA 1Y7LA 2PH5A 3JV7A 4FFBA 4GBMA 4TL8A 3ZGLA 2XBMA 4CVNA 5IAOA 1SKQA 4NH4A 3DS3A 3MM4A 1T3TA 4P34A 5JV5A 5TLSA 4XD2A 2GASA 2VDOB 1QG6A 4KE9A 1TCVA 4YFYA 1GQYA 4O8ZA 5G0SA 4BZQA 4B31A 5JI2E 5F3RA 2A1TR 4YXWA 4L8LA 5IAEA 1FFBA 1PKXA 3I4FA 2F55A 2C42A 2FFAA 3T4XA 3TOZA 3EH1A 1MV5A 1IXKA 2WSSD 3CZPA 3G5TA 4BQFA 4URVR 5T4HA 5B4UA 1MRZA 5HX7A 4PBRA 2BEUB 2XCQA 3TLBA 2PLAA 1IZ0A 2VPYA 4MP6A 4DCUA 2JLYA 2QR3A 4L4YA 5LUBA 5CT8A 3FZQA 1UT5A 4LSMA 3L79A 5IKPA 1J8YF 1NF3A 2WW8A 1ZMOA 4DLKA 2C04A 1ECJA 1FX1A 1V1RB 2ZJ3A 1KMQA 3DZBA 2J9RA 4WK6A 4WBXC 3C6MA 3CCVP 1MQAA 4HPJB 2ERCA 3WL7A 3UMMA 5KC8A 1BRTA 3RIEA 3SS9X 4JYZA 2QOEA 1L4YA 4M83A 3K6SB 1ZC3A 1ZW6A 3QA3E 1KE2A 4NZZA 4IO0A 5LIRA 1UBRS 4FC6A 2CLCX 3FRJA 4UEKA 3SXJA 5CCXA 2AC4A 2XPCA 1GZHB 3SC2A 1K92A 2GZMA 4OB8A 3CG4A 3LZDA 4BATA 1JILA 2COUA 2NADA 4LWPA 4RHUA 2KORA 1T1EA 4B6JA 5HKLA 4TSRA 2O0HA 4ESEA 1J56A 2HREA 1JJBA 3MGGA 3TX2A 4OO3A 2C5LA 5HQJA 4NDNE 4BOYA 4Q5IA 2BFMA 3CBGA 3FYDA 1V95A 4OFWA 4ZRMA 1M6NA 2F4VB 4TZTA 3U9TA 1W85A 5WRFA 4OX9Y 4MS3B 3SAJA 2F4NA 2FF7A 4TMYA 1OTXA 4KVZA 1I1HA 3FW1A 3FF1A 3QW4B 1L5QA 2ZUBA 4RVHA 4W63A 3USES 5B3JC 3KRTA 4R41A 5EG5A 4QYIB 5CA0F 2JATA 3BA1A 2P75A 4U7TB 2ADOA 2HHCA 4URUR 5ELXA 2GXAA 4Y0AA 5F2KA 3ITNA 5J4YA 5KI6A 1W2HA 2P2LA 1I6KA 1KQSO 4G9GA 4IFIA 1FSGA 1V8FA 3F97A 4L28A 3M70A 4FJ0A 1G8YA 4PIPA 2R6FA 4DQVA 2NW6A 4HQ0A 5KAPA 5M5BA 4WLVA 1U31A 4ASUD 4D8VA 1VMKA 1KMNA 2FG5A 2ES4A 4HAOA 3MAAC 8ATCA 1PEYA 5SZKB 5EZYA 3KLMX 3W78A 4OGKA 4ETWA 5HKKA 4KRFA 1KRXA 2BR4A 3DCNA 1NKSA 4YCSA 5LM3A 2AG8A 1KVUA 3QV2A 4DA7A 2P4UA 2JFBA 4KPGA 1YTLA 1RCTE 2XB6A 2YXBA 2PUFA 1QZZA 1QGAA 3ILXA 4A6XA 3SQXA 4MA4A 1C3VA 1JXQA 1O4WA 1YJCA 2FSVA 2JEYA 4BNHA 4CT0A 4Y2VA 3WBFA 3NJRA 3WMFA 2Q3DA 3H9EO 3SQNA 2AQIA 5AVQA 2WU1A 5CA0B 2QPOA 4I3HA 3UC9A 4D81A 4LF9B 3FFBA 3GP8A 1E7QA 4H3KB 3MQFA 4M7RA 2Q9CA 5IN4A 2V58A 1DKMA 3L4SO 1E9SA 5JSZB 3F3KA 1EUQA 3AJRA 3OE1A 4P38A 1JIKA 4GPAA 3GJ0A 1GLNA 1ONOA 3EAGA 3FDZB 2Y99A 2GM3A 2VEDA 3DPSA 3DBHA 3EIHA 1XDSA 3GBVA 3LDFA 4P3OA 5AKGA 4ND6A 2O8DB 2GZEA 2XWSA 4YRMA 2XZ1C 3QM1A 2NTJA 1LPOA 1R64A 3A70A 1EKXA 1IXYA 3AINA 3SVZA 4R31A 2V59A 3H1GA 1Q44A 2HNAA 3H2GA 3KSBC 2XEXA 3EC1A 1VG0B 2X9NA 2R7NA 4J0HA 1P1FA 4RDXA 3PSAA 4R7ZA 1KEWA 3RVBA 3TOSA 2HC9A 4YUVA 1U1FA 5TV2A 3ANMA 2FCRA 5LFAA 2BKAA 5TPZA 3PNMA 2AXPA 1W87A 4RELA 2HCFA 4UCFA 4CKEB 3FGZA 4AJHA 4KHPB 1M6YA 2VHQA 3WG9A 1I7PA 1RI5A 2GJ4A 1FLNA 1KJ8A 3HP1A 2UV8A 3RYFA 2AFIB 3LBYA 5ALKA 4CN9A 4EGQA 5ALMA 4DWWA 4AS1A 2Y1CA 1SXJE 1CRQA 2BM9A 3VKFA 2NQ8A 2BUBA 4GR6A 1UZLA 2V96A 3KHTA 5H80A 5LDDC 2CMKA 2VG8A 1GR0A 3OWHA 3F3MA 3UWKA 4L0MA 2QF7A 4CUKA 1VXOA 1VFPA 2CJPA 4G84A 4H1VA 4U2EA 2WWIA 4L51A 2UZ1A 5B2FA 5BWLA 3DOIA 5IXYA 2IUUA 1M3SA 2JGAA 3G2IA 3R6TA 1WUYA 3W6PA 1CZUA 3ECCA 1BMDA 1TU3A 2JDIA 1CQPA 1PHRA 5IWAB 1LH0A 3ZHRA 1NUQA 1IHDA 3LFUA 5H8WA 3TXAA 1CQJA 1L5ZA 1AUXA 2TECE 2FI1A 4FT4A 3LMOA 3W5VA 2RE8A 3I76A 3AFMA 1CR0A 1KC1A 1YHYA 2FW1A 2W2MA 2F1IA 4QDOA 4EJSB 1ACJA 1M1ZA 1RWOA 4GX0A 5A9TA 3OQPA 4YGXB 1JH8A 3CUVA 3LT5A 5I7VA 1UDRA 4YMIA 2GK3A 4HAVA 4F8EA 4KWIA 2O6LA 2A8YA 2J7KA 4PXSA 2L0XA 3VGJA 3LC1O 4PY2A 2ONZA 1DEAA 3CR3C 1K6JA 3H2IA 3URKA 4QOFA 4YT5A 5I7RA 4GE3A 1ZAYA 4LW8A 5AXAA 4CQJA 4EF4A 1NQXA 2FHSA 4QRDA 2B21A 3C3CA 3FFXA 2OD7A 4D42A 2BN4A 4MOWA 2JA2A 5EJMA 1KMMA 3NBMA 4IKOA 4HGRA 1XC7A 5IJ0B 1DDGA 2WPTA 3FMIA 3K1AA 3NDPA 4ZZ2A 1SG0A 3DMFA 4EHAA 2MSLA 5A5DA 1Y3IA 3I32A 5JH7A 1WHTA 4HNHA 3SJAA 3KXDA 2O19A 2JIQA 