2EG5A

The structure of xanthosine methyltransferase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
354
structure length
344
Chain Sequence
GDTSYAKNSAYNQLVLAKVKPVLEQCVRELLRANLPNINKCIKVADLGCASGPNTLLTVRDIVQSIDKVGQLERPTIQIFLNDLFPNDFNSVFKLLPSFYRKLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLQWLSQVPSGLVTELIGTNKGSIYSSKASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCICKGVELDARNAIDLLEMAINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCIVEEEGSFEILYLETFKVLYDAGFSHIKAEYVASSVRAVYEPILASHFGEAIIPDIFHRFAKHAAKVLPLGKGFYNNLIISLAKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Xanthosine methyltransferase
publication title The structure of two N-methyltransferases from the caffeine biosynthetic pathway
pubmed doi rcsb
source organism Coffea canephora
total genus 120
structure length 344
sequence length 354
chains with identical sequence C, E, G
ec nomenclature ec 2.1.1.158: 7-methylxanthosine synthase.
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03492 Methyltransf_7 SAM dependent carboxyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.270 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2eg5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2eg5A02
1M6EX 4UOEA 5CIYA 2AOUB 1JTFA 2JJQA 3TKYA 5EEGA 1RJGA 1O54A 3KQYA 2IBSA 4WXHA 4EK9A 3CKKA 4OBWA 2BR5A 1DL5A 4MTLA 3VC1A 5CVEA 2YXEA 3P9KA 2PX5A 5FADA 1RI1A 1DUSA 1ZQ9A 2CWWA 2FYTA 2ZZKA 3NVMB 2NNWB 1P1CA 3OU7A 5EMKA 5DTMA 2ZW9A 2ZTHA 2ZBPA 3OE5A 1XDZA 2ORED 3A25A 3PX2A 5DSXA 2QE6A 3ME5A 3ORHA 1UWVA 2DULA 3KQSA 4ATNA 1FJXA 3K6RA 1NW6A 1AQJA 3H2BA 2EJUA 3BGIA 2P7HA 2YX1A 2ZSUA 3KQMA 3OU2A 1R8YA 1JSZA 4KDRA 2PT9A 3CJRA 3F4KA 3OCJA 1L3BA 3UJ9A 5GP1A 2ZCJA 1AF7A 1NE2A 4KVZA 2HTEA 1M0EA 1X1DA 2HNKA 2WA1A 3FUXA 3BWMA 3MERA 3NDIA 4E70A 3FTFA 1XVAA 3EMDA 2ZWVA 5CVUA 3PB3A 4RTKA 10MHA 2GS9A 2PX2A 3AXSA 3KR9A 2ZBQA 3UJBA 4M37A 5HFJA 3OU6A 1SKMA 2IH2A 2GLUA 4DM3A 2GPYA 4P58A 4CWAA 4YUXA 2G1PA 5BW4A 4YUVA 5G02A 1JSXA 5LQJA 1G55A 3FPEA 2C7RA 5E9QA 3LCCA 3FRIA 4AZTA 3T7SA 1RI2A 3FPHA 3P2EA 5GINE 3EGVA 4RSRA 3JWGA 1N7JA 3SSOA 5K0NA 3LHDA 3GNLA 2P7IA 4RVGA 1BHJA 3M6VA 1YUBA 3B3JA 4GOLD 5T6BA 1R8XA 5KQSA 3TMAA 2GH1A 1R74A 3ELUA 3IV6A 3PVCA 3GIWA 4QPNA 3I64A 3KPWA 2BR4A 3FZGA 3KKZA 4RTRA 3BT7A 2HR1A 3C3PA 1R6AA 3LDUA 1L1EA 1FP2A 2OXTA 1QAOA 3ELDA 3VC2A 1X1AA 3KQOA 3BXOA 2B78A 5EIFA 2NXJA 3KHKA 4DCMA 4GOMD 5K0FA 3SMQA 3A7EA 4U7PB 4KIGA 2PVCA 3FUUA 3R6TA 4OX9Y 3GWZA 1ZGJA 2I62A 2OY0A 3FTDA 2V74B 5K01A 2OYRA 2H1RA 2AOVA 3EVZA 5EPEA 3AY0A 1BOOA 4CKBA 1JQDA 3GRVA 1VE3A 3ANXA 3B3FA 3LBFA 4CKCA 1WY7A 5K0EA 1P91A 2YTZA 5E9WA 2UZ4A 3K0BA 2AOWA 5EIWA 3RODA 5EKUA 3HCBA 2ZBRA 1NW8A 1KXZA 3KPVA 3SR4A 4PYKA 2ZWAA 4RVFA 4BP1A 5LQUA 3DLIA 1KYZA 3IYLW 3KQTA 4E2WA 1L3IA 2NP6A 1RI4A 3EGEA 1G8AA 4YV2A 2PXXA 3AJDA 1N7IA 1MJFA 4P7FA 1PJZA 3PFHA 4HRAA 5DXAA 5FA5A 3G2QA 4RWZA 5ICFA 4YMHA 5HOQA 5K0GA 5DTQA 3ELWA 5E2AA 2ZZMA 3G8AA 3KPJA 3UJ6A 4YV1A 2O0LA 2EG5A 3UA3A 1BC5A 1ZHFA 3NMUF 2XVAA 4FT4A 2PXCA 4X61A 2PWYA 4C05A 4GOOD 1NBIA 1TPYA 2G71A 3REOA 5K03A 3TM5A 1JR4A 4AZSA 3WSTA 5KS2A 4QTTB 3G5LA 3CJTA 2PKWA 4P7KA 4FR0A 4CXMA 2AN4A 2OBFA 2OO3A 4FSDA 3O4FA 1ORHA 4YUWA 3L8DA 2NP7A 2YQZA 5D1HA 3G89A 3CVOA 3HNRA 5EZSA 3EVAA 3DXXA 3FPFA 3R24A 3UZUA 5P8WA 3UJAA 4V0QA 4RTPA 2FCAA 2QRVA 3P8ZA 4HTFA 2OB2A 5LQKA 4PGGA 5EHGA 3TR6A 4EKIA 2PSSA 2AN5A 3R0QA 2VDWA 3HA7A 1RJDA 2VS1A 3SX0A 2XVMA 4GEKA 5EQJB 4QTUB 2IGTA 4IWNA 5FQNA 3BZBA 4OQDA 5MHTA 1IM8A 2O05A 5HEKA 3C0KA 3OZRA 3LPMA 4AX8A 1SG9A 4QVKA 3PFGA 2XYQA 2GAFA 5H02A 1G38A 1I4WA 4A6DA 2YXLA 4E32A 1EIZA 3EEOA 2YR0A 5E9JA 2P40A 3ELYA 5F2OA 4F86A 3PX3A 3PTAA 4P7GA 3FPJA 4PYJA 5C9ZA 1VPTA 4GQBA 5EC8A 4AZWA 1D2CA 5DT2A 2F8LA 4EVIA 2YVLA 3C6MA 3FTCA 3I5UA 3V8VA 5ERGB 2UYOA 3R3HA 4PYOA 2C7PA 3GXOA 3UJ7A 1HNNA 3EVDA 4DF3A 1INLA 3LX6A 2I9KA 1V39A 3DUWA 3OZTA 4QQKA 1NW3A 2CL5A 5DWQA 2IH4A 2ZZNA 1RI5A 4GOND 3KU1A 3A27A 3HVKA 2Z6AA 3EVEA 3GDHA 3E7PA 4CKEA 2P1DA 4FSXA 3NWBA 4WVLA 4MWZA 2FRXA 1KHHA 2HMYB 3CCFA 4PGHA 4QVGA 3C3YA 1P1BA 1VLMA 2G70A 3KPYA 5K05A 5M5BA 3P9IA 3O7WA 1M6YA 2B25A 3O31A 5EMJA 5DX1A 2H11A 4NECA 5JUWA 4OQEA 5U4XA 3X0DA 5CCXA 1MHTA 1KPIA 2EFJA 4OA8A 1P39A 3NJRA 5BP7A 2OPBA 3JWIA 1JTEA 5EVJA 2JHPA 3M33A 4OBXA 3UBTA 2P8JA 5CVVA 3LBYA 4BLUA 3UJCA 3GGDA 5D1NA 5E8RA 3HEMA 3MCZA 5HILA 3BGDA 1JG2A 2G72A 3ER8A 3MQ2A 2G8NA 2PBFA 1KIAA 2ERCA 2BH2A 4R05A 9MHTA 3BWCA 3G2PA 4FS8A 4EQZA 3UWPA 2FK7A 4RYLA 4PCAA 5HIMA 4YMGA 4IV0A 5K0LA 2PJDA 4GC9A 1OR8A 3A7DA 1U2ZA 4HC4A 1G8SA 4LG1A 4OA5A 5IKMA 5EHIA 2Z6UA 3TKAA 2O06A 2ZIGA 3BKWA 3QV2A 2AOUA 1YZ3A 4KRGA 5FWAA 4ER0A 2XBMA 1R00A 2GB4A 3RW9A 1JQ3A 1TW3A 4L7VA 1JG1A 3HVIA 4E2ZA 3ID6C 4R6XA 3DR5A 2PV0A 5CD1A 3QOWA 1QAMA 3DXYA 4G56A 2WA2A 3ERCA 3LKDA 4ER3A 1SQGA 2AOTA 4E2YA 5FTWA 2HV9A 3SGLA 5DM1A 4PNEA 3G8BA 5IH3A 3KR2A 4PYNA 4M38A 5FWDA 3G7UA 4M7RA 1G6Q1 5FCDA 2QRVB 4HTFB 4AZVA 3NWEA 4PCLA 5DRYA 4DA4A 2R6ZA 5FQOA 5GWXA 5CCBA 2PXAA 4B17A 5LQAA 3EVFA 3VYWA 5E1OA 3PLAE 3M6UA 3GU3A 1EG2A 5E8JA 4PIPA 2ESRA 3TPZA 1XCLA 2PX4A 1SUIA 5CVJA 5KQRA 1I9GA 3PS9A 4E31A 1DCTA 2C7OA 3GRYA 3MHTA 4DZRA 4ER6A 2ZIEA 