3GJNA

Following evolutionary paths to high affinity and selectivity protein-protein interactions using colicin7 and immunity proteins
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLQLVTTICDAEATSEEELDKLITHFEEMTEHPSGSDLIYWPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Colicin-E9 immunity protein
publication title Following evolutionary paths to protein-protein interactions with high affinity and selectivity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 27
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 3gjnA00
1ZNVA 3U43A 1GXHA 1GXGA 1MZ8A 4UHPB 2VLNA 2GZFA 2JBGA 1IMQA 4QKOA 2K5XA 1UNKA 1E0HA 5EW5E 1AYIA 1CEIA 1FR2A 2GYKA 2VLQA 2GZJA 2NO8A 2JAZA 2VLPA 1UJZA 2GZIA 1BXIA 2K0DX 7CEIA 2GZEA 2ERHA 3GJNA 1EMVA 2VLOA 2JB0A 1IMPA 2GZGA 4F37A 3GKLC 2WPTA
chains in the Genus database with same CATH superfamily
2FQ2A 5HGOA 1RO0A 3DS0A 2GYKA 1N8RQ 2M8LA 5DCKA 1W2BO 2EHSA 2KORA 2M5RA 2JGPA 2GZGA 1BAJA 3CCVP 2AVAA 5HGMA 2DNWA 3DS2A 1A8OA 2Z46A 2JYLA 1AYIA 2GZJA 4XFYA 4COCA 2PEQA 2PEOA 7CEIA 4BPFA 1OR5A 1Z6MA 2MY5A 2PY8A 2K2QA 2QA4P 1ACPA 2X2BA 2QEXP 2GZFA 2JU2A 2FQ0A 1VQOP 3DS5A 3B4QA 2N98A 2BUOA 1UJZA 2K0DX 4R0MA 4PXHB 2CQ8A 1S72P 4IPYA 4H2YC 1GXGA 2N6ZA 1L0IA 3CD6P 4