4XAQA 4D9NA 5F9MA 1C1HA 3C16C 4MLCA 3LT0A 4WFKA 4H1HA 4BMOB 3M6MD 1GZ4A 4P2BA 2ZYVX 2ZXUA 1J4AA 5AKHA 1JEOA 3FNBA 1NXPA 2WVAA 1E1QA 1PX2A 1BEZA 1SD5A 2X7JA 3ZIUA 1QCZA 1LPBB 3EGWA 4GYKA 1Z74A 2ZJ0A 3LLMA 3DTJA 5FBKA 4D97A 2ZCUA 2ZRCA 1P4AA 1AMUA 1QFJA 1ZKMA 3T12A 1OHHA 4S04A 3KOUA 4X6LA 4TVSA 4CDRA 1SC1A 4L4XA 5AW4A 1R0ZA 1YK1A 1EDOA 5ALSA 4H2WC 1R8SA 3IT0A 3G4SP 1RPAA 3LQQA 4JB8A 4NDAA 3ZCPA 1TEHA 1VTKA 5E1DA 3GP5A 2BJVA 2WV9A 5IDVA 5DF1A 3BKWA 4RKFA 3TR5A 3Q4GA 3W2FA 2MR7A 1RHJA 1OC2A 3DDUA 2QXTA 2HZBA 3N0XA 1GAWA 4QDXA 3MWDA 2C98A 4Q4HA 5AM1A 1VIAA 1SK9A 2WWRA 1AQIA 2BFNA 2AR0A 3LRYA 4IR7A 3HKEB 1RQRA 3ISVA 4MXDA 4ZOBA 3ZD7A 1GPWB 1JEQB 3HBNA 3HU5A 3I58A 3HRIA 5TE9A 3VPDA 4F84A 1GGKA 3HB7A 4X8HA 5EIBD 1XELA 3DTTA 5EVCA 2IUYA 1FTQA 1K2WA 2IW3A 4DT1A 4C2UA 4LYFA 4PC6A 3WNQA 2E1MA 5BS2A 3CX3A 4Q9IA 3VR2A 3P9XA 4MQMA 1CG6A 2ODAA 3IODA 1FQKA 1NSFA 1HLFA 1SXHA 1YB4A 2FPOA 2JAUA 3OG9A 4TKVB 2BY4A 1U6KA 3UHJA 1W2GA 3GVIA 3KQMA 4DSNA 5FPKA 5LJLA 3DV0B 4HXYA 1ZJYA 2AQKA 1VCIA 4HF7A 3JAMA 5JPIA 2Y1GA 1SULA 5MFZA 1I33A 5EL0A 4DLBA 1JV2B 4IIUA 2QLLA 3W2HA 4PZLA 1V1MB 2NM0A 3GRZA 3GGJA 4LECA 2O06A 1A5BB 1DC5A 2NTEA 2HBRA 4NE2A 1WSAA 4QBTA 4PX5A 3IHKA 4DMLA 3ELUA 4X3OA 1C50A 3F2IA 5BRJA 1STOA 3VZSA 3ZE6A 721PA 9ATCA 5I8PA 1FDWA 1GCGA 2ZOSA 4GO1A 2R8PA 3Q87B 4HUQA 1U2DC 4YASA 4CM4B 2HUNA 3VC3A 3CJTA 3SSOA 1NL3A 5CCEA 3WLKX 2UYCA 4JB2A 1Z08A 3LRPA 4FYWA 1EP1B 3DEKA 1ZBDA 3HRHA 2BI4A 2GD2A 4Z99A 1XPJA 4X65B 3W9UA 1CRWG 4Q3CA 4DBLC 1APBA 1GNVA 2WE7A 1LPSA 4IOKA 1GTVA 4DRXB 1PWHA 1YUBA 4BNVA 3L84A 3EGXB 4J0IA 4B8WA 1GZDA 4FN4A 1NX9A 5K0FA 2QQ0A 3UTCA 4GICA 3C43A 2OXTA 5C52B 5C7OO 1DJLA 4CM9A 4KUEA 4DKXA 4RXTA 3JQ6A 4L5JA 4LCBA 5F98A 4PPNA 4MA0A 2KW5A 1IPFA 1P2SA 1A97A 1NY5A 1P73A 2FV8A 3OZ7A 1IJEA 2PL3A 2WSBA 4P98A 1BCSB 2ERYA 5IJWA 5B12A 3PZBA 3MHTA 3LXMA 4RFSB 1XZEA 1Z5PA 3STWA 3T61A 4C4PA 2H0RA 4HVAA 2GSWA 4KH0A 3AEXA 1J2RA 5U9CA 1M6VB 1ONSA 1RHKA 2IUSA 2A33A 4XJXA 3UK2A 3VO1A 4E22A 1XRMA 1SU6A 1NRWA 1XF9A 2MVUA 2Y05A 3C5EA 3PA6A 3PGJA 3DHYA 1HK7A 1HY3A 1ZK2A 2WIGA 1ISJA 1SVKA 2DH5A 3L0PA 1RCFA 2WDPA 2E1RA 4YN3A 2G6TA 4M86A 1MNQA 1TZ2A 1W0JD 4R1UA 4JI6B 5IVHA 2BFPA 3HKCB 2OVFA 3DEJA 3ETEA 4M0MA 1GV0A 2O3JA 3M6VA 5F35A 4TTVA 3RGGA 1SMKA 1TF2A 3OOJA 4DA9A 1T0UA 2B8TA 1MFPA 2WI8A 3GGGA 1UQTA 3VHLB 4J90A 3L0SA 1XTTA 1I9CA 1QUEA 3C97A 4PH1A 5DT2A 1ULZA 3LKBA 4S0XA 3USCS 3H11A 3OIDA 5KYYA 4MCAA 5JSHA 2AA3A 10MHA 4YCDA 1PD1A 2ZU0C 2ZIXA 3FUUA 4PX2A 1OI7A 5CRIA 3QU9A 3QOYA 2CGEA 4J1SA 1Y1LA 3LF1A 4EHJA 5FT9A 1EEHA 4FYVA 2GCEA 5D3MA 2AHOA 3P4UA 5JD4A 4IIBA 3NHMA 2Z83A 3N5KA 3G21A 1HDXA 1NBMA 1LDEA 4YR7A 1OFVA 2RHGB 3B1ZA 2G1KA 5AP9A 1NMEA 2QTGA 2RI6A 3GZNA 3DOOA 1WMAA 2I1QA 1A2KC 2PXCA 4QQKA 3VX3A 4DDKA 3F7TA 1P9LA 4B3CA 2CJFA 4GKBA 5LZ5A 1ZYUA 3H4VA 1IY1A 4KQXA 4TKMA 5I9MA 2VDMB 4WNAB 1LQTA 3ZCXA 4G0WA 1Z36A 1N36B 1PFWA 4C0WA 3IOBA 1E64A 5IBRA 3DF7A 4FGLA 1HLDA 3OPYA 2G1PA 2N46A 2V0NA 2JG3A 2PGAA 4TMKA 1YQWA 4GWKA 4BGDA 4MP8A 5BY2A 3HADA 5DNVA 1QRTA 2QX4A 5BWBA 3WNVA 5JZ9A 1SK8A 4Q03A 2BEWA 1UJNA 1B0UA 3OF2A 1J70A 1TJ3A 1KVTA 2EZTA 1LUAA 4GLOA 5LD2B 4H6XA 4AQ7A 2A9OA 3ROMA 3KUCA 1VI2A 1PU2A 3T3DA 4J7AA 2ZBUA 4KH1A 3NI2A 4OHWA 1NW7A 3PJGA 1HDYA 4M7OA 4PIVA 1NQAO 5JZVA 2ZUEA 4UJ3A 3A26A 3JRWA 4M0EA 3V1LA 2X5OA 1A8PA 2WIKA 2ZBGA 3E8SA 4MVJM 3W5DA 5K0EA 4JT9A 4H08A 3SZMA 4BP8A 3G0HA 4R2KA 3T7EA 3SSNA 4E1AA 2OR3A 3ZZUA 1BTOA 2FR1A 3TLMA 2E6KA 2JJ2D 2VCYA 1KJIA 1CP3A 1XCGB 3FYUB 