4P7JA 2XYRA 3P2KA 2OZVA 2PY6A 1NBHA 3HP7A 4QPPA 4Y30A 1WG8A 4PIMA 1WXXA 4M36A 4RTMA 3BGVA 2ZVJA 1YZHA 1QAQA 2PX8A 3P97A 1EJ6A 1VL5A 3FUWA 4C07A 3DMGA 5K0BA 3R9XB 4C4AA 3FYDA 4E33A 3T7RA 2CKDA 2ZLBA 4RTJA 2P3QA 2O07A 1O9GA 2AVNA 3E23A 4E2XA 5DM0A 2OB1A 2AZTA 2Y1XA 2KW5A 1D2HA 5HIKA 3LDFA 1UFKA 2JH8A 3OPNA 3KQPA 5E1MA 4EMSA 1QYRA 2IPXA 4RTNA 5E1BA 1FPQA 1YB2A 4RTOA 3FUTA 4JXJA 1BKYA 3A4TA 3GJYA 3KR0A 3GCZA 5BW5A 2R3SA 3G5TA 2CMGA 3HVHA 3TRKA 1XDUA 2AOXA 5JR3A 2P41A 1R18A 3TQSA 4POOA 5K8VA 2UYHA 4ZTBA 1EJ0A 3HCAA 4R8SA 1JG3A 1X1CA 3Q87B 1RJEA 1XTPA 2AVDA 3DULA 4FP9A 3MTEA 3DMFA 1JQEA 4KWCA 4LWOA 5FUBA 1SQFA 3MCTA 1XJ5A 1X19A 3LCUA 3UJ8A 3NDJA 5FHQA 4BLWA 3BWBA 2JHAA 7MHTA 1XDSA 2LD4A 2ZULA 1VBFA 3HM2A 5EG5A 2IBTA 1X1BA 1N2XA 4QDKA 4RTLA 1T43A 5CM2Z 4RTQA 5LQNA 3HCEA 3SSNA 2QY6A 3T0IA 2PT6A 3IEIA 5DSTA 4LECA 4O29A 3FYCA 5T67A 3OFJA 1AV6A 4GF5A 3FRHA 3NVKI 3G2OA 2B3TA 2VZ9A 1G60A 3CBGA 5KVAA 1KYWA 2XYVA 3PT9A 4PYQA 4X60A 3G88A 1WZNA 1EQAA 3I9FA 5HIJA 3DP7A 4C08A 5F2KA 1FP1D 3C6KA 2JHCA 4KDCA 4XUDA 4RVHA 1ZG3A 1F38A 3GRUA 3JWJA 1D2GA 3KQQA 4V0RA 1NV9A 2I6GA 2C7QA 3D2LA 3B89A 3DH0A 4HGZA 5E1DA 4GC5A 3QOXA 4YUYA 4QQNA 3AWIA 1VP9A 2AOTB 2ONYA 4EKGA 2UYQA 5K0JA 1TW2A 2ZFUA 1SVUA 2VDVE 4XUCA 4MIKA 3SSMA 1Q0TA 1L3CA 3KQWA 5CVDA 2BM8A 3JWHA 2BM9A 2N47A 4AUKA 2VP3A 1YF3A 3P9NA 3RIEA 1Q0SA 3EGIA 5BXYA 4U7TB 2K4MA 4HGYA 2IIPA 1KR5A 3M6WA 5C1IA 3UA4A 1XXLA 3BWYA 3V97A 4PINA 4C04A 5F2NA 3U81A 3DTNA 4PWYA 2UYCA 2Y1WA 5FHRA 1H1DA 3HA3A 2YXDA 4FGZA 5EEHA 3HCDA 3CC8A 5GIPE 2AR0A 2IFTA 4IKPA 3NW9A 5HZMA 4Z2YA 3KR1A 2BR3A 2PGXA 3LSTA 4PONA 3BUSA 5B1SA 3KQVA 4R8RA 5HIIA 2YUIA 5EGSA 3THRA 3E8SA 4RV9A 1KPHA 4QDJA 4IV8A 1NW5A 3TOSA 1KPGA 1WS6A 3GRRA 5DLYA 3LCVB 1F3LA 4CTKA 3DXZA 3EEYA 2ONZA 3P71T 5ICGA 3EVCA 1ORIA 1VIDA 3AXTA 2QYOA 3S68A 4C06A 1I1NA 5DRTA 3ER9A 2Z6QA 1VP3A 2P3LA 3T7TA 1KP9A 3HA5A 2QM3A 2CMHA 2NYUA 3DOUA 4HG2A 4LWPA 5EKXA 4DQ0A 2P3OA 1WXWA 2AS0A 3LL7A 5DTRA 3BKXA 3TLJA 3CJQA 1RJFA 3HVJA 5K0CA 3OE4A 1B42A 4GBED 3FPGA 3UFBA 3MGGA 4DKJA 4KW7A 3SM3A 1NT2A 4Y2HA 4F84A 3HCFA 3THSA 3TFWA 3IHTA 2O57A 5E2BA 5EMLA 3OZSA 2EX4A 3M6XA 3UJDA 4ER7A 1QZZA 2H00A 5GIOE 4PYIA 2ADMA 1RI3A 3Q7EA 2E5WA 3B7PA 4HH4A 5CUQA 3EPPA 2GA9A 1AQIA 5DM4A 3MB5A 2Q41A 2FK8A 3E05A 1ZGAA 4X63A 2NXNA 4E30A 4RVDA 2JH9A 3OFKA 5LR6A 3KPUA 2PLWA 4MQ4A 3I53A 4GUAA 4FZVA 4PYLA 4MHTA 2IDJA 4KIFA 5DXJA 5FULA 2WK1A 2AN3A 3P2IA 4ISCA 3SXJA 3LGAA 3LECA 3FUVA 2EJTA 2IP2A 2VDUE 3MAGA 4K6MA 5LSAA 1VQ1A 4PYMA 2IDKA 3B5IA 1XCJA 4HSGA 5EZQA 5C0OE 4YUZA 4RX1A 1JG4A 3A26A 4C03A 3G2MA 2B9EA 3P9CA 4X41A 3B3GA 5ICEA 4BY9E 2V7EA 3GRZA 4YV0A 3FTEA 2PWPA 3HTXA 2JG3A 3EVBA 4FT2A 2I7CA 5GOZA 3TM4A 4R6WA 5DPMA 4BLVA 1QANA 5LQRA 5EOVA 3EMBA 2NXEA 2OKCA 4CTJA 3LDGA 5ICCA 4DMGA 1IY9A 5K09A 8MHTA 1Z3CA 5DX8A 1YFLA 5GM2A 1Y8CA 2P35A 3DLCA 3LKZA 4XCXA 4RTSA 3SVZA 5KYGA 3HCCA 1NKVA 4DCGA 5T64A 2B2CA 2ZIFA 4A6EA 2NXCA 4X1OA 1YFJA 3DMHA 4H0NA 1ZKDA 2A14A 3GO4A 1EAMA 5DX0A 5LQCA 1NV8A 4F85A 3M70A 2HWKA 1HMYA 1PRYA 2IH5A 5EMMA 4BP3A 3CGGA 2DPMA 3M4XA 5GM1A 5DM2A 5FA8A 1NW7A 1L9KA 3MTIA 2FPOA 1SUSA 2FHPA 1IXKA 1UIRA 3VSEA 3EVGA 1O9HA 2BZGA 4XUEA 4ER5A 3I58A 1FBNA 3NTVA
chains in the Genus database with same CATH superfamily
1CJUC 3T7KA 3CH7A 2BV3A 2VPYA 5IKOA 5IASA 3PUZA 1NNI1 1XWIA 5EPUA 1DC6A 5BNFA 4EK9A 4OBWA 4MDHA 1GXSA 3IT1A 3VBCA 4V39A 2FSVC 3W6OA 4Q7LA 3VKGA 1OFVA 1NPTO 3M7IA 2BP7B 4FFWA 4UHCA 3MUNA 3PYXA 3GLHA 4MV1A 2Z1MA 2ZZKA 2IX3A 2GK6A 4RQTA 4AUMA 1KWGA 5EJGA 4JXXA 4GMFA 5HQJA 3WK9A 1P5FA 1EFAA 3NY7B 3PQ7A 1PFQA 4XDYA 4W4TA 1F14A 4ND8A 2Y1DA 5DGIA 4KPEC 3DDUA 4UTZA 3H2BA 1Z2CA 2ZYAA 3L1IA 4ZAXA 1OXSC 2YX1A 3UO8B 4B8YA 4YRQA 3VR6D 3W3AH 4BNDB 1D5WA 4YIHA 1EGMB 1M1NA 5FNZA 1L3BA 4DCTA 1ADFA 1HSZA 3M83A 5KTMA 4JB2A 4PGFA 1S72P 3VJRA 3KXKA 3Q5GA 1S3FA 3JAMA 1JDZA 1K8ZB 2W4MA 1W19A 3R5HA 3ZWWA 1PP4A 4AUEA 4RTKA 2GBLA 2EVWX 2QSYA 3KR9A 5E6RA 1ID1A 2HLDA 1DTSA 3AESA 2UZ3A 1NXSA 5HFJA 5DCKA 3VNAA 3DZKA 3IUQA 4TL6A 4BVHA 3T1HB 2RDMA 3DTVB 3S2SA 5C5CA 2NTJA 5A4IS 3N53A 4PXAA 3LBHA 1G55A 3G49A 2VAPA 2C7RA 2ZAMA 3GJ4A 4LXIA 3FYUB 4U7WA 3FFXA 1VECA 3T06B 1T2AA 3W6PA 3P2EA 1RRCA 4H7FA 2GCOB 1BH6A 1ZW1A 4MA4A 3RTAA 5ANRB 5H59A 1NPYA 4ZANA 2AXPA 2O8NA 3OCXA 1G20A 1DXYA 1K5GA 3GMSA 1JKMA 5CEFA 3I83A 3ZTTA 3IPXA 2VPQA 2C7VA 1YH3A 4OI1A 1ZBQA 1SD2A 2LDBA 3KM0A 5D01A 5I4KA 3UATA 4BQEA 2GSDA 1JYSA 2O0KA 4UXJA 3QX3A 2FFAA 1L1EA 1A4UA 1GLVA 1H9AA 1MRNA 1NAHA 4UAJA 1T6BY 4JNKA 4MQFB 3TECE 4P35A 3U09A 3BE5A 1M1XB 3LRTA 3T15A 3BXOA 1L4EA 2PS9A 2I67A 4LIPD 3ROXA 2GHTA 4HEJA 3HR7A 4FCWA 5ABPA 5C4IA 1XMSA 5CDGA 1GKIA 2CCGA 3OE7A 1FMJA 3ZDXB 3TCXB 4Q9LA 4BMDA 4OSOA 4BHTA 1UQTA 1Z4QA 2VR1A 3QHPA 3NBMA 2C95A 3FF1A 3V5NA 4PLTA 1H5NA 2AVAA 3N2YA 4OQYA 2O2HA 3DAGA 2YHAA 3EH2A 2ZI4A 3T5BA 3VKFA 4D97A 5EMNA 4EI2A 4BIIA 5L95A 4U9IS 3EODA 1V95A 4M0FA 4QBKA 4R1SA 1T1GA 3NEAA 4J1TA 2N5HA 4KQ9A 4ZV9A 1BE6A 4MJXA 4EW2A 4IXNA 4YV1A 1QWSA 3ZHSA 4CHTA 3JQAB 4ED9A 1CX9B 4KVAA 1WDMA 5LMZA 3VR6H 1VHQA 4L02A 1PR3A 3GMTA 4X61A 1NBIA 2VFAA 2XUJA 5FH9A 3DBLA 1EM8A 5I7UA 4DR2B 4ND7A 3PU6A 4AW9A 2O3UA 2GDYA 4PFSA 5EUBA 4A03A 2XDQA 