3LOQA 4KRXA 4OSEA 4QWWA 4AJEA 2DFLA 4D3FA 1UZAA 3FHOA 4V2IA 3R3YA 2APJA 4UU8A 1EE2A 4FCTA 1X13A 4LDAA 2RGNA 3ECAA 5E9JA 2R751 5GV8A 1Q0TA 3RS8A 1A76A 2JA1A 2O8CB 4D92A 4EHIA 1XA3A 3MK31 1Z73A 3EQ9A 4MGZR 3D02A 1NHGA 5I4TG 1TCBA 2Z0MA 4ENVA 5DBGA 1E2FA 3WE7A 2QRJA 2M98A 1VJCA 2QVGA 2RHBA 1UXOA 1FU4A 3TECE 4ER6A 4J0CA 1SUFA 2Q3CA 3PXAA 3C2QA 3FTQA 5DCLA 3TEFA 1JRLA 3QF7A 4Z3KA 2WHRA 3EVDA 1Y3HA 3SOZA 3VISA 3AJ8A 5IKEA 5ANRB 2ST1A 1SA0B 3RVJA 1WXWA 2NOAA 1ZCZA 4HTFB 4Q66C 1RYHA 5J5AA 4Y6LA 1JFFB 4CKBA 4FONA 3UY4A 3CTMA 4LJ8A 2EDCA 4PSDA 1AZTA 1QMPA 2QV7A 2Z3ZA 1RVV1 1M33A 1U8UA 2EZUA 2GD1O 4P32A 2G83A 1E2EA 2W6MA 2VUHB 4PQYA 5BN4B 3BE8A 4DZTA 4XWGA 1DX9A 1GUAA 2IH5A 1Q86Q 3KZ1E 3SBDA 2BBWA 4RIEA 3K53A 5JPAA 5AXBA 5LZ8A 1M0WA 1J0EA 4MJLA 5HJ2A 5AK0A 2RHWA 3K09C 2O0MA 1NW3A 1TK2A 2DWOA 1WJGA 1Y6QA 4LN1A 2YRWA 4J16A 3UB3A 4MCJA 4YCJA 3OU2A 4V0ME 4DQLA 4DANA 2AOUB 2FR8A 4DWVA 3BIFA 3VI4B 2X8WA 2YY6A 5JS7A 3WMXA 3VHXB 2OB1A 2VF2A 3LBFA 3TLAA 1GPNA 4WACA 3I2IA 1XV5A 4C7BA 1W93A 3PDWA 4DKJA 1W4RA 3A7EA 5BSHA 1TVKA 3DFIA 1X42A 4M2LA 3QU4A 4A1FA 4QDZA 4Q19A 2NSLA 4IIEA 1L5HA 3JVIA 3TQOA 3AFIA 3G2QA 5G2OA 4I5DA 3L49A 1B8PA 1FYEA 4LXXA 1GUFA 1QHEA 2NG1A 3E2IA 4Z0TA 5P21A 1VE1A 4C0JA 4D8UA 4PNEA 1KEEA 1LBQA 4RA9B 4KDRA 1RXIA 5EPUA 4ZO8A 2IBTA 2VH1A 2V55B 4RD6A 1AF8A 4G1UC 1GRRA 1KGDA 2QZJA 4G5SA 2MDTA 4MEJA 3FVQA 2ID8A 1ECCA 5GY7A 2R2GA 4BMYA 4OOEA 3OZAA 4LOIA 4JZKA 1QJ4A 4O4LA 1KYYA 1HEUA 2C00A 1T1IA 1Y8RA 3LP6A 4AP9A 3U81A 2VTBB 2J87A 4F2PA 2A5DA 1OA1A 4U6NA 1TO2E 2CNRA 3R41A 4Y2HA 3OICA 1QTRA 5FP0A 4F60A 4AY2A 3BEDA 2ZTMA 1RADA 4N7MA 2R6ZA 1Y48E 5AVRA 1OD6A 2E2WA 4JCCA 2VZ8A 1NN1A 3MMPA 1UBSB 1Y4UA 3IR5A 3NXSA 3QVWA 1V8PA 4L5AA 5DOVA 3BJRA 4DTCA 3CJQA 3EA5A 1ZOLA 2B4TO 5LA6F 2Y1OA 2AIRA 4JR1A 3RJMA 2W2QA 2D1YA 1SBNE 3DH0A 3K0CC 3GN1A 4WLFA 2PDAA 2GCGA 3O4VA 3PD0A 1MJGA 2WHPA 1SUDA 2JIZA 2WG2A 4ZDKA 1XCBA 4BB9A 2HWYA 2P8JA 4HQ6A 4A0RA 4F56A 4LF7B 3T99A 1TLTA 4ZDJA 2K92A 5KJ6A 1DTWB 1RBQA 3KJHA 5E1OA 1NIPA 1W4BA 1PFUA 4XQCA 2GAIA 3L5OA 7YASA 3LGXA 4CNBA 5IJ9B 2PCLA 3ADPA 2A88A 4IGEA 1RKVA 1QGYA 3MQ2A 3N07A 4IX1A 4NU5A 3O9VA 4MWBA 4BUZA 2P40A 1R5OA 2JVKA 3FAZA 3NOXA 2O4UX 2Q9UA 2EGGA 3MUFA 2Z2IA 3FSRA 4MUIA 3PHLA 3KL2A 5FPSA 2JYLA 3ILSA 1WDMA 3DHVA 2DG2A 3BWEA 3HNRA 3JD4A 2ZPTX 4Y1EA 3T15A 1N8NA 3ETCA 2EP5A 4RM2A 2V9ZA 1C1DB 3RTDA 3T9FA 2H17A 3TNFA 3V80A 5HKAA 1W8DA 3G2KA 3I2GA 5DXAA 1E5TA 1P3JA 3FLEA 3A28A 2BGLA 4MVJE 5AVUA 3CWZA 1YZTA 1ZH0A 4Q9LA 3F5QA 5LA6B 4EX7A 3KKEA 3RG8A 2VZEA 1XJ5A 4XJVA 4DMCA 2IV2X 2HXYA 1SBCA 4ZIRB 3LUAA 3Q9LA 2F1JA 3I9JA 4X44A 5KINB 3T5AA 5ICGA 1R0SA 1T9ZA 4BNGA 2IUTA 5GJCA 1FS5A 4KACA 5G4KA 3T38A 3KP1A 3L1KA 1HY8A 1QK4A 3VSBA 3ZWAA 4DA0A 3RSZA 1CXZA 3K9HA 2FWJA 3ENVA 2HT1A 3IAFA 4OQZA 2XXJA 1MJHA 1QIGA 4JJ7A 4K46A 3T7AA 5EMMA 1OX4B 2WT8A 1YHNA 1E9CA 4RHFA 3SE7A 2QMUA 4GMDA 3KAPA 1LPAB 3JD0A 5KTMA 3WB1A 4BMDA 4CQMA 2D5LA 3IAAA 4K6CA 1DIOB 3Q15C 4TLBA 3GQBA 1AB6A 5EWJB 3LIPA 4EEKA 4RY8A 2GZFA 4AZ3B 4JWTA 4LDJA 3OWXA 2OQVA 4BPGA 1J97A 5DN6D 3AESB 3WGLA 4O4HF 3V8BA 2G80A 4EYOA 4PZCA 2VYFA 1VIDA 1B2RA 2AB0A 2FQ1A 3H8WA 4AX4A 4U1RA 4NTZA 4C87A 3I9MA 4JEUA 1R0LA 3CIOA 1J7KA 3SOPA 5EIXA 1T1GA 5BNWA 2Q4BA 1L7MA 3VDRA 5HW0A 5B3LA 5SYAA 1QGDA 3NT5A 4MIOA 4QBHA 2ACKA 3U7IA 3HJTA 1N6NA 4CKWA 3DLIA 5EI5A 5EZ6B 3TZLA 4F04A 2DULA 1ESEA 2R5NA 3UWDA 2FP4B 4J0EA 2XWJI 1X7XA 1B00A 4M9CA 4LZWA 5I7SA 1UPUA 4MKXA 4M1OA 1DAIA 3PICA 3QNWA 1JFVA 4W5NA 4NBWA 4KWHA 3CM0A 