2NV2B 1RRMA 4F5YA 1VE7A 1SHLA 1MW9X 1R0YA 4YUWA 4DLPA 1FSGA 4Z4GA 1NBMD 3CVOA 2Z4RA 3UK7A 5TVGA 1YR8A 4E88A 4V0QA 4F4DA 2J30A 3RBXA 1RHUA 3TKLA 1DB3A 3KVNA 1QG0A 5EMHA 1I1QB 3IRUA 3CMMA 2JGRA 3N0WA 3HSYA 3DL0A 2WW8A 4Q00A 1B93A 2F3RA 3SHTA 2QN8A 4LRTB 3PI6A 3BXEA 4HLCA 4EYQA 3HKEA 4OQDA 2P67A 4XD2A 3RU3A 1Z7BA 2QOEA 2NUPA 3UXEA 1GPH1 3NEJA 4MCJA 2HMAA 1HDOA 3GT0A 5IHXA 1K4YA 5AOCA 4EQ6B 1PDVA 2NNLD 2WFLA 2N1MA 5AOVA 5AK5A 1GT6A 4IBOA 3F71A 4Z9BA 4FN4A 1H22A 1M5RA 4MR7B 1ZCBA 2BTQA 1T3ZA 3ELYA 3U5ZB 3KT3A 2PZFA 4RABA 4O4IB 1HC7A 4BB6A 2J7KA 4BVJA 5JSZA 5IT9A 1I2ZA 1OAOC 3FPAA 2P1ZA 4LK3A 3V8VA 4ILEA 2CV1A 1NURA 1Y7PA 4Y2YA 5EE9A 2KE5A 5E38A 1U9CA 4BGEA 4ENWA 2PD6A 4M49A 3ULKA 2VJQA 3AVUA 4ARCA 1CG6A 1IBKB 5UKDA 4C7BA 4FFVA 4FONA 4PZLA 3DFFA 3WLJA 2O2ZA 4BFLA 4P0QB 3L77A 4NHEA 2VHUA 4Q18A 2WNSA 1UKVY 2WUVA 4HD8A 4GKVA 3TLKA 3CCMP 1EU1A 5ALKA 1M8KA 1X3SA 3ND8A 1GKUB 5BV7A 4MIYA 3W9UA 5HZHA 5HHTA 2EZTA 4MUNA 4X5OA 5C8YB 1SXIA 1PK8A 1URPA 2QTFA 1W5FA 2VEOA 1ZA1A 2YJTD 1JHAA 1M6YA 4YMSA 1UEJA 3RS9A 2O3QA 3HCWA 3S6JA 2YHUA 1FJ2A 2NTNA 3ZX5A 3TINA 2P2GA 1DBIA 2Y0DA 3BILA 1X9IA 2V9ZA 1LW6E 3IDQA 1FTYA 1P0QA 2BF7A 3DM9B 3OT1B 3PG5A 4PS1A 4L4ZA 4MEBA 4EJ2A 3EWNA 1P9OA 2W8ZA 4AKIA 2FMKA 5COBA 1GV0A 5FP0A 4J7XA 1YTUA 1HL3A 1ZH8A 2N50A 1V3TA 3VR5H 3CRW1 1EFRA 1HX7A 2DERA 2GAJA 3EAQA 4L27A 4Q1EA 1W4ZA 3BWCA 1M8GA 4GVPA 2L0QA 1G7CA 1PDOA 2E82A 4NU6A 2WIJA 4NTZA 4PZPA 3ETJA 2IW3A 4YJDA 5I9BA 1LLFA 2F17A 3N39C 2AMLA 1BKDR 5GONA 5AESA 1KYTA 4CM4A 2HBQA 4GYJA 1RLIA 5FOTA 1IPFA 3IVXA 2AOUA 5K4AA 1TYEB 2C0CA 5LP6B 2VA8A 1UDCA 4PO3X 4Y0VA 1WZEA 4ZYZA 2QVBA 3ICOA 3K92A 1TM4E 3PPVA 3TH5A 2H08A 4M0LA 4XKJA 421PA 1AF4A 1M2GA 3AR6A 1L4GA 1SIUA 3D2CA 4F6CA 1DVRA 3H4TA 3JRNA 4NAVA 5TMPA 1NMXA 3EPKA 4UHJA 2QXTA 2I5PO 1Z73A 2XUOA 1IRIA 3LKDA 5IHPA 2YFHA 3OQBA 1Q7GA 3KSUA 4PNEA 5DN6A 3TCKA 2CNWA 1M6VB 4FIZA 4G23A 2PO7A 1Q5PA 3MC1A 3PFCA 5CD9A 4V0OA 5HCIA 3FCOA 2BI8A 1M1ZA 4Q4JA 1AKVA 2V5UA 2JAWA 3DS3A 5KKAA 3KWLA 2W6PA 3AHEA 5JAOA 2QORA 2NM0A 3AEQA 3GGCA 2GPAA 2QUZA 1R16A 4GOXA 1NRWA 4QU0A 4UM9B 4KAFA 4ZI2A 1C7ZA 4WBXC 2VDMB 2FKAA 1G3RA 2OV8A 1XCLA 2JLZA 4FFSA 1CZHA 1DT5A 4A0GA 1XZBA 4HGOA 2AEEA 3Q3VA 4ND6A 1PFVA 2XV1A 1A7UA 3Q3JB 1XLUA 3GAAA 4Z9FA 2FAXA 3E7FA 4Q05A 4TTRA 5FLEX 4EW3A 2HCTA 3WAKA 4BMOB 3SDSA 1SWVA 4BIMA 4DR7B 3HHEA 3I6MA 2K0XA 3ZVLA 4DBLC 2UUBB 1A9ZA 3BYZA 3ER6A 4C4AA 3EPLA 3CPHA 1FOEB 1PR9A 1RWVA 1UKZA 1R27A 2J3IA 2JNWA 3G2JA 3HL4A 1UFQA 1V9SA 2VK1A 2P79A 2W9XA 3MQFA 2P2NA 3DLPX 1FQKA 4CM6A 2PUAA 3VXKA 3DB2A 4GUDA 3CUWA 1IVYA 2B4AA 2SCUA 4MI6A 4DMCA 2SKCA 1U4OA 4TT8A 3VPHA 4GRAA 3O73A 4RLQA 5JZ9A 4IJ5A 4JXJA 2LIPA 2VG8A 2W43A 2WHRA 2NO1A 3KJGA 4XR9A 2VF4X 1GGFA 4XM2A 3VYVA 4ZOQI 4YUAA 5HOEA 3V8QA 1XRSB 4HX2A 3H1GA 1PGQA 3ETHA 3O3CA 3CCJP 1CU1A 3RC8A 3A36A 4EYGA 2GCGA 3HY4A 4U2FA 3KKKA 2DECA 2V0NA 2FEAA 1OH8A 5EWLA 2N98A 2QW1A 3PGVA 3AUYA 4TM7A 3WBBA 2H1WA 2NZJA 1D09A 3PDIA 3B2NA 1JLRA 2Q3BA 1U94A 2BM0A 4F2PA 4FZ3A 3DD5A 1EVIA 3FGNA 1XZIA 5HRCA 3ZI4A 2CJWB 1P1IA 3IUMA 4BFXA 3IBFA 3AL2A 3D4PA 2H4JA 4V0KA 2Q28A 2VHXA 2HT1A 1XQ9A 2ZXFA 5GGXA 4G1MB 1E0SA 1DKNA 2JI6A 3WWZA 3UYLA 4OLBA 3QX7A 2Y93A 2DHCA 1KEUA 1AV7A 3WL3A 4EHFA 2VDRB 5IARA 5BV8A 2GVNA 4A92A 4GI5A 2JF0A 3EPHA 1R50A 5L3SA 4Q7KA 1TXGA 4YRKA 4IIJF 2ARKA 4GKAA 1AGYA 3P0RA 1JA0A 5I8ZA 2P9GA 4JYCA 1A2BA 1RRFA 2OBLA 2QAGB 5DV9A 2CNRA 1X1SA 3JYQA 3DH0A 3R0ZA 2X8BA 4LGCA 1T3LA 2FJUA 1Z12A 3T9BA 5CDSA 2A5JA 1F8FA 2Q3DA 3G85A 5BNIA 4EG0A 3ZEIA 2ZFUA 1Q44A 4R69A 3VSDA 1QUEA 2YFKA 4U6QA 4XUCA 2DBYA 1QPGA 4WCVA 3ZWMA 1Y3IA 4JJZA 2FQWA 2I2FA 2FVXA 4G5YA 2XUHA 4K9QA 4TX1A 5ERYA 1YF3A 3WIBA 2BFCA 2PGIA 4YIKA 1O94A 1QNFA 2HTFA 2GXAA 3VU9A 1HORA 4NJEA 5FO0A 3CF4G 1KR5A 4LGVA 4KN6A 4LJ6A 4D9HA 3PEYA 2AKYA 1EVKA 2UXCB 2J87A 3Q2IA 1AUOA 4NV0A 1ULHA 4OK5A 3IP9A 3FVWA 5IJ9B 4EHKA 1OC4A 3DTNA 3NBKA 4CMIB 5BR8B 2Z8XA 5AHOA 4QUEA 4AQYB 1P9RA 4EGJA 5EIEA 1EJ2A 1HV8A 1L4HA 4GR4A 2R1UA 3UQYS 1R9NA 3ZHZA 1IXSB 4AJ1A 5HM6A 1M74A 1Z5GA 1ZSNA 1BJKA 2QK4A 1RJ9A 5IBRA 4J2TA 1PQUA 3W9BA 1YONA 2GZ3A 4JLNA 5F1OA 5IFKA 4LNHA 2Y05A 1Z07A 4RETA 1KDYA 2H65A 3R5XA 3EEYA 4G86A 5FEMA 4IUBS 4KUHA 3HWX1 4LISA 1KVSA 1Q74A 4DJDC 4YAGA 1QVAA 1PYGA 3E6AA 1GFZA 2LE0A 4FFLA 3T94A 4HG2A 2YV3A 1T4DA 4NYIQ 2P3OA 1WXWA 2M1ZA 1KC3A 3P2JA 4P36A 3BKXA 3UGTA 2O5CA 2AIRA 1CETA 1IZZA 4KIJA 1P19A 4MCHA 3P5SA 2WJAA 4X64B 4YBZA 1UOQA 1H2YA 2B5WA 3ONVA 3WBJA 5I4BA 5DH9A 1V7QA 2DUNA 4ETWA 5EZYB 3UJDA 3A31A 3I52A 2GHIA 2QGNA 2PU7A 3I01M 4WKPA 3ICQB 2FFJA 3L6RA 1VJGA 2VUUA 2WWIA 4C0AC 4FMBB 1V8DA 1P31A 1WVGA 5CA0B 3MB5A 1Z4PX 2FK8A 2XNKA 3IAS1 4AULA 4FHEA 4ESHA 2BEWB 2E1MA 2DSNA 2OG2A 6REQA 1KVTA 3NFYA 5LR6A 4JLSA 2QT9A 3QF4B 1DCFA 2NVUB 4JBIA 2HYIC 1UODA 3OZAA 2VI5A 4B6EA 2QTLA 3IMCA 4FOPA 5DXJA 3TOVA 3TQCA 3BRWD 2CLSA 5CBPA 1K7SN 2X40A 2B98A 3MRTA 4U7GA 1C2TA 5EYPA 4ZIRA 5JV5A 2DFNA 3CRVA 1P9LA 5JIBA 1W9HA 4B4OA 3KJFA 1U7TA 2DZDA 3CLRC 3DZHA 3PUWA 1MV5A 5E7IA 2YH2A 5EZQA 5G40A 2W6ZA 3RJMA 6ABPA 3NTLA 1P80A 4CEIA 3OUUA 4F06A 4V0ME 1TYZA 1E6WA 3O3OB 3PD0A 4LRQA 1MT3A 1MTZA 1Q0HA 7YASA 4C7OB 3OY2A 1VI6A 4YQEA 3PNLA 5CK5A 3EVBA 2O9JA 3F7TA 2FETA 4PLYA 4PE5B 2O4UX 2NXEA 2X41A 4AKTA 2IX9A 2PRKA 3GOHA 2WMYA 3BE6A 1ID8A 5IJZA 3DCNA 1YR6A 2RHWA 5T4BA 1Z3CA 2IWRA 3OCWA 5K09A 1Y8CA 1IY0A 2HU7A 4LY0A 2XCIA 1CD5A 3LE8A 4UJ5A 5DDIP 1LK7A 2ZRGA 5DIFA 2FPGB 2QX4A 4MQEA 2GPWA 2Q0XA 4RVNA 1BHO1 4EO7A 2NYAA 4DR1B 4MMYB 1JVBA 1Z6YA 5AXAA 5I4TG 4PEVA 4CUJA 3WKDA 3OETA 3SU8A 4UUAA 2GM3A 1WBJB 2IU0A 1II0A 4B4VA 3HFGA 1B8VA 4OK3A 5B2ZA 2XMQA 1BGXT 2ZRPA 1IULA 2C2KA 1DWOA 3DO5A 5F2EA 4LZJA 4XUEA 3SP1A 4LZLA 4EB6B 4KQXA 5H8WA 3QFHA 2H54A 4G0PA 1MA0A 2JGPA 2HBRA 4EJSC 3TKYA 5HNKA 2IBSA 4O4IF 4UBOA 2POCA 1J49A 4TWRA 5JAZA 1JPUA 5IEBA 4MTLA 3CB2A 4RK4A 2H5IA 4FGSA 4LJKA 3KEMA 5BSEA 5ITSA 1M6NA 2RK3A 3F9IA 3U0BA 5GJCA 2CLMB 2PIDA 3OPYB 4XGIA 3SZLA 2XCTB 4QHYA 4A8JB 5THQA 1U2PA 1N2CA 2ODNA 1RXYA 2C3PA 4MKHA 5L8VA 3LNTA 4QVIA 1SQSA 1RP1A 2F9MA 1EVYA 4DQXA 3IT3A 4IRUB 4ZARA 3V33A 1KI6A 3HN7A 3NHBA 3VOSA 1WULS 4ZI7B 3IALA 2CB0A 2ZTLA 2FPIA 2D0IA 1F2DA 2AW3A 3JQCA 3QEAZ 5C8YF 2GMWA 2P4EA 2N9UA 1J42A 3F4KA 1ZM2A 3AF1A 1QDEA 3UK0A 2BMJA 5KWVA 2ZCJA 1W4AA 1EVQA 4AWXA 4ETNA 1IATA 4HHEA 3SBEA 1ZOLA 3BWMA 4YTEA 4ZJYA 2K94A 1CW2B 3C41J 1ZRMA 4WNCA 3WAGA 3PB3A 1RXUA 3BIOA 4S35A 3O2QB 4JYAB 3QYAA 4JGGA 3QWAA 1X15A 4I5IA 3VH1A 3HUTA 4DEXA 4WKGA 1F8GA 2IH2A 4H1WA 3T3HA 4C0JA 1YNOA 2VWQA 4G89A 2C03A 3FTNA 1ECLA 1ZGCA 2AFIE 2CFRA 3JQPA 4FYXA 1VFNA 3PEEA 1T8UA 1FYXA 4R8VA 2V54A 4ND3A 3W2IA 3FRIA 4CHGA 1ZEMA 1RI2A 1G0OA 3FPHA 4FBMA 5CPBA 3I9LA 2EEPA 3UUGA 4DV4B 4RQAA 5K0NA 4B7UA 2ZBGA 4N5MA 1B16A 3GNLA 3JARB 3L6CA 4L4RA 4ZKEA 2OFFA 3V46A 4CT4B 3C15C 5LP6F 3D4OA 3VR3A 1KRXA 3Q7RA 1VSUA 3TLAA 4IDDA 3ZWCA 3N28A 2N0SA 2HAEA 1Z06A 4BFSA 5ALSA 1KYIA 2J3EA 4TQ9A 2JC3A 2V7PA 2QSUA 2EIHA 3C2QA 3SF8B 3TQHA 1RAIA 3GFPA 1AD2A 2PX6A 4R68A 3V7WA 2X5XA 1K3UB 1TZMA 4LOHA 4DCMA 4QODA 4U02A 1DDIA 3TR5A 3O75A 4DM4A 3UMSA 2JIPA 4G63A 3UMYA 4IHJA 3CZ9A 3GWZA 3QVTA 2V98A 5BS2A 5CH5A 4DM7A 4OX9Y 3OQ1A 2QMYA 2HLHA 3B5JA 4G1EB 4K2AA 2FAEA 3RBZA 2B1JA 2VHCA 3SHFA 4D79A 1PV4A 5HTOA 1HA3A 3T41A 2R6HA 2MMCA 1GQSA 2W5UA 2X8JB 3VU3A 1DBWA 1WD5A 1FBTA 1P2SA 2EGGA 2H0AA 3BOSA 3GVCA 2FPPB 3HCBA 3KZ1E 1SUFA 1PWXA 1T9CA 2DT5A 4J0KA 4LHVA 3H4MA 4M55A 5LBUA 2BEKA 4MX8A 3SYMA 2EBHX 3A8TA 4YAIA 2CXOA 2QE7A 3OEHD 1KEVA 3KOUA 1USVA 2WYVA 2W11A 1SU4A 3QIAA 5K0GA 3WK8A 5TE9A 5CT8A 5BO5A 3ELWA 1OIXA 4DZZA 3MSCA 3H11A 2PG3A 3N2NA 3IPCA 3JAKB 5KHLB 1BC5A 2J33A 1CY6A 1KK1A 1NZJA 5JYDA 4N9QA 2Q4DA 1TPYA 4GOOD 4KWIA 1GXSB 1TKRA 3EIOA 2Q1UA 1UOOA 2GXUA 3BMOA 2Q8PA 1YB7A 5DCLA 2QD2A 4IG9A 4HVTA 3GLHB 1GCOA 4YB8A 4D2IA 3A14A 4DYVA 3R3YA 5L9AA 1H6DA 1ZJJA 4BN4A 5I5EA 3W2HA 4WYMA 3F6CA 4URYR 1JJAA 1YITP 1J9ZA 3C6BA 1UAGA 2V6FA 3A3OA 3KJIA 4ND8B 3R24A 4QGAA 1SXJC 3LQ2A 3ZBQA 2HV8A 3ASUA 4NNJA 1YE8A 1RPTA 2VXCA 2QRVA 4FFBA 3RJZA 1JTVA 2C3UA 3R3WA 4F4CA 3T1YB 3W0LB 4HUQA 4WA8A 2FWBA 3THWA 1HZJA 4MUAA 4QYXA 3H05A 4G0YA 5F7ZA 3F2VA 1HE5A 1QHIA 1UPXA 1PGJA 1G1AA 1ZN8A 4PTLA 5EQJB 1GPAA 3NOVA 1W1WA 1N4DA 4UEKA 1F2VA 2GBGA 4YCLA 3SX4A 1FU4A 3DPSA 1KZ1A 2IUFA 3OWHA 3G0CA 5DGDA 3I6BA 5K45A 4D82A 5E6RB 1JDPA 1XFDA 3AESB 1LB1B 3L2OB 3VNVA 1GSOA 1NDQA 1DIGA 1C5KA 4S1TA 1ZISA 2KBFA 1NVMB 4RK0A 4PLVA 3WK6A 3TW0A 4RF3A 1Q1NA 1UMDA 3VNBA 4H3SA 2VZ8A 1K8YB 4KQFA 3TIGA 3MJCA 4MGZR 2YVLA 3T9EA 1MRSA 2XKAA 1V45E 1W5BA 1J0BA 1FC0A 5BNWA 2LDXA 3OLWA 4RXTA 4F8EA 5JNSA 5FTJA 2NGRA 2KB0A 3BFVA 1JH9A 3LX6A 2Q2NA 5KSYA 3NGMA 2B6NA 3WA6A 2IH4A 3KU1A 3A9UA 4YMLA 1FRQA 4QUAA 5DO9A 1I7NA 3QPUA 3BRQA 4IWXA 4EZEA 3Q40A 1NYLA 4Q6BA 4FSXA 1C1XB 1XYVA 1P2GA 1E1KA 5AJVB 4UAVA 1MMFB 5IAKA 2GKSA 1YS7A 3R3JA 4H59A 3FN4A 4DG9A 2FACA 4HQKA 4B75A 2RD2A 1QR6A 3O8QA 2PEIA 3O7WA 2GPNA 4LX8A 3BX1A 3I45A 3KOWA 2EFJA 3DYVA 4R84A 1R6DA 2D1YA 1Q82Q 1T5LA 2Q9AA 3A4MA 3GZJA 2ON6A 3LWDA 1JAYA 5G4LA 4UOZA 3M33A 2JPDA 3NS7A 1UKAA 3CRRA 2VT2A 1K7YA 4MVJA 4N4AA 3LU1A 2V1UA 4P32A 3L01A 1IRXA 5H82A 2VHJA 3O8RA 3D5EA 1ZJZA 3IAEA 3MCZA 2ONCA 3NHWA 1NR5A 2NVWA 2XUKA 4Y6RA 4Z9XA 1TLFA 2DUJA 2EARA 2GTHA 3OSUA 1GZ5A 2AJBA 4HCJA 1OZHA 4RMGA 3U3KA 2ZIZA 3AETA 5FWYB 5HK8A 1QYDA 2ERCA 4I5FA 4A3SA 3QKWA 1Y7LA 2BH2A 5DWVA 5AJXA 3D1VA 3ZE1B 1H2EA 1PJTA 3UWPA 2QSJA 1DZIA 1ZD4A 2IIBA 2XMRA 2ZI9A 1AXRA 3DOIA 3GDFA 1K7CA 3LPNA 4IV0A 5FUQA 1IVSA 4Z53A 3DHYA 2FQ2A 1C3OA 5LKAA 3ECCA 3NX4A 4TTAA 3TZHA 2B8EA 5L7YA 4YRGA 3GRPA 1Y8AA 1ZQ1A 1GG5A 3D2BA 3F5DA 1YI0A 3GLGA 2GB4A 2IOYA 3Q7SA 2AF8A 1G63A 1P7WA 4ZZ0A 1VL0A 2SKEA 2HRRA 3T3EA 3N8KA 5D7NA 4ZQGA 2R1TB 4LPKA 4DNQA 3ROTA 3NRCA 5HS4A 3LC0A 3R40A 2LOLA 1MC4A 1IJKA 3PQ3A 4GE3A 2XDQB 3LVBA 4IIUA 1PGPA 3HZHA 3FMGA 3N8GA 4R2KA 5FOVA 3DMYA 4KOEC 4A5SA 5KSZA 3TSOA 4ER3A 2FG6C 1AGRA 3PJDA 2ORYA 1M2WA 4XD7A 1HT0A 4E13A 1Q19A 4TSKA 5F1KA 1J7KA 3CRNA 4IF6A 4U39A 4W5RA 3G7UA 2JHFA 4M3NA 4C3OB 1ZK3A 1K5HA 1O6BA 4QNBA 2JLSA 2YWEA 3QI7A 4XIIA 3SE0A 4AS3A 3Q1KA 3C6QA 4ISBA 4D57A 3BXXA 3SC4A 4TMYA 4DA4A 1LA2A 2P0AA 1S3SA 5AFSA 4GL2A 2D5IA 3QRWA 4FQ5A 3RC3A 3L46A 1KSFX 2H1LA 3DCJA 2ZAOA 5HJ7A 1T36A 4FW9A 1TRKA 4LQ4A 4E1AA 3HKEB 5C3MA 5CA1B 3VBEA 1S4MA 4JSRA 2X0RA 1QZTA 3G9UA 2DNWA 2O1EA 4MUKA 3E1GA 2G7ZA 4H35A 5I4IA 2HD4A 1S89A 5M7EA 3PC8A 2NTYC 3K9BA 3QEKA 3HUUA 3LOUA 3ZE6A 1A97A 