3CNEA 3PKJA 2PH7A 1EWTA 3PUJA 1PFVA 3M4XA 1EWRA 1SXJA 4OA5A 3W9SA 4D57A 1OI4A 5BN5A 1F2UB 1P7PA 2RHRA 2EFCB 2C7OA 1DO2A 3GNTA 5AJZA 3VR5A 2UZIR 4U7JA 1AG9A 3NALA 3EGOA 1R0BA 4U0EA 4RKYA 4MKRA 2HMAA 2GN8A 4G8CA 4BLTA 4PZDA 3STTA 1W6RA 3D5EA 3GJ4A 3KR1A 1NU8A 1ZO8A 2QUKA 2RARA 4BNYA 4TLCA 2VC2B 3AF2A 1N7IA 1RWKA 1ZUD1 2V4ZA 1H5QA 4HK4A 4KPFC 4F4JA 2CVZA 1AGNA 4XJSA 5CP8A 3B13B 3THRA 8ABPA 3L06A 5CNMA 3VO9A 5KMGB 1S3SA 1CY1A 1UXHA 2IYRA 3CZCA 4ZAGA 3O82A 4BEJA 3GXBA 3KPYA 3HLTA 4QJ4A 2Z6UA 1Q7GA 1OXKB 3KWLA 3PNBA 1SZJG 4NC9A 3UJPA 4OJNA 3RYCB 3ZDBA 3BJEA 5H7XA 4R4JA 1U2SA 3SCZA 2WYWA 1G7CA 3DE6X 4AMBA 4HPXB 4NFLA 2QTVB 4CEHB 2FVFA 1O94C 4AO7A 1TMGE 5FO1A 4JJEA 4RDHA 3HZZA 3Q2IA 5BV0A 4IDNA 2XQKA 3I04M 2H9YA 1X8JA 4AWBA 4WJLA 1U80A 2EFEB 3IBYA 4GD3Q 3P4XA 2XW6A 2QM7A 4LXTA 3TF5A 4CIXA 2MSDB 2SKEA 1Z83A 5AVZA 1YR7A 2ZUFA 3OBIA 5THXA 2BFBB 3ICPA 5C7LO 1PG0A 5HHTA 4FYXA 2W2VA 4G5QA 1WUTA 2UUPA 3GJZA 4LRWA 1NX6A 4A8JA 3HCFA 3RU3A 3VPXA 1I32A 4PQRA 4TSKA 1XQ6A 4N5HX 1LQ2A 2AOVA 3G2LA 1DC6A 1F3OA 5CLIA 4NE9A 1WBDA 3EUFA 4K81B 3A1FA 3U9SA 3W79A 1GU0A 4KR3A 3VAYA 2Y9MB 1E9DA 3QRWA 4XVCA 2ZR7A 2J6CA 3OETA 4CM3A 4NZ9A 1PTKA 3RS3A 3R6LA 3NWEA 2UYGA 4OHZA 3JQQA 2OMEA 1ZITA 3BMOB 4RJ2A 1A4IA 2M32A 1EK2A 3B2EA 3GEIA 4FFNA 3VU1A 3R0IA 1RPNA 1GU1A 2O52A 2VYVD 3GMIA 4V0QA 3IT3A 4M0LA 2D5AA 1TNDA 3CCFA 1XTRA 3R2JA 4IFEA 4YP1A 3UCFA 3GFBA 1YZUA 1CUWA 5JPCA 3UN1A 2H1LA 4MP3A 3U2QA 2VZ9A 1KARA 4F38A 2CWDA 1G18A 4IRMA 1IEWA 2BD0A 2C9MA 5AYVA 4BQOA 4D4GA 4C0KA 4PQEA 1YIOA 4LYJA 4JLDA 4RV5A 3SYNA 1QLHA 1L8XA 1Z9BA 2CF6A 1MT3A 5F4BA 5FOWA 4C3VA 3O95A 2F48A 4M37A 3A2MA 3BGDA 2G17A 4JLJA 2E21A 4IS2A 1P33A 3N87A 3KFXA 3KPVA 2Q5IA 3F78A 3MJVA 4CLOB 2A5LA 4PV7A 1E4EA 1Q83A 1WUIS 2ZYDA 3NJ4A 1OREA 1GKIA 2C8LA 1NOIA 4BYGA 1YNSA 1PNQA 3NXKA 4LMBA 2PZBA 3E15A 4G97A 4Q9KA 3PD1A 3WBBA 2R9VA 3OJFA 3E81A 4B3XA 5HF6A 1MX9A 3U0VA 2QUJA 3AVQA 2HRDA 1AGYA 4KPUB 2PFSA 1QPGA 2PT5A 2DJ5A 3A4NA 4G5XA 4OA8A 4WKPA 3H3JA 2V3CC 3DCIA 1YZGA 2VJDA 3VJRA 1DQYA 1VMDA 5B6IA 5IAAA 1PHPA 4FHEA 4OHKA 4U8GA 1VCNA 2Q4EA 3U7FB 2KR5A 3UAWA 4DA4A 5CXUA 1IONA 2C2WA 4EEXA 3D43A 1MO2A 2VKQA 3H3XA 2XXAA 1WCV1 1HE2A 1J7JA 3DPUA 4QGFA 1GSOA 4HWGA 4IUYA 4AY5A 2B69A 5FTKA 3MA0A 4BEBA 1V5WA 5AR1A 1I6WA 5ITWA 2IPMA 5K2MA 2W6PA 3TLYA 2D5CA 2OCAA 1V5IA 1WEHA 2W2OA 2XBLA 2QN1A 2OYSA 4PLYA 2I2DA 2UVDA 1Y63A 4JOBA 5AHXA 4NLLA 4TTPA 3NTXA 3T54A 4EQ6B 1NVMB 2EKLA 3ZY3A 3G6WA 5IK2D 5CITA 1R12A 2PA3A 2ECPA 1NV9A 1NUHA 5AI0A 5KU7A 1G291 3PK0A 4Q6BA 3PWTA 4Q7JB 5GM1A 4ZCPA 3A27A 3G68A 3JD2A 4B3JA 3ZDEA 4BTVA 3LH5A 3HXMA 2EWWA 2WPNA 2JAOA 2JCXA 4ZCIA 1NBWB 4IV5A 2B2NA 2YN4A 1FTNA 3NATA 3NDJA 1RAIA 1AUPA 1NXWA 2XLCA 4J49A 5YASA 3CEHA 3ZDZB 2A57A 4KI7A 5FJIA 4C01A 2L6EA 4RSGA 4RIIA 4U00A 5JD5A 4ZHQB 1VJRA 2KLBA 3OESA 3U3DA 3JZFA 1KNQA 4LHZA 2G0AA 4BGIA 1W7AA 2PYZA 3NVMB 4UOZA 4U0KA 3EDQA 4YLYA 1ECBA 5CYFA 2OAGA 1AKTA 1Y3FE 2P2ZA 1EGAA 2YZ7A 2ZIUB 4KKVA 2BSXA 1GZ6A 2BTQA 1ULAA 1WY5A 2DSTA 5EIWA 1QV7A 2NZWA 4FFBB 3D64A 5IG2A 1DRJA 1GYPA 1KBZA 2Y0DA 4BO6A 4U0JA 1J22A 2IOQA 1K5GA 5C4IA 2HQ1A 1MW8X 3VDQA 5JCJD 4QARA 2VT6A 1XALA 1IDN1 1U9JA 3KR9A 4S05A 4QBKA 4KCGA 3NV7A 5TR9A 2FQYA 5AKJA 1AY0A 2OK8A 2XUPA 1AB5A 1M0SA 3NFRA 4MYDA 1L2TA 1DQPA 2X42A 1KK0A 2DOKA 2WSLA 4KYVA 4ZT4A 3ZTTA 1FRZA 2O4CA 4HJRA 1T9GS 4Q3EA 4TPKA 3DULA 2ZRIA 4NCNA 2FMFA 4O3FA 4Y2UA 4IVNA 3AB3A 2GZIA 4XD7D 4XYLA 3EZFA 2O7SA 4M21A 1YS1X 4ZK2A 1AHPA 2XYVA 4PSCA 1Y9ZA 5LZ4A 5A71A 1R1DA 