2PX8A 4QBFA 4IDCA 3TPCA 1U7OA 1M1YE 2JLWA 3HLTA 1KFEB 4R1MA 4XDZA 4ZCRA 3UJPA 4QEKA 2OBNA 3CKYA 1YD7A 3GBPA 5JSZB 5J2TA 2NSHA 3KT0A 5AI8A 1GZ7A 5FJIA 4YPOA 1X8JA 2J5BA 4WD3A 1OA0A 2YV1A 3I1IA 5AKIA 3ILSA 1O9GA 1LDBA 1JE0A 3LNCA 3PKIA 4MW4A 3TZKA 2FDRA 1WPXA 2I4RA 1JMKC 3UUFA 5ED4A 1TM3E 2UUPA 4D0RA 2GA8A 4QLBA 4PPQA 4IXWA 1XEWY 1MB9A 3PIRA 4FK8A 3A1TA 1NVVR 5HKOA 2IOQA 5JT1A 5WRFA 2Q8QA 3L49A 3AV0B 3EIUA 3AFMA 3BDVA 3AO0B 2QT1A 1NVKA 2R3SA 4ESVA 2X0KA 1I01A 1YR2A 3CN9A 5IC5A 5TR9A 3JQDA 3UB3A 8AT1A 1TGYA 1QC5B 4DCCA 5HQ3A 5IW8A 4DKJA 1YJQA 2L22A 3HCAA 2CG5B 1LY1A 2GN0A 3BJRA 4B6SA 4BNLA 2D0PB 3EY9A 3OPQA 5JCOA 2NPFA 1IB0A 3DMFA 2IIQA 1E4EA 3AUFA 1SXQA 5FTNA 5JE8A 2LZ0A 4UBKA 3MCTA 4CBVA 4UMFA 1E2DA 1X19A 3RTBA 4BO7A 7MDHA 2RFLA 2JGJA 2PUBA 1RHKA 1XDSA 4G4SP 1Y5IA 2O59A 3A3KA 2NU6B 1DJLA 4IMJB 4DLXA 3BFJA 5CZDB 1DJPA 1R6TA 3GT4A 5CDYA 2GDZA 1K7EB 2F90A 4G37A 5C4GB 2XQKA 2FQ0A 2R47A 1FF9A 3UAYA 1EFLA 4LYYA 2E85A 3OKPA 4DJAA 4O29A 3ZD8A 1S2IA 1F12A 1KGDA 1XP5A 4JHLA 4KPUA 4YQZA 2IYEA 3K4QA 2PZEA 1QIIA 4CF5A 4B43A 4ZVSA 1HQYE 4CM4B 4JYZA 4K86A 1SXJE 3ST7A 3CFYA 5DBEX 5TXGA 4Y2SA 1P0PA 3PT9A 3I9FA 4DA0A 1P4RA 5JTUA 1QSGA 1N6LA 4J90A 4BXOB 2VYCA 3LPLA 4W9NC 5CGQB 4G6ZA 4J49A 3WK5A 1PJRA 1ZG3A 4JH0A 3A9RA 4AO8A 2O3JA 4IVNA 2PXHA 3KJZA 2E7ZA 4PYRA 1QHGA 2Q6TA 2NOAA 2YJ4A 2Z3WA 1JAHA 2WM2A 3JQRA 3OHSX 4IQ0A 5CXQA 4KLZA 4NARA 5E1DA 2B9VA 4OFWA 4OYHA 3HB0A 2XZLA 1VP9A 4ZI7F 1XZKA 1XRNA 2BHTA 2CJPA 4X9XA 2N6YA 3ZNPA 4K9KA 2Y99A 3KQWA 1EP3B 1MAWA 2BM8A 3JWHA 2C2WA 3QU5A 4LE2A 2G5CA 2KGCA 3UQZA 4IG4A 4IUDS 3QKTA 3VU8A 3G28A 3G0BA 4Q4JB 1ZOOA 4C2UA 2DHRA 3EGIA 1P5ZB 4U7TB 3LYUA 4FE7A 4XA8A 4BJHB 3DAYA 4MJLA 3RG2A 1OXKB 3LX4A 3FHJA 3QVGB 1IY1A 4FKMA 1QCCA 5JS8A 1N6KA 2QLBA 2ZRHA 4JI7B 1DC3A 2AJLI 1Z7GA 2FW8A 3IDSA 4NFLA 2AA3A 2W2KA 1DAOA 1NP6A 3LC2O 3PT5A 4HNQA 3BFXA 1JUDA 4HRYA 5EEHA 2OCKA 4RJLA 3M3PA 4B84A 2QRKA 3CLRD 5A9SB 1YNSA 3BQMB 4RY0A 4S1WA 5FBHA 1FVFA 2V7XA 1T34A 2EXXA 1G5IA 2ILVA 3QW2A 1NTRA 5A7HA 2NX2A 3ZXYA 4DREA 2YMQA 2B3DA 1GRVA 5AHWA 1BCRA 2WSSA 4QRHA 1K9MQ 3TR0A 4URXR 4YC7A 4HWKA 2GYWA 4L0DA 3JAWB 1DIAA 3LDHA 3PFIA 1EFDN 3QPDA 1MVNA 4IXDA 4PANA 5CLQA 5DRTA 4GR5A 1XQ1A 5E6SA 4ZVVA 1RKUA 3BD9A 3IAM1 3ABSB 4GAEA 1S2GA 5DW3A 2CXHA 1X0VA 2SCUB 4B3IA 1JFFA 2V03A 4DJEC 1WMDA 3KKQA 4JT8A 2WG2A 5G0UA 3CJQA 5B4VA 4Q9HA 4DLTA 1C7JA 1O03A 3HABA 4GBED 4X0EA 4EY8A 2YV2A 4KW7A 1PFKA 2Q6VA 2WJYA 4OUKX 4CLDA 4D0SA 4ROTA 2FN4A 3SQNA 4DNOA 4DDTA 2EQBA 4KR0A 2GR9A 1JJ2O 3ZZUA 3L7CA 5KKCA 1MB2A 2ADMA 2BCEA 1P7VA 5BN3A 1E63A 3V1YA 3NG1A 1Y5RA 2XSZA 3T38A 3WGGA 3N8NA 1RS0A 1VJDA 3RPEA 3ASZA 1ORDA 1ZOPA 1EZ4A 1OZFA 4L9AA 2GCNA 2JH9A 4YRSA 1VLQA 4C4OA 3AI1A 4Q3AA 1OMOA 4RD2A 3NBYC 1KI2A 1KJ8A 1T1JA 4CV3A 3AT1A 1AMOA 4OQZA 1I6LA 2PSDA 3DAHA 3EEQA 3CWZA 4UEQA 1KOLA 4L0CA 3H6GA 3QU7A 1VHNA 1UXIA 1VB3A 4KQMA 4HWOA 3H2SA 1R9GA 3DS8A 2XZDA 1MIHA 3GT7A 5CLHA 1TM7E 2VRNA 5CLGA 3WHIA 2CXXA 4NCXA 1L8QA 3H1TA 2WWVD 4YUZA 1JXMA 2BFMA 2HNBA 3A26A 3GA0A 4RS4A 1Z5PA 1ZVVA 5L3SB 1E9SA 2B9EA 1QYVA 1X92A 2WDPA 1QQBA 2JCBA 3RRBA 1U8ZA 1X0XA 2IYAA 3VAYA 4KQ2A 4MWOA 2G3YA 1BTOA 1WEKA 1ZBDA 2D1RA 2FW6A 2HMWA 3E3AA 3HUEA 4KE9A 4X7BA 4BNKA 3N2LA 2C7BA 4QTYA 1GZ4A 5IYZA 3LK7A 5EWJA 1I4OA 1JV2B 2BHNA 2PEKA 4HAZA 4IIHA 5B1IA 1U99A 4RZ3A 1CUJA 1Q1BA 2G6BA 3SVZA 1U0RA 2VHVA 1KS2A 4IJWA 4LJAA 4DLWA 1XAHA 1EWVA 2KOOA 1QGUA 2IS2A 4V0NA 1PTJC 4AD8A 3E9MA 4L9WA 5TGZA 3V9AA 4YRZA 5JLAA 2XRZA 2AJ8A 2DWUA 2JJYA 2KWIA 1UC9A 3BXGA 4NJEB 4RE6A 4XFKA 4AFNA 2DPMA 4CUZA 1SKYB 1E99A 1V26A 4AJ9A 4HDCA 3V34A 1P6XA 1E6MA 4KQ6A 2VTVA 3QVWA 2UVPA 1CEYA 1Y34E 3FOEC 2PMWB 1TU0A 3JD2A 4RTMA 3I4FA 1XP8A 3TQTA 2FLWA 4TYYA 3CR8A 3ZI7A 1QPBA 1XVTA 3AHGA 4WXHA 1JEOA 3T6KA 1JS1X 3BERA 4S1NA 2QTTA 3HM9A 1QH9A 1LD3A 1V48A 2O52A 1W5TA 3ZE2B 4BLPA 1D2EA 1UP4A 2V1XA 5CFQA 1HNWB 4MW0A 2VBIA 2FYTA 5BSRA 3T7JA 1TAGA 1DKRA 4F4UA 4Y3UA 4OEHA 2CT8A 3GUHA 3IC5A 3B6ZA 4I3FA 1FYFA 1IC6A 3ME5A 2WLSA 3PNMA 1CRLA 4KYTA 1WKVA 2EJUA 4X62B 1SK9A 2OD9A 1JVSA 2X4IA 9ATCA 4P8RA 4XGRA 1R8YA 1RQXA 4Z54A 1LV8A 3VKWA 1MZVA 2X76A 2VDKB 3IDFA 1E1DA 3PPXA 5CX1A 2YHBA 2I8LA 2JEZA 5BW6B 2ZWOA 3D64A 3TZ6A 10MHA 4DQDA 5B58C 3AXSA 4LTMA 1SU8A 3IXLA 4RO0A 2QPLA 1ST2A 5JNRA 3GJ8A 1CFJA 3NOQA 1QH8B 4MJ3A 3AVQA 1N0VC 5ALRA 4AZ3A 1T8SA 3BL5A 5JAHA 5JAMA 4O3MA 4TWIA 6REQB 5TNXA 1PCXA 3D81A 4NDZA 4WXPA 1UT6A 2BGIA 5M3BA 2WPDD 3DKIA 3FDZB 5MN4A 1S8OA 5ULLA 2FWNA 2VK4A 3VKHA 3PEFA 4RSRA 1LK0A 3I1YA 1RVV1 1CT9A 3B3JA 4GOLD 1W0KD 5KTOA 1YE3A 3WOVA 5K3OA 3QLEA 1BEEA 2BSXA 1Z0JA 2XCUA 3IV6A 1XEFA 4LYHA 2FWPA 3RLFA 3DF7A 3QEJA 4O1MA 2WWGA 4XAQA 4OP1A 3LH5A 5KQMA 1NP3A 1RYYA 2X1MA 3FYUC 1OZ0A 5KYYA 3OAAD 5A62A 3ANNA 4HYEA 1EWTA 5BN5B 3FNGA 3JX9A 4IF4A 4RHEA 4DDHA 3MTJA 4IVPA 2ROQA 3VNUA 2JIQA 2PKRA 4LHXA 3LXRA 4U7PB 5FUWA 2UUCB 4AY6A 2IZ1A 3BIFA 4X93A 4RSMA 5AVQA 4KE6A 2I62A 4OVKA 5HGJA 3I5MA 4CCSA 3AOEA 3EA4A 1PS8A 2GK3A 3CEJA 4WV3A 2AOVA 4MQEB 1UKCA 4IJKA 3U56A 2HN9A 5TX7A 2IPOA 2OHFA 4GSKA 4PCVA 4X20A 2EP7A 2WAYA 2J3KA 2ZIAA 4L9SA 3T3PB 1L8AA 5B7PA 4RDCA 1SKBA 3H6KA 1KYYA 3AKCA 4JNCA 3QUCA 5G2OA 3QQ5A 4OGWA 1AZTA 3DLIA 4W7HA 3VPCA 