1S2DA 5BMVF 4PZ0A 4HAIA 4KFRA 1SBHA 2C4KA 2O8VA 4TYYA 2HA6A 2FEOA 2PU7A 3BRWA 3P0JA 3KJNA 1V1JA 2EERA 3A04A 3LY5A 4RU1A 5E6SA 5IMBA 2XYPA 2OHIA 4R54A 3KQLA 1KNXA 2OZPA 3QUAA 2GF0A 4GYWA 2I8CA 1PW5A 4UUQA 3SC2B 2F1RA 2R47A 3QU2A 3DXZA 4EAQA 4B3MB 5LB4A 3N7UA 5EZYF 1T3SA 2PH3A 5H68A 4EY6A 1YBFA 4KTVE 5L3ZA 5AOCA 3TNYA 5JYEA 3AM1A 1EIWA 2WU3A 2QBYA 2AZXA 2NSYA 2QTNA 3W9BA 2YZNA 1IG0A 4C0SA 1N8KA 1W85B 4QXRA 1V2GA 3EVCA 3IL2A 4MW6A 3AVOA 2EF0A 3N8KA 3KOMA 1GCOA 3ABZA 3JD1A 1ZH6A 2OZEA 4FWIB 1N8TA 4KO8A 4GI7A 2CUKA 3ZYCA 4EA6A 1SH7A 3P9SA 1NR5A 1GKUB 5DLYA 4AP6A 3NZEA 1BE0A 1GWNA 1XFAA 4LGVA 4YAOA 3QKRA 4FOSA 3FX2A 4L5CA 4W5OA 1T9KA 3HEMA 4Q34A 3LPAA 2EP8A 3EPJA 3K2BA 2YYAA 5KVCA 4EVSA 3VNQA 3SS7X 1W52X 1IBLB 1G2OA 1U63A 5DYTA 1M2OA 3GLKA 3KE8A 4KKXB 4PLCA 3O7MA 3SZRA 4XTRA 4QHSA 5D5QA 3WGOA 4AMYA 3I9V1 1GL6A 4PG5A 1MAUA 4A2QA 2GARA 2XITA 4HZGA 3AF1A 1XA0A 4DCTA 3PDUA 5C9ZA 3PRJA 2EQAA 3WO1A 5JCZA 1AUQA 4D6PA 1QQBA 2G9NA 3V1TC 4JGIA 2Q4RA 1MO3A 2CLSA 2ZRGA 2FJPA 4RJKA 4C4OA 1DKRA 2O5EA 2BWJA 1RJWA 2JBAA 4G5OA 4L16A 2C2YA 2Y9PB 3ZK9A 3H6KA 3K0KA 4TRRA 4CT4B 3GZMA 1A2QA 1MJFA 2CHGA 2JLVA 3KFLA 3I09A 2PMBA 3F9IA 1Z4KA 2QVZX 1XD2A 4ABYA 1N8RQ 3ACDA 3DDSA 4RPIA 1NN5A 3PHGA 4NIMA 3X1YA 1GTZA 1N2CB 3RVLA 4WADA 4YWJA 3MTJA 2WNHA 3MN1A 1DT3A 2UDPA 2QRGA 2VHYA 4LQLA 2ZW9A 3G88A 1OPRA 1XVIA 1XVTA 3KXLA 4RKWA 5KYWB 4OREX 1KPHA 2V8OA 3O2NA 3E27A 2BMWA 2B78A 4HAWA 1NOJA 1V6AA 3L82B 4N5LA 1V6CA 1OYOA 2CUZA 4DNXA 4N3AA 4A10A 4E5SA 4Q82A 1H2EA 4IJKA 4FWBA 1WZ2A 2YY5A 4MEBA 1B74A 1JL3A 3ANYB 3M6FA 4ZYUA 3DAOA 1X7ZA 2GSDA 1PTJA 4IG4A 3PLAE 4LS3A 3OQMA 4XPIA 4DTIA 2WP0A 3MTQA 1SBYA 3DZJA 1OF1A 4UVDA 1ZNQO 3QUTA 1LSSA 2X0IA 1N0VC 1WM1A 3HBAA 4KLCA 4WWHA 4BUJA 3W5JA 3TFOA 1DT5A 1PUXA 2OZVA 3GMTA 3R6DA 4ZAFA 4AUNA 1ODLA 3ZDFA 2P6OA 4ZVVA 3WLJA 1Q1QA 5CK5A 5EUCA 4QYXA 4WVFA 5FFMA 3GLUA 2PEJA 1JYFA 1SELA 3I92A 4JSYA 2HR1A 2OLJA 3RYFB 2HBYA 4CODB 4PXYA 1PNVA 4K26A 3GAAA 1HZZC 1JQ5A 2HTEA 3QE4A 4DQKA 4E5NA 1A04A 5KNLA 4MYCA 3EW9A 3PUKA 4HG2A 4LZNA 2D5BA 4MB2A 2ZR0A 2EBFX 3EIXA 4JJGA 4HDRA 4EK9A 5KSYA 1VSUA 1H22A 4P4NA 1KK3A 1RXUA 4BB0A 2UZ1B 2ESRA 2ZRJA 4KMMA 3GVPA 5EJ7A 2HWXA 2WJ3A 1J06A 2X22A 4A2PA 4LYDA 3NDBB 4HNVA 3AVVA 2XHZA 3RYTC 1TZKA 2WPDA 1X1TA 2XZPA 4FFDA 5JH7F 1QX3A 1CQJB 3RM3A 4ZEMA 3GT7A 3BL6A 1O4VA 1U4NA 3A14A 3U4AA 2DQYA 4OYHA 1SU8A 3PQ6A 2V8BA 4R1OA 1HUQA 2IZ7A 3EGDA 4EG4A 3MUEA 3NWJA 4U2FA 4FYYA 4ZO4A 3ADBA 1R8QA 1WW3A 1HFEL 3ZJ4A 3EJ6A 3L1VA 5DYWA 2ETXA 3UK1A 4E31A 4BVHA 1AMOA 1ZQ9A 3BJMA 3RK1A 2AOTB 1BXKA 1IHUA 2QUAA 1L8QA 1SHJA 3CNLA 1JR4A 3JVEA 1PJCA 4MWCA 2PPLA 4FKMA 1PT5A 3RCBA 4RTMA 1QE0A 4EUKA 4CG3A 4NCAA 1HL3A 1QF7A 3JR7A 4G2TA 1LWNA 3ZEAA 4CUZA 2G9UA 2OV3A 1QK3A 1X1BA 3DVLA 4LJ6A 4XGIA 5KAMA 4CJXA 1X87A 1YC5A 3OJEA 2XT9A 3K1AB 1QO7A 4QDKA 2G28A 3TLEA 1E6EA 3GD5A 3DDHA 3UZUA 5JH7B 1WHTB 2FUKA 2Q0HA 3JYQA 1VRCA 3MILA 4O4IB 4X3PA 5KKAA 3F8TA 4TVOA 2P9TA 3L0YA 2WA2A 1Y6RA 1YI8A 1U5CA 4IUBS 4JUAA 1J1UA 4Q02A 3DDCA 2R2AA 4D56A 2ZIVB 3OQ1A 5IXSA 3KYIB 3OA0A 2CFOA 1V3VA 5IJAA 1H1DA 1WULS 3I1IA 4UAGA 2ZE5A 3ESYA 3MCTA 1HV8A 1C3OA 1J2TA 1V4VA 3MWYW 4TMWA 4UCQA 4QVKA 1M8PA 1X94A 2HD4A 4EUSA 5IBCA 1QYRA 2P2NA 3RS4A 2FPPA 1Z5NA 4GXRA 4NE7A 2IHKA 5HCNA 3ZD6A 3ORFA 5CT5A 3AOGA 3H8VA 2WY2D 1CY4A 4MVJA 4J4HA 1G17A 4XSVA 2OZLA 4WCFC 1C9EA 3J81A 1EOQA 2P7IA 4CKYA 1OI3A 3P2KA 3GYBA 1TFUA 3MWDB 4Q4HB 5KO2A 1WNTA 4W99A 4EFLA 1E99A 1AO0A 3RSOA 4LJ7A 3WGTA 2GVDC 3U56A 2WWHA 2JGDA 4UAVA 