3WMEA 2NP6A 2IXBA 1AKYA 1RI4A 1A7AA 2X22A 3NDRA 4UM8B 3W8RA 4I99A 2ASEA 4IMRA 4HDRB 1PJ2A 3IUYA 3PFHA 5FA5A 3TEJA 3UK2A 2XWBF 3AG6A 4Q7JB 3P45A 4HDMA 4WNAB 2ZXUA 3UJ6A 4B73A 3NEPX 4I4IA 5FORA 3U17A 4HB2A 1VFPA 1QVFO 1WOMA 1T8PA 3NT2A 4COOA 2YY5A 1EBBA 3DTTA 2D1TA 2PEZA 1OLUB 2AZ4A 4J7UA 4PO8A 3HFRA 4C05A 5BR4A 2CV0A 3ETGA 3TM5A 1ZSYA 3PXUA 2COUA 2JFOA 3EARA 1T1RA 5IUNC 2P4SA 2PKWA 1O95A 2OPHA 3U0VA 3TUJC 1NZFA 1PWZA 2Y1FA 3IQIX 4YECA 4QDZA 2AN4A 1N2CB 1F0NA 5D86A 3TE7A 1ORHA 3FM9A 4ZCSA 1FX1A 3OLYA 3DBHA 3WE7A 2PUDA 1ECPA 3VKUA 4D3DA 1E0HA 4E6EA 1KI6B 3BMNB 3L84A 5JHGB 3ZJ4A 1Y3DE 5SY4A 5BOSB 2FCAA 2WP0A 1Q7EA 1WSDA 2PANA 2QWXA 2C98A 3ZHYA 1NC3A 3FNRA 2WWRA 4OFBA 5HDQA 3R5KA 3TZEA 3TS1A 3H8WA 5AKZA 3RNLA 4UDNA 1JQJC 2E4WA 3KZNA 2AH5A 4DY6A 1M6HA 2H1CA 2Y6VA 1X8KA 1GCGA 2JCSA 3JRWA 2AUTA 3A9VA 3OPVA 3NO4A 3UTCA 2XB6A 4EM6A 5DK4A 2KOSA 1ZXXA 3MTBA 3WB9A 3DHWC 1W75A 1QO0A 3MN1A 3OOYA 2Z3ZA 3Q0IA 5H02A 3U4DA 2E5LB 3QUSA 1FDRA 3WL6A 4Y2JA 1HNZB 1H66A 1BX3A 2YZ7A 5TF4A 4IQFA 4JLAA 4F86A 4DLNA 3G0DA 4UBIA 5IC4A 2A59A 5EKSA 4AZWA 3CNBA 2FR8C 1O5IA 2CYCA 2F8LA 2FN8A 2P5SA 2Q3JA 3DOCA 2VCYA 2WYWA 4MKZA 4TXMA 3ASVA 1OHHD 2BGMA 1M1KQ 16PKA 1GA6A 4L28A 4K9OA 1AQNA 1Z75A 3AUTA 2ZRNA 5AVWA 2NMVA 4Z1OA 3QV1A 2I9KA 2AKAB 2HQRA 3JYHA 3OLXA 4R01A 1GPMA 2BGNA 3IOEA 2IEIA 2P2SA 1WCXA 2Z6AA 1CULC 3OE1A 4M8KA 3KK0A 3PDJA 3FFAA 1OYYA 2P1DA 4G0ZA 4EITA 4TMVA 4DJFC 1CQXA 3GA7A 3DQPA 3O92A 4S1PA 5I6DA 1I6KA 1HDCA 1G21E 2HMYB 3AEXA 1Y9JA 4B83A 4EBFA 2MCFA 1TUEA 2BF4A 4DCNA 4UVIA 1P5HA 3HK2A 4Y1RB 1AOXA 3X0DA 2F9LA 3ZYCA 5D5QA 2PEOA 4RGBA 5ARCA 3IUJA 4MCIA 1NFQA 3DBRB 4S1VA 3GB9A 4FYJA 4BPHA 3CV3A 4Q48A 1JI0A 3NHUA 3P05A 3D4LA 3U7HB 3GGDA 4US2R 3MCUA 4PSKA 2IWHA 5JSYA 1YCGA 3NXKA 4NS4A 1C41A 2H16A 2IELA 4A8HA 3O2JA 1V9CA 4NE2A 1QX4A 3RIMA 3W8FA 3HJFA 4IS3A 1ENZA 3TB4A 3OZBA 3P52A 3U80A 4A0HA 1ORTA 3QX8A 1QVVA 2LVBA 1P7PA 1L5YA 1KO5A 3O47A 4CDMA 3U44A 1ISJA 3KLPX 2PEYA 5C7YA 1PNQA 3DD1A 1Z26A 4HEHA 5FWAA 4R4JA 1ZWLA 5KOIA 5LP1A 7REQA 4ER0A 2RIPA 4I5EA 3OMWA 5HF6A 1JQ3A 2HPHA 4LFCB 2FHSC 4AN4A 5TQ2A 3WGTA 4QOJA 2ZRIA 5G0SA 3ZDBA 3WLIA 1SHTX 2VP0A 4MUEA 4NCJA 1P33A 1XMXA 1G66A 1KL7A 3E4DA 3GL9A 1IEXA 1SUPA 1VMIA 2FWJA 2OM2A 4J0HA 1QAMA 2PQ0A 1C3LA 1E3LA 3F9CA 4YROA 3IELA 1YBVA 3U1VA 4YDQA 3QP9A 1KO4A 1E2PA 4J4TA 2Z46A 2YWBA 2HV9A 1FEZA 3F5FA 1L5QA 3G8BA 3N74A 1NOJA 2QTBA 3FRJA 3T5GA 3ZZ1A 1CF2O 4U0CA 1OC2A 4FFBB 2QRVB 3SBDA 3ABRB 5LP6C 2ZVQX 3CNQS 3HU5A 1ZVMA 1L7OA 4HUQB 4RC9A 4AMGA 4BQSA 4LTDA 4Z5XA 1WOYA 1N7GA 3THWB 2H0QA 4M2LA 4NZMA 4TKLA 4RVOA 2IUUA 2WB2A 2R6AA 2JDIA 4KR3A 1CB7A 2HF8A 4KLAA 1Q14A 4ZVKA 5CDUA 5K5EA 1OFTA 4X1YA 4D99A 3T5MA 1WXHA 2E18A 2D7JA 3QELA 3NTEA 1U0HC 1CZLA 1XLVA 5FI5A 3VSAA 1M5UA 4RENA 2ZVJA 4ARAA 3B9BA 3I0ZA 4QBTA 1RWNA 2CYAA 3E22A 1UMDB 3V2UA 2H48A 2JB9A 3OJWA 1ORRA 4KJZA 1D03A 3GD5A 2QUKA 4M1ZA 4F04A 1KI4A 1LC3A 4OQ4A 4BEWA 3QITA 4PM4A 5AUQA 2F4VB 2J0QA 1EI9A 5LIPA 5FPKA 3HBNA 1DNYA 1T0PA 2JKZA 4JI1B 2Z8YM 3LPDA 3V9PA 4HLUC 3EA5A 1H1LA 1M8JA 2H5JA 1II8A 4I1YA 4WCFA 1YC5A 3BJEA 1O8BA 5IMBA 1LS1A 2RAVA 3WWEA 1O6GA 2GZJA 2JA2A 2GYVA 4KZKA 4UAUA 3G5TA 3GLFA 1U1DA 1YZVA 3FBTA 2X6RA 3O8QB 1MJHA 4N8EA 2XMDA 3TD2A 1OX6A 1Q0PA 4MRAA 3WB1A 4G84A 4R8SA 2NVBA 2HEIA 4XSGA 5T57A 3VV2A 3WQQA 2C5LA 3D5TA 1UBFA 2FR1A 2XAUA 4IDOA 1XDBA 1Y1SA 4JK3A 5H3LA 4W7IA 2G9NA 2YWCA 1AS3A 3AEUB 4TLDA 4BP8A 4W7SA 4PH0A 3SLRA 1SQFA 2CFSA 2ZPAA 2H2WA 4C01A 2HA3A 1WSAA 4NPCA 2QRQA 4YP7A 2VSOA 1UK6A 4LKOA 2IQIA 4BO3A 1DWUA 1H93A 5MN6A 2LF4A 5D51S 4Y6SA 1OI3A 2F8TA 1FLNA 4NYJR 1Z7WA 4I5DA 4UQPA 4ZVMA 3M5WA 3RK1A 5U9CA 2IHBA 1QCDA 1W5AA 3GLVA 3RROA 3CLTC 4YAFA 4Z4QA 2O8DB 4C9BA 4NBUA 1G8PA 1STOA 2CQ8A 1C3OB 1G5PA 3OFVA 4MV7A 4CQMB 2B3TA 4XWKA 3A10A 3VZPA 2XE8A 2ZR0A 2PL9A 2EKQA 3DP7A 4DQKA 3I6YA 2JK1A 4F45A 4FD3A 2LBPA 3PQ4A 3A2LA 3ZY2A 3PRJA 3BDAA 2F64A 1CZKA 4YNBA 4B3TB 2P6MA 1ZY2A 3RUCA 5AW0A 2BHVA 2XZ0D 2XV6A 4RZHA 4C0SA 3P0JA 3NGXA 4GZMA 4TWJA 2XCRB 3FB1A 1FUKA 1CTQA 3T52A 4AY4A 3TOZA 3IKLA 1XXHB 4YYZA 1NVDA 1VIMA 2EW2A 3OOJA 2Z08A 2WNIA 3FWPA 5TMEA 4NSNA 1KETA 2C92A 4INAA 4G9BA 3QGMA 3D6JA 4F3RA 2CJYA 3N0RA 1UP7A 3ZQ6A 4LMBA 4DRXB 5BSWA 1B26A 4RD1A 2QAGC 1RKBA 2FFBA 1AH2A 1XPJA 3JD3A 4TSFA 1T36B 2EIAA 5BSTA 2WC1A 4B8ZA 1GYRA 5L3RA 2WJIA 4PZCA 5FBZA 2R2AA 3U3MA 2R6JA 1P8AA 3FYSA 4QL3A 1H1DA 4MPTA 3OHMA 4KHZA 3U4CA 1GU7A 3H5IA 2YNMD 1PZNA 5H81A 1J07A 5ERXA 5F7OA 1KDTA 5EW5E 1J20A 5C80A 3QKSA 4CKZA 4PONA 3RUHA 5JS1A 4ZGGA 5DHAA 1QFMA 3AM1A 5IJ0A 1KO7A 1PS0A 3VFDA 1KPHA 2C94A 3E0QA 4UJ3A 4YJ2B 2YRXA 1KVQA 4JITA 1GLGA 3K0CC 4UCXA 3PZBA 2W42A 1WDWB 3P4YA 3P71T 4RDIA 1UDAA 2H2HA 3HH8A 1MDBA 2WJ4A 2Z5FA 3CZRA 4LE0A 4PX9A 5J59A 3TBKA 1VP3A 2DC1A 2MR6A 4H4EA 3BTSA 4UTXA 3HA5A 5D6NA 1BGWA 4IH1A 3WFJA 1IWOA 1DWQA 2WSBA 4ZCIA 4ZRDA 4RL6A 1YRQA 3PFBA 4MVXA 4UE3S 4BNWA 2WNHA 4ZJZA 5ADWA 1N57A 1VMDA 4TS9A 2OM6A 4EA9A 2WUEA 3NIDB 3DE0X 3SM3A 2XKKA 2Q8NA 1H3NA 4YMWA 2IS6A 2P90A 1ATIA 4NULA 1K6MA 4U0JA 4EY7A 4ER7A 2B1RA 5F9FA 5J63A 1K92A 3F5MA 2RH9B 2YY6A 1U28C 3GEDA 4G4SO 4X7RA 1XTUA 5A4JA 2Q99A 2ALJA 4WRRA 3RC9A 3WXMA 1GVNB 1UUFA 2FWMX 1JG7A 2ORIA 