2C7VA 1W44A 3DKKA 3GL9A 3I52A 3AZQA 1FMTA 1GQFA 3A9TA 4JROA 3R5HA 4DT1B 1GHTA 3I64A 4RE6A 2LPMA 4BE7B 1EDZA 3OMLA 2JLBA 3HJRA 3D8UA 4MUMA 5FV7A 4EG1A 2I91A 3FETA 2QYOA 3PF9A 1H8ED 4LZZA 1KDYA 2PXAA 3A31A 2ORIA 2W6IA 2QGFA 2D2VA 2W2LD 3NM4A 3T1NA 3PNKA 4II7A 2O57A 2IEYA 3VDNB 2RGEA 4G4GA 4MAFA 1Q92A 5A2QA 3ZDYB 3HH8A 4FQ7A 4JBXA 4JI2B 4B3FX 1Y9EA 4JELA 4AUMA 2OBYA 1D9ZA 3CYFA 4RO0A 1QIEA 2DHQA 4IDPA 3WKBA 4AUEA 4KC0A 3EZGA 1WCYA 4CHTA 5BR1A 3KQNA 2XI4A 4G56A 4H18A 4DS3A 1QORA 2A5GA 4J0GA 3RS2A 4F2WA 1ZR4A 3CC7P 3TMKA 5JHHB 3TE6A 2YHIA 3QV1A 1FP4A 4NU8X 3UT0A 2UVPA 1W29A 1BDMA 1QO9A 4IICA 1YOVA 1NYRA 2NACA 3GFVA 4IEIA 4M38A 4ZZ0A 3E3AA 4NESA 1FW8A 3CNBA 3ZW8A 3G9ZA 2FSVC 2VP4A 1S9HA 3BBLA 4BFVA 1IY8A 2WYUA 3G8YA 3FJOA 4NZMA 2FSGA 1A5ZA 4UCWA 2RAUA 3UV3A 1YQUA 4BVBA 4R8SA 4GR5A 1KY5A 3NONA 2EEZA 2FCAA 1GFSA 4C43A 1EFRA 2JL1A 1AHHA 4QOSA 4Q48A 3N86A 2DGDA 5BRNA 2QMHA 3MJ4A 3WWOA 2YXNA 3CPHA 4QQRA 3R7FA 3ZV6A 3PQ7A 1NLYA 1ZIPA 3KDAA 1ZOIA 1FP6A 2OCIA 2AUNA 3IUJA 2AJBA 3KB8A 2ZZNA 4AI6A 1CK4A 1BH6A 2JI6A 3FNGA 3HY4A 2F00A 5FH9A 8MHTA 3OZDA 5B7GA 2H6EA 3BK2A 1T0HB 3TTUA 5LSAA 4BV8A 1SEVA 2PPVA 1AK2A 1SB8A 2FN3A 2OORA 3EPRA 2VSNA 5SY6A 4I1SA 2XMGA 1GVNB 1M1KQ 1Z0IA 1JBQA 2QSYA 2XA1A 3PDIA 1N5IA 7GPBA 2YJ6A 3BE5A 1IOVA 1ZD1A 1BN6A 2CZCA 2YIMA 3CXUA 4IIDA 5AHOA 4YMTA 4KAFA 5IZCC 3HYLA 2Q3BA 3UYKA 4B3IA 1NZFA 3GZ4A 5JXIA 2GCOA 3C7DB 4NOJA 3U40A 2AK3A 1W35A 2E4YA 4P3YA 3ROXA 1MX5A 5C8VA 2XMZA 3K8ZA 4AY6A 3IVGA 1XDZA 4QDTA 1W34A 4NI5A 5AJYA 5FHRA 5BR4A 4G67A 1KI7A 2HNBA 2R3SA 3WR5A 3LLVA 5AQEA 1RBZA 1ZP6A 5BSGA 4JU9A 2XUKA 2MY5A 1DGQA 1ECPA 2BELA 2BPOA 3G5AA 1YL7A 1J0XO 4R16A 2EGUA 2Z5LA 4RPGA 1T3ZA 5T8KA 1E0JA 1DOZA 4EBFA 1HE8B 2P0EA 4ZMSA 1HYBA 2CNOA 1JDPA 2C20A 2ZIXB 1XTSA 4Y1GA 3USZA 3OO1A 3JSAA 1LY1A 3P9NA 3R9IA 5CB8A 4MW9A 4FFSA 2D3TA 1SB9A 1TJPB 1L5YA 2FFJA 1YU9A 2O2DA 2Y1DA 4HH1A 4PYKA 4I9NA 4EATA 1QRJA 3ID6C 1KGSA 5DNWA 4ZAZA 4WE3A 2ZRPA 4C14A 4L0DA 3GRCA 4JBWA 4RORA 1FTYA 4EB8A 3IQXA 4QTTB 4U3JA 2VJMB 4EZIA 2E5LB 2LUOA 5BQOA 3A6FA 1E62A 2V5VA 3QVLA 3D7SA 3GZNB 3DS5A 1Z68A 2J3QA 2WFLA 3ND6A 3OQHA 5E9WA 1FPMA 1QPZA 4NARA 5E1BA 2LTAA 2GEVA 1R6XA 2ADMA 3CD6P 1P8AA 2IRWA 3JQCA 4YO7A 4RLHA 5BWCA 1O97C 1Y3AA 2VRWA 2Q41A 3AHCA 3CO0S 2PZLA 3ITKA 3QWIA 5C46F 2JK1A 2FUG1 2ZI7A 4OFBA 1Z0KA 5I3ZA 3EN0A 3T5GA 1I5OA 3VZRA 4D0SA 3U17A 1JG6A 3OPYB 3QELA 1KYZA 1WXFA 2DR3A 1IRXA 5C34B 2V74B 3KCNA 3L02A 2XNDD 2Z8YA 3PJDA 3NCTA 4B9EA 4YRDA 2JFPA 4OFXA 3WA7A 3SFVA 2JZOA 2BEWB 3IEPA 1PV2A 1YAHA 4NS4A 4F5EA 4FWTA 5KNDD 4NV3A 4RHXA 3GEMA 4DMFA 4XIFA 1IN6A 5E8JA 2WKSA 1U2GA 3LYUA 1H0SA 3PX2A 1KIFA 2YRFA 4PPYA 4YROA 1SUIA 2VT7A 4AW9A 1UKYA 3AHHA 4J0QA 3QW2A 2FNAA 2DGYA 2YFYA 3NS7A 5AKKA 2OHJA 5KVVA 3T5CA 1FYWA 3KYDA 4CL2A 4TL6A 5I7WA 4YV1A 5THQA 3RJTA 4OBXA 2R66A 5DXFA 3ESCA 4CW7A 1EVIA 2N0SA 4BVKA 5FA6A 3PUXA 1YS6A 4MTLA 3ETNA 3T7IA 5EYPA 5IVDA 2DY0A 2C4NA 5FEMA 2XJ4A 3LT4A 5FTJA 3L0CA 3PX3A 5K0LA 3UGQA 5B1SA 2REOA 4MVYA 1JH9A 3R8FA 1RYEA 1CBUA 1ZIYA 1S02A 2DQ4A 2GO7A 2VEOA 3HSSA 3IA7A 1D2AA 5DBFA 1LLQA 3C15C 1G6Q1 3UJAA 5KC9A 2OFWA 4G0PA 3BWVA 1ATIA 4RYLA 1PJBA 1LKZA 5IKOA 4GH5A 2I1LA 4DR3B 4HDNA 4RSRA 2OECA 2FETA 1WOMA 3X0DA 2NXJA 4ZV4A 1WP4A 4NWIA 3N2YA 1VE9A 3PFWO 2G5TA 4CETA 1BJRE 2GYYA 2RKWA 2VUUA 4TS4A 1EVZA 2B99A 4KMSA 3S2YA 2I7XA 3F1KA 4DJEC 2D06A 4ETIA 3VH4A 5FAKA 4OAPA 1AK1A 4YCCA 4BNWA 3NPMA 3IPYA 1M5UA 3QWAA 1VL6A 2JQ4A 4IMPA 3UGKA 4C0QC 1XHLA 2GPWA 4O0MA 5KHLB 5EAIA 3CRRA 3L1JA 2PUHA 1J39A 1JIJA 4XCVA 3U7JA 1RU3A 4POOA 3VA7A 3OEHA 5IJXA 3STHA 1YFZA 1WCXA 4CKBB 1ARZA 1KAEA 4JLNA 4WMLA 3S2FA 1I2CA 1PW7A 5TJHA 2WIAA 4KDFA 3UEOA 5LIPA 3KT3A 2ZWIA 2FEMA 1H2XA 2EARA 2WMOB 5CVJA 4LF8B 1ZSVA 4QX6A 2VDQB 2CJWA 2YWHA 4H31A 5SY9A 2YJ3A 5JCOA 5B2EA 1LK5A 2HLDD 3P1JA 4NR0A 1RLIA 4XWAA 3KL4A 4FW8A 1HA3A 2HPHA 1Z4NA 1GSIA 2YVQA 4MEAA 4O4LF 2Z9DA 3OZRA 1VXRA 3CW8X 4TQUS 5G3ZA 1U1GA 2HF8A 2BCGY 2GPNA 5FNVA 5G53C 3AVUA 1BXIA 2Y0BA 5JOQA 3LO8A 4DDUA 4XA8A 1JHOA 1TVKB 2W0MA 3AF5A 1VLJA 3AUYA 3DXFA 3P71T 5EQFA 2C07A 3N75A 5EKTA 1LWOA 1L5HB 4F1WA 5K05A 4ND8A 3HCAA 2IL1A 1QCDA 3PT5A 4JLBA 2MWMA 4R1PA 1WB5A 5AKYA 4C0BA 4QA9A 4LFAB 4H1WA 3I05A 5AOAA 3P2EA 1S2MA 1SBIA 1AU9A 3BFPA 1KEEB 4K9NA 4OKNA 3WIDA 4NOKA 4AB1A 2V0GA 5AM0A 1U3VA 2W2PA 2DR0A 3MS2A 4H17A 4HN4B 4CIAA 4ZVPA 2PD3A 2VDVE 3IP7A 4HAUA 2K5XA 2AUMA 2H63A 1CR2A 3QOXA 3GNSA 1MH9A 3LY8A 1Z33A 2RFLA 1T36A 2X5XA 1Q14A 4O4LB 1XGKA 2JANA 3VYTB 4B34A 1ZHFA 1Y8RB 1IUKA 4AK9A 7ABPA 2CFCA 1DIBA 4YPFA 1GIAA 5AVJA 3FA2A 3PQCA 1NLZA 1US8B 1O94D 5BW5A 2YKGA 4BZWA 1ATZA 3GVCA 1J07A 3C5HA 5DCWA 1UADA 4GEKA 4UQOA 4BNFA 3BKXA 4X0EA 2H2WA 2QTMA 4RZUA 4U0DA 2OTLP 5JADA 1OILA 1P0QA 4QNBA 5AJHA 1L7RA 4AKIA 5AUNB 3SGLA 2AFHA 6PFKA 4F4CA 5I51A 2LRHA 5AO9A 4AF7A 3W6ZA 1IJBA 1SNYA 3M8KA 4B48A 2AHRA 2WF8A 2WHPB 3KQTA 4BFZA 5B7PA 4WI1A 4E2FA 1H2YA 4M8SA 1ZRHA 2UUCB 5KNBA 1H05A 4L8GA 3PUVA 2IY9A 2JK0A 4ZDIA 4BO8A 5EJ9A 4RJIA 2FG7C 2DFDA 1MBZA 4AWAA 2I22A 4HB0A 4D46A 3LOUA 1Y80A 5CLFA 5FUBA 4Y1RA 1PT8A 3KOXA 3QOFA 1YB7A 4JGBA 3TKYA 3LQ1A 4X1OA 4LSWA 2I6TA 3RW9A 4JIMA 1UJ5A 3BK1A 1DIAA 3FKSA 3HWSA 2Q62A 1VYUA 2BMVA 1EB8A 1YO6A 2VP0A 1IBCA 2GLTA 3U60B 5DHSA 4FUTA 4GOOD 3L0ZA 2GILA 1P7YA 1TEZA 2GUWA 3EBOA 4G6ZA 1UP7A 1UDWA 4QXQA 3GLSA 4I4LA 3IVAA 2A9FA 1E3LA 1FLVA 5I4IA 1UQUA 2W6NA 1P5ZB 3DFKA 1ZL0A 1TK9A 2IOHA 1MAAA 2R44A 3D3KA 1Z6GA 3K3PA 3QMPA 4IXTA 4UCXA 2BI8A 1RR6A 3I2KA 1RYZA 3OO0A 4QG3A 2TYSB 3L4KA 4JA2A 2KWIA 2QNBA 2FEXA 1FRVA 1L1EA 3OIUA 4RX1A 2A14A 1XDGA 1RI1A 1BRMA 1AGPA 2ZI6A 3E70C 1PGOA 1L7AA 4J3JA 3B78A 4E3WA 4YUAA 4YRQA 4Q7QA 1AT1A 1J33A 5G4KB 5BOVA 1NR1A 3PDCA 1W49A 1CU1A 1NMQA 2PV7A 3AKCA 2WWXA 1DO0A 4X7PA 3WFJA 3CW9A 1P4SA 3AEKA 1I4DD 2ZI9A 4LIPD 1JB9A 1YR8A 4ZALA 1JQBA 2HJGA 3W8DA 1F2DA 3RRZA 1W1UA 5A7FA 4PU0A 5BQPA 1LPPA 4CQMB 4UTVA 4Y7CA 5TPWA 4X1IA 2PAAA 4TXMA 1YZVA 4CU5A 4W8GA 1V39A 4FP9A 2CYAA 2NO6A 4KYIB 4N3BA 1JI0A 2PUAA 1PZMA 1GDDA 3TYXA 3DE7X 4LYEA 3LRTA 1KZGB 1Q7BA 1RBMA 3O4FA 4IP0A 1K7CA 1JU9A 4ZQGA 6ABPA 2RBKA 2BMDA 2DQKA 3V9PA 3WWEA 5KHAA 2DETA 4BXOA 3FTFA 3IBGA 4IH4A 3MTBA 3S4YA 4DBVO 1F8FA 3K9LA 3KHKA 1C5KA 1EGMB 4AJPA 1EXWA 1XZAA 2HSZA 1QVFO 2NVOA 4CCSA 4DLAA 1Q7EA 4FCVA 3VV3A 3ZUGA 4CKWB 1JUDA 3ZHSA 4LTDA 4YT8A 4GKVA 3K9WA 4Q9DA 1SHKA 1NNLA 4MNTA 1YJBA 1A77A 1WVIA 1X7XB 4UXIA 3CEMA 2IKQA 1J9GA 1VPDA 4V1CI 2EU8A 3AUAA 4K7JA 2NYUA 4BWFB 1ZNVA 4A1OA 4WZAA 1G60A 1UT6A 2JF0A 2C78A 3CX7A 2X2FA 3QLTA 2IY8A 1ENYA 3EVFA 3QHPA 4R3WA 4N39A 5B37A 5M7EA 5BN5B 1XXHE 3ETLA 2QRQA 4GOJA 3Q0IA 1UFOA 1LDGA 1X3SA 1C3XA 3DKIA 2AF4C 2H5LA 3PWKA 1FDIA 3L1UA 4Y9UA 4Z1MA 4AJ1A 4E09A 3DT8A 3WI7A 4ZQEA 3N6XA 4FHDA 2F9FA 2ONKA 3OE7D 3IFSA 3W6NA 7REQA 1OT5A 1OX6A 3TQCA 3W6UA 2PXXA 2WT9A 1MG5A 4G0MA 4Q3OA 4D8TA 1GTSA 1V8DA 3ZWWA 4K5QA 3B9PA 4RD0A 4D8XA 5FXMA 4KI0A 1D4AA 3OF5A 1HDRA 2O7RA 4K9OA 1JFLA 4J16C 1HTBA 1W46A 2PZAA 3DT9A 4QASA 2OYCA 3TMYA 4EGJA 4HLNA 2FR8C 4W8OA 4Z9YA 3AGPA 3VPFA 2Q6VA 4TZKA 3OQVA 1N7GA 1YBHA 