5EAIA 1E4EB 2OAGA 3NTOA 3G1IA 1D0SA 2X9QA 2G36A 3AUAA 4QSHA 2FMTA 1ZWKA 3S7ZA 2CVHA 5L45A 4M4SA 2O1XA 3JYPA 2OHIA 3D0RA 4LI3X 2J7PD 2B8JA 1N5JA 1WY5A 2PRSA 5LCXA 4BNTA 4C7MA 3K2BA 5IU6A 2GXSA 1CQJB 3GLSA 4DA6A 4DVJA 3SQWA 1JR6A 2IP2A 2J8ZA 2Q3MA 2R8BA 3IAUA 1Q15A 2H2DA 3D6UA 3OFND 3S8MA 3HB9A 4JCOA 4OBBA 3WGOA 2HKIA 4KGDA 4C3UA 3GJ3A 2XYGA 2C07A 4RD0A 1R2QA 2FLKA 2HSZA 2OLJA 4X41A 1ZSVA 3SN6A 1U1GA 3MAJA 4BB0A 4H2XC 1OH6A 1I5EA 1GUBA 2DM6A 4YV0A 3E70C 3MXOA 4IDPA 2W6JA 5LLSA 5LJLA 1ZR4A 4UZSA 5LMCA 4Q82A 1W4BA 5DPMA 3W2GA 2QVGA 2OK7A 1N2EA 5DMHA 3LDGA 3SFZA 3ICEA 5JDIC 2XH8A 3GAFA 3CGWA 2ZQ5A 3NLLA 3F7OA 3FI0A 2QR3A 1NKVA 4U2DA 1IY2A 3VM6A 4QEDA 4WN3A 3WDMA 4H7PA 2FVEA 1CY0A 3FLAA 4H0NA 1DADA 1QH1A 4L5CA 3N8IA 4BU1A 3CXRA 5E0KB 5ESRA 4UHFA 4ZRNA 4EHIA 5ALVA 3OX3A 4MLPA 3IS3A 3VO1A 1WP4A 5DYGA 5FL7D 3GW8A 2V5AA 3CO0S 3WBKA 4A23A 1EESA 2FHPA 2FRDC 3PL1A 2IHZA 2Z0MA 1F8XA 1O9HA 2UVQA 4OM8A 1GG8A 3RNOA 2SNIE 3BJZA 5AKGA 4W5TA 2IYSA 1OKKA 3FTQA 3NTVA 2OZEA 3DMDA 3P7MA 4PQEA 5MGBA 2XB2A 4IPYA 2VTDA 4BX8A 5TQ0A 3GPCA 2R8YA 3I5AA 4GR9A 1XHFA 1G19A 4NYMR 1K66A 2BR5A 3DTVD 1IQRA 2O6HA 5FTMA 2FQXA 3VC1A 1B0ZA 4QLOA 1RM5A 1VYHA 3ZU4A 1BCRB 1TJ3A 3AJ9A 3WA7A 1YE5A 2PL3A 1HYBA 2HRCA 2XWJI 2ZRQA 3ZJYA 2J0UB 1SC4A 2XKJE 5CGZA 3W4JA 3LL4A 1K0UA 3L79A 1OXVA 3AF0A 4H3HB 1QVGO 3GZMA 3H0CA 3ZQUA 2ORED 3QOYA 5K9ZA 3FA2A 4NZYA 2W7TA 1JFFB 2XMPA 4NICA 1J8FA 4ARSA 5A5DA 5IXJA 2P6RA 1X7YB 2I9PA 2WIDA 3NPMA 1K9VF 1C7IA 4JB0A 3F3MA 2QDXA 2XHEA 4MWBA 1JSZA 4CM9A 9LDBA 1UL1X 1C8BA 1SULA 3OCJA 3G0VA 1ZNQO 4O8ZA 5JRDS 2ETXA 1XC7A 3ORFA 1AHPA 2V3CC 2AKEA 1M0EA 2JI9A 1ISIA 2ZRBA 2HNKA 3PNPA 4L75A 1T24A 4M0PA 3WTBA 4DYDA 4IHJF 3SQMA 4G81A 4KN8A 3V6MA 1XPRA 5JCJD 3BL6A 1U7PA 4A8JC 2P9XA 1KDOA 5D84A 1LXCA 4H77A 2Q6IA 3G4SP 4GI2A 5AVUA 2CNLA 3F96A 4J29A 2ZBQA 4CIYA 1TIKA 5JPIA 1O0SA 1L5ZA 2PYIA 3HY3A 4DMUB 1C4OA 4G4JA 2G1PA 5DLQC 3MJRA 5BW4A 4DMHA 2BE7A 4JLWA 1E1RD 1IFXA 1JSXA 1OAAA 2BEUA 3A28A 3N3BC 4KGZA 5AJUA 5ALMA 3EIQA 3EMKA 1SCQA 2CHVA 3LCCA 4C43A 3U7GA 1NOIA 5CT6A 4RQUA 4P2GA 4C87A 3ZCVA 2OQVA 3UJ3X 5AW2A 4N41A 3IQHX 5IFLA 3N6RA 4RPKA 3CCEP 4Q3KA 2GH1A 3HZQA 2HGSA 4LJ5A 2QIOA 1NRIA 4A16A 2JJ1D 3EDMA 1B6RA 2NU8A 4PHHA 3RUPA 1SBIA 4NG4A 1R6AA 3RRMA 3WNVA 1CUYA 4D3ZA 2P5YA 2W22A 3CWCA 3JQ8B 2FWAA 4L5JA 2QP4A 4D5GA 1FDSA 3IUSA 1AE1A 1YJBA 1BMFA 1SBYA 3OF5A 2BC9A 4Z7NB 1UZMA 2J6BA 3P9PA 3LT1A 4H7EA 1ADBA 2MJLA 2X6TA 4YGXB 4DUGD 5KBYA 3NRJA 1W85B 1ZIPA 3FHOA 2IXDA 1FDOA 3QTBA 4HWRA 2YWFA 4QJBA 1TJ5A 1PX2A 3AY0A 3AVYA 4ZC1A 3K0AB 1QGUB 3IE0A 3LBFA 1VBKA 1FTGA 3PC3A 5AVKA 4HB3A 4I1RA 1N8TA 2DWOA 2V9PA 3GROA 4V1CA 3AZPA 2H9IA 4CMBA 3RYCA 1KXZA 4C7XA 1JPVA 4BP1A 4KXMA 3SQDA 2P68A 2WVAA 2DXIA 1WBDA 4N54A 1CY2A 4X3OA 1KK2A 3UKDA 2QHXA 3ZIUA 5ITZA 1O4WA 2UVPB 4TTIA 4ZEXA 1NQ5A 1O8CA 4RWZA 2FOIA 3QLTA 4HEQA 1GRQA 5TJHA 4OJQA 4X3CA 3CX6A 3G8AA 2FF5A 1H2WA 3A6KA 1IMJA 1YI2P 1XZMA 1T6ZA 1N25A 4NVRA 4ZQIA 5A1TA 3NAMA 5BMVA 1PJQA 2O7QA 2X8LA 3D9QX 4N18A 5G4KA 2B4RO 4PPFA 2OILA 4DMMA 1ULSA 3S1AA 2OCGA 4OSPA 1OU0A 2G80A 3GGPA 2HUPA 3OFSA 5DCWA 2JHGA 1DTWA 3MWGA 5BNZA 2R8OA 3ND6A 3SQLA 2FDXA 2W8BA 4UNIA 4ZREA 3G6WA 2XHZA 5FLKA 5B3KA 3G59A 2GVDC 3HNRA 1JR3D 1ZCAA 2GHQA 3QWIA 5JWHA 3X44A 1LJLA 4E5VA 2OQIA 1IQPA 4P2BA 3RVOA 3GFGA 2OB2A 4EEZA 5M34A 5HG0A 4Y0NA 1T5DX 2XI4A 4LC0A 1RXSA 4LXQA 1UDBA 3ZHXA 4BMSA 4N7JA 5IAAA 2DQ4A 1VJ1A 1VYVA 3H86A 1FRFS 3DAOA 1Z35A 3AP1A 2FZGA 2VQSA 2DFKB 3UYKA 1BMTA 5LLTA 4G24A 4BEBA 4MVJF 1NVVQ 4QVKA 2AGVA 4EDHA 2PZAA 4L8GA 3UIEA 1ZR2A 4LN1A 3BB3A 1BU8A 1S1MA 4HPXB 6AT1A 3HV2A 1J2YA 1E9CA 2QP9X 3GDWA 2NYVA 3FFTA 1PYOA 5D5PA 1CUHA 4ZXPA 2M6LA 4BV8A 4E94A 4ERXA 3AINA 2CVZA 5AOBA 1G8KA 2DTXA 1AMNA 3K9HA 4G01B 4PC2A 3OOWA 3FTCA 3H83A 3Q8LA 2QJRA 3S5UA 1W87A 1P1KA 1A82A 3C5WP 3ZJUA 1V47A 1DAFA 2RMKA 1A2QA 5CNKA 1W4LA 2KHZA 3TSAA 4QJ3A 3ZE7A 2GEVA 2GBLC 4PIVA 5HUQA 3AJEA 1UMCA 2WWHA 2JGKA 5K3AA 4BNIA 3T4UA 1EEXB 2G9VA 3L6EA 2VSXA 3QY9A 1ORVA 2NT3A 3NWBA 3QLUA 3IR7A 5IJXA 1TK3A 5KYYB 2DETA 3KLBA 4HBZA 4PSDA 5CCXA 1BW9A 3Q6NA 4U2KA 1D0IA 1MHTA 1E8NA 1RIIA 1LK5A 1DXHA 1M76A 5DOVA 2IV3A 1DXOA 1N1GA 1IAQA 2JIZD 2D2EA 2QPTA 1HYEA 2WTBA 2HDNB 3OO1A 3WDSA 1WMEA 4YRAA 1Q1GA 4MEAA 1RC8A 1I51A 2WILA 1E1LA 1TCBA 4HH1A 4NNPA 4Q6WA 1CHNA 3KWFA 5H9VA 4I1OA 4QAQA 4B6RA 4DPLA 1XA0A 3QEMA 5ECDA 3PRKE 3RSHA 2O0HA 2QLFA 1NGSA 5B7NA 2PBFA 4P3NA 3FDIA 4RIHA 1WPQA 1SR8A 3E5NA 4R05A 4X6UA 4NEGA 2FK7A 1SNYA 1CUAA 1X7WA 2WVJA 2OZLB 4NZPA 2RBKA 2FH5B 3ABQB 1GZUA 1U2ZA 4GOKA 4HDMB 3ZG6A 2Z6UA 4LJYA 1NM5A 3UV7A 2YY7A 1ZLYA 1DI0A 3CNNA 2JKYA 2QLMA 2WOJA 4RJTA 4HXGA 3K5HA 3K5IA 2FMFA 3PXAA 5KNCA 2FUG1 1OXXK 2FP4A 4ZEMA 5F3DA 2F3PA 1DAKA 4LF5B 3NHMA 1N92A 3DBIA 2OARA 1K73Q 2FZ5A 1B0PA 4NBRA 4IIBA 5COQA 3D8RA 3L7YA 3QU4A 1XD9A 2FZEA 2WA2A 3C16C 3KTFA 1SQGA 2AOTA 5CX4A 3CR7A 4NEQA 3CNLA 4BJ5A 5KNLA 1J8QA 1RYBA 5A2QA 5DK6A 1EE2A 4EB8A 1T0JB 3PC7A 3NWEA 3UFXA 1HY8A 3BXFA 1FMCA 5CCBA 5LC1A 4H60A 1EP2B 1ULUA 5FV7A 3DMNA 4Q7EA 3V1LA 5KQRA 2ACVA 1Q11A 4OD0A 4RORA 1WQ4A 3VR2D 1NU8A 4YLEA 1CUBA 3CLTD 5L7WA 2V6IA 4Y30A 1ONNA 2XCQA 4QPPA 3SFVA 1FDWA 4J8PA 2BAGA 4CMCA 4ALNA 4K3VA 4YI3A 4DA9A 1NJ5A 5LQSA 2HIMA 5K0BA 3IMFA 4PLHA 3DMGA 4LCJA 5CT9A 2R66A 2FV8A 1XNJA 2ZJBA 4JBGA 3H1PA 5IKPA 3L7NA 2WRZA 5FD8A 1Z82A 2ZTMA 2FG5A 1Q84A 3GFFA 3N3AC 1WKCA 3OZFA 2VLBA 4JLKA 3SJBA 3DQQA 3VVMA 2R9VA 2O07A 1QGDA 5DM0A 3EZNA 1L6IA 2C97A 2VA9A 3RANA 4MI1A 4URUR 3OQHA 1TADA 3FOBA 1V41E 4FGJA 1R4NA 4MHOA 1FJHA 4LGYA 4BO8A 4ZFNA 5C8ZA 1QTQA 1Z83A 4HN2A 2Z56A 4RPHA 4G8BA 3VR4D 3KR0A 2ZYIA 1U8UA 3BXZA 3LYHA 3AKEA 3F47A 2GESA 2B83A 2JARA 3F9RA 2PUTA 4JI8B 2G0NA 2BELA 4RK1A 1OYWA 1OIWA 3HB1A 1XL1A 4MUXA 1NJ1A 1ECGA 2CL7X 5JJBA 3BL8A 2PH3A 1TJPB 3NR2A 1NXTA 2AXQA 1G4AE 3DZGA 5IF3A 4P0PB 1ORWA 4QXAA 3WFZA 5SY6A 3RG8A 1R64A 4FYYA 2VPZA 3UJ8A 2HW8A 4U7HA 1YKSA 3ZWQA 1V8FA 5JROA 1OUMA 3U16A 3LQQA 1EQ2A 2I4MA 5DHFA 1VKHA 4KXXA 5GVSA 1GOTA 1NQAO 4F9GA 4TKUB 5D5HA 4HMOA 1JL3A 1EUZA 1QBGA 3ABZA 4HSEA 2BFDA 1US8B 4FOLA 2AD1A 1FX0A 1IG0A 2AQIA 2G08A 2VZ9A 4M6WA 4C7VA 8GPBA 5JEEA 5HJEA 2ADFA 1MG0A 5ADHA 7REQB 5FLXA 1NYRA 3M4ZA 5FUVA 4TYNA 3CUKA 4EJMA 3QXCA 2G28A 1TTHA 4AUKA 5KTPA 4N7MA 1U0JA 1ZONA 4WLNA 4CR8A 4YK7A 2X23A 3KT8A 2OBYA 1W8DA 2GARA 2Y71A 3GLHE 1OGYA 3E4CA 3KJHA 1QFZA 3GA5A 2CLIB 4E6PA 1CY8A 5KYWB 4KGXA 1N7HA 2N1BA 2XPCA 5KAMA 4BE4A 4EPRA 5DNAA 1L3CA 5BWBA 1N8NA 2P2CA 2P4UA 4JQSA 2XJ4A 5C5IA 1MW8X 2O8CB 3TBFA 2OCPA 4LHSA 2M5RA 3QVKA 5D00A 2H29A 4OLHA 5F3RA 1H2ZA 5F7XA 5LOVA 1NP7A 2WU8A 4HRVA 1T91A 4IGAA 4MV3A 1Y3HA 2WPNA 1SXGA 4FEGA 4NIMA 4X1YB 4AP5A 4ANFA 4ZYVA 2DBVO 1HQDA 1PG0A 2AI3A 2QX7A 2R5FA 1YBHA 2XBUA 3R09A 2E4YA 3TRDA 5JFTA 4WESB 2R2GA 1OWPA 3PSAA 1YJWP 3EQZA 4KGVA 1COWD 1H69A 5EGSA 3TMKA 2WEKA 3THRA 1LPBB 2HFJA 1ST3A 4EGFA 2IHTA 5E9AA 3MOSA 1JQKA 2A0YA 3RGWS 4EG1A 3U7IA 5FFFA 5DI3B 2L2QA 4HWGA 3CMAP 2Q1YA 4G3XA 4BRSA 2JAXA 2XGOA 4YCSA 4J0QA 3T7TA 1QNLA 1GT91 2P3LA 2FI1A 1R6UA 2JYLA 1NR7A 2F1IA 3H5VA 5BV0A 5M04A 1HF3A 2PSFA 5EKXA 3KOZA 1YIJP 3O90A 1II8B 2IYWA 4NU0A 1Z0DA 3ZWNA 2EDCA 1V6CA 4HXYA 4O1HA 4TL7A 1IJFA 3V4RA 4P4UA 1ZIOA 1DHTA 4ZCLA 2A5LA 2R4TA 4Y2GA 3U9SA 4YRIA 4WXYB 1NQ4A 3EBOA 3LYAA 4V02A 1JPJA 4LCEA 1Z6AA 1P72A 3GLFB 5IYZF 5E2BA 4P0TA 4CL0A 1M9NA 2FPLA 3E9NA 1UEXC 3CZ4A 3O4JA 1NXVA 4F3YA 5DNUA 3ESBA 4DNFA 5AD1A 1LDYA 4KPGA 4C20A 1PJ8A 1L7NA 2W0SA 1KY5A 4KO3S 2Q41A 2QNBA 3HJAA 3ESRA 3OQIB 4X63A 4P7BA 5I7VA 1D1TA 2BUCA 1WCWA 3ZHCA 2IBMA 4GD3Q 1IDN1 2WLTA 4O25A 1USGA 1DC4A 2K2QA 2FRVA 2GAIA 3DGEC 3QXXA 4J43A 4BQOA 2V9CA 3EQ6A 4ON9A 3ZZ0A 4BQFA 3P2IA 4FGKA 3FKJA 4XROA 2C4HA 1CS0A 4FFMA 2EJTA 3GKLC 1E18A 5TRTA 2IDKA 4INZA 4JSYA 2HB6A 3K9WA 3B1YA 4V0MA 4KC0A 4HFJA 2PR7A 3S2EA 2C9DA 2C2OA 2HJWA 3DE4X 3RS2A 1MLDA 2AMJA 3ACBA 3UOGA 3NBQA 4JSTA 1GPKA 4U2CA 4ZODA 3DZIA 1BRTA 3G9XA 2CD9A 3MT8A 2X14A 4D4GA 4EG6A 2ICAA 1RTTA 3C24A 1RE1A 3R5SA 5H5JA 2O8EA 3CBQA 2QXYA 3UPUA 2WPTA 1YKGA 4QYSA 4J3JA 1YBMA 3AY3A 1XVIA 4HXFB 3M1MA 1XTJA 4PAOA 4G1BA 4IDEA 1FUUA 3LPCA 4ENUA 3ANMA 4RADA 3PK0A 3KAJA 4B31A 5TY0A 1DJQA 5L3ZA 2GJ4A 3CGGA 2J9YB 5LWHA 2QQEA 2OHXA 4AJHA 4JXKA 2A0UA 2AF3C 4MTCA 5FUYA 3OIDA 5GAJA 1SUSA 4QARA 4KRYA 3HUFA 4U9UA 4EHHA 5AIBA 4R31A 1QHHA 5B7GA 1Z45A 1NDHA 5K2OA 4ZICA 1BXGA 2FZKA 2BONA 4FN5A 4EI7A 2OLEA 3WSWA 4YPVA 4UXIA 3I92A 1L4MA 4UOEA 1ZD1A 4OXNA 4OXYA 1SKUA 1YZYA 2WAXA 2XNDA 1ZMRA 1TF5A 2AFRA 1YRBA 2VJCA 1DEHA 3MLBA 2N3ZA 3QKSB 4RHUA 5EERA 4QOGA 1UMBB 1Z08A 1J2RA 5FIUA 1XG5A 1UPBA 3IVGA 4R1TA 2OZKA 4LXXA 1E6JP 3STHA 1QU2A 4JP3A 2EZUA 4P93A 2ZJ0A 3P19A 4CM3A 3GPDG 5KU7A 1DUSA 2EDAA 2WKPA 1T0UA 4NS1A 2DUWA 4ZOLB 2R1VA 4GHWA 2W4QA 2YVAA 4OG2A 3R7BA 3UXYA 4CKXA 3BAZA 1D1DA 2ZI5A 3AP3A 2RHCA 4YCNA 4BO2A 1KA9H 1DKUA 2UV8A 1VQ4P 4JBYA 3T12A 1NW6A 5FPYA 4QUJA 3MA0A 4HQRA 2HHHB 4HBGA 3OU2A 3UC5A 1N1MA 3X2FA 5T3UA 1HFWA 4PBTA 3Q9UA 2UZ1A 2WHEA 1LNZA 3M1LA 1NE2A 2W6IA 2PUFA 4OJYA 2WA1A 1RWMA 4HQNA 5CT4A 1EVLA 2ZWPA 5G0TA 4JIMA 3P94A 2J1LA 3G0IA 2DPLA 4JI0B 1NY5A 2QV7A 4EEKA 4P82A 1DC7A 4UEJA 2PX2A 2XNCA 4W1SA 3GOQA 1A4XA 3OVMA 4NESA 3B8HA 3EJEA 1ZX1A 2P11A 4JYPA 1H8EA 5LZ8A 3PF8A 5BQOA 3CSDA 3U4HA 1KZ9A 3ZWOA 5JC1A 4N01A 5G02A 5PNTA 4B6PA 4BN0A 2PQ2A 2ID8A 2J9FB 3REQA 2HSDA 3Q1LA 4AZTA 4JA2A 4UTRA 2G04A 2ZRCA 4M83A 2QZZA 4I4TA 4TMXA 3VYTB 1T2VA 3ONEA 2HIGA 3LX5A 2ZG6A 1X3OA 3TLEA 1XVLA 2JLRA 3DC2A 4ASUA 5HKKA 2FMXA 3E58A 4HVLA 2JGIA 4QPNA 5JZVA 1N9ZA 1DV2A 1EMDA 3VUFA 2CK3A 3DO8A 721PA 3EZXA 4DUZB 3LO5A 1Q7TA 2EBUA 3DZCA 2E3JA 3IAFA 4MA0A 1A9TA 1DKLA 4PY2A 3ZCSA 1YVRA 1VQ6P 3DFIA 2C1XA 3ELDA 3M81A 1WQ3A 1UM9A 1FIUA 1OASA 3D6MA 1X1AA 1QIEA 3WRWA 1LWNA 3KYBA 3AJAA 2PZGA 2RHRA 3FNBA 3O9ZA 4C30A 4EPWA 5CDHA 1HY3A 3RAJA 2QNWA 1MTOA 2M8PA 2CHFA 1B73A 2GAAA 2MSDB 2OY0A 4K6FA 5KU1A 2WDZA 2LKCA 2WMDA 1E2BA 2ONJA 2P3SA 4CKBA 1DGQA 4PNHA 4BS9A 5H70A 4FLMA 4YPFA 3T3NA 3CLKA 5KWEA 1XKTA 3R6LA 3K5WA 4MVJI 1FZQA 3KPVA 4P3PA 3V2HA 3EXEA 4JVSB 3ZGOA 4FDAA 5IWCA 1ECFA 1Z8FA 4EWLA 1IQ0A 1WDTA 4M9CA 2WVHA 4Q3EA 4HPJB 1MO5A 4ZGWA 3FB4A 1U6IA 4Q9NA 4UU8A 4PNZA 1WB5A 3EXHA 3CZPA 4NBTA 2G07A 2HLDD 3NYWA 1AURA 3PLNA 1GP2A 3LUKA 4NU5A 5DYTA 2QVXX 3U3OA 1GCIA 1MPTA 3DA8A 1FRNA 1VBNA 1SC6A 5EE3A 3CEHA 2VBGA 1FYWA 2WU3A 3UMFA 2JFUA 1BWPA 1F9AA 3PXBA 4KR9A 4DBZA 5I01A 1ZMTA 5FR2A 3KQNA 3O1LA 5JI2E 1O89A 3WYGA 4RF5A 2RC6A