4KDEA 4Y2QA 5IUKC 5C5EA 2NTYC 4HJXA 4JMPA 1R6DA 2OBLA 1ZXBA 2P9GA 4PAQA 4EY5A 1SGWA 2AGVA 2P5YA 4REMA 3UT5B 1U8CB 2CJYA 1JG3A 4MI9A 5DHPA 1YZKA 4TMXA 5DHRA 3EFBA 3WGUA 5A4DA 2HKIA 3ZGXA 5BYKA 5E2AA 1RYFA 3GU3A 1S4MA 2D4HA 3PUWA 2BGGA 4X8LA 4G01B 4Q01A 2N6ZA 2OILA 4LZPA 2ZE6A 1DNYA 1K7XB 4L1KA 5DGCA 3U3OA 4QIHA 4BN0A 4C21A 5LUAA 5CPBA 2R96A 5DHUA 2W42A 4DV7B 3UKOA 5DTEA 5BOSB 1GRCA 2O5VA 3WTCA 4Z7JA 2QZ9A 2CNNA 1Q0QA 3VYUB 4A8JB 5CLHA 5KIAA 3N2KA 3MJHA 2BAGA 3AV0B 3O84A 3Q3HA 3PQ2A 3Q7IA 5D7BA 1E98A 1KOJA 1P9OA 1W75A 1GSHA 2C4WA 1JKXA 2YNMC 3GGSA 3Q88A 3SHOA 1T0JB 2AV6A 1LA2A 2D8MA 1KF0A 2CVQA 2WKRA 1NVVQ 1N3IA 2J85A 3IIKA 4WIAA 1P45A 3E23A 1WZCA 2HA7A 2QL7A 1A69A 1H4TA 1NVUQ 1ZVJA 1BG6A 2WYHA 4ALJA 1G55A 2DXIA 3I5YA 3GEEA 4G0VA 2ZXFA 4F7WA 5E0OA 3V42A 3UFXB 3A4MA 3LO5A 4JBHA 3I1YA 3D0RA 2BKUA 4O25A 2NYVA 5JSKA 1KQGA 4NAVA 7MDHA 4M9UA 3KHSA 4J0DA 1VC2A 1ZOPA 4QPZA 3W5IA 4EY7A 4WOBA 1YIDA 5FYDA 2A0UA 1E1CA 1C9KA 5CK4A 1FVXA 1OIWA 3G7SA 1E5VA 3FCAA 3W1EA 4EAAA 1U8EA 1F80D 2J0VA 1DXOA 3DHWC 4J94A 2ZAMA 1YACA 2AG6A 3GRYA 3RVOA 1TQHA 1KXJA 4BFTA 4EPRA 2WMDA 6YASA 3WLOA 5LP6A 1JJFA 4KQ9A 1DC3A 3ZBPA 3RSQA 1H2ZA 3O38A 3UXMA 3WGYA 1ZQ1A 4KXVA 3E35A 4KW7A 5T3UA 1RQ7A 1H1TA 2CEAA 3I6IA 3CINA 3IT2A 1WDWB 1AHNA 3DNMA 1Q7TA 4GBED 5C7YA 2HRZA 3QPAA 5C8YB 2WA1A 4UM7A 5DNEA 2D2XA 4I8IA 2QX7A 2EHTA 2HIMA 1C7RA 1KAGA 2I5PO 1G1AA 3B8EA 4CL3A 4US2R 4XWWA 3G6EP 4H7EA 3U1TA 2BMFA 5FL3A 1UBEA 1DAHA 1TJYA 1YR2A 4FILA 4G1VA 4RH0A 3SR4A 4Y6RA 4DR2B 1NTRA 3TQSA 5E6RA 2Y93A 4O4JA 1EG7A 4XB1A 5F21A 2VN8A 1GTMA 4AG3A 4US1R 1DXQA 1NMXA 3RLFA 3U49A 4E2WA 4BB5A 2XXAB 3QKUA 2LTEA 4AN4A 4EYKA 5BUQA 3FSJX 3LP8A 2GYUA 2QLNA 3IELA 4MKHA 2D74A 2W6JD 1C4WA 4GC5A 4RPLA 3LTNC 4HSEA 4Y6SA 3D8BA 3LMKA 1VHQA 3FSGD 4IDHA 4PQFA 3Q10A 3A1NA 3IP5A 1ORWA 2TMDA 2Q0XA 1TYAE 1ZU5A 3WLEA 1PYGA 1XZPA 4RS4A 3RE1A 3LK6A 4EOGA 2QMYA 3B6JA 5IUJC 1P0CA 4N7JA 1ZS9A 2YWFA 3GFFA 3MF4A 1L5SA 2RK3A 4D3ZA 3EW7A 1Q21A 1WXDA 3AGQA 5BNFA 3UB4A 3VZPA 3BGOS 1OZAA 3L6EA 621PA 3T0GA 4RHEA 4OHPA 4F72A 1TCCA 4PAWA 1T1RA 4F93B 4QHTA 5BSTA 1J00A 4P0PB 5J63A 4HEA1 1QXSA 4A2CA 1E7WA 3DQZA 1SN7A 1WD7A 4I5IA 3RDPA 3RK0A 1VLQA 3P7MA 1YBAA 1D5WA 1XPRA 5TS3A 3TDKA 1P2TA 1HE5A 4MWZA 3ILVA 3AF6A 4NCKA 2J67A 2G08A 1GPYA 5DI9A 1EM6A 4S3MA 2BTQB 3EFHA 3R1IA 4Q21A 1U0OC 3ZDDA 1RS0A 4G5GA 1L7NA 1XZLA 4FDLA 5SY4A 4CRWB 1OR5A 4F6LA 2QD2A 1ZHOA 2HNKA 2NUPA 3UMVA 4D3YA 1QANA 1T29A 3GJ7A 2G5PA 1SXJC 2OUKA 3HCDA 5A05A 2QIPA 3IT1A 4B80A 2GN4A 3M6XA 3F47A 3ZWXA 1R0YA 3NUGA 2YCBA 2R8BA 1S5PA 3GW8A 4GECA 4IRUB 3WQQA 4F3RA 1WS6A 3P2IA 3RG6C 5EQTA 3M49A 2Q3EA 4OQ4A 4XVUA 4ZCTA 1IWPB 4XGRA 4BLWA 3C7TA 5CVTA 3NTQA 4M0DA 4WLOA 2A4KA 1G21E 3HYTA 2YH2A 3K96A 3UANA 1IWBB 3EBPA 2FUG6 3QPVA 3U39A 5E3HA 1KKUA 3ZDCA 2YICA 2HDOA 5EJIA 4YI3A 3ORSA 5ERGB 1K3FA 2JFOA 3CA8A 5HGXA 2HPZA 4NBKA 2VNAA 4GM0A 4BNZA 2K94A 2Z1DA 4X6YA 5FI3A 3V7UA 4UFPA 1H8HA 1D2MA 3P4YA 3RTGA 2P9FA 3ENNA 3N2LA 1N9KA 3WAJA 1JHUA 1P39A 1JU4A 5A4KA 4YXWD 2NO8A 3P9PA 4ALKA 2J41A 2QAJA 2DEUA 3TL2A 2EHSA 1JMYA 3V46A 3JY6A 3Q8LA 3CE6A 1N5DA 4N40A 2EDAA 3EXHB 4U0BA 4OI1A 4LE1A 4L4SA 4AIIA 4LCJA 2FW7A 3F98A 3ADCA 2QBYB 5H4GA 1NSTA 4U6SA 4I1VA 3ZXIA 3VNVA 4BO0A 5C1BA 2GGSA 2GZ2A 1IMQA 3UTDA 1A43A 5FX2A 2O07A 3QI2A 4BBAA 1XJCA 3JQ7A 2I3GA 2VP9A 1D03A 4A8JC 4PSVA 1DBWA 3SVTA 4ZCRA 4NHEA 3DL7A 2OO7A 3GJQA 1V5GA 1BKSB 2C88A 4J2TA 1D7OA 3RWMB 1CYEA 4OP1A 4TLAA 3FOZA 1G3RA 5LU8A 5EJ5A 5DGDA 3SWWA 3QKRB 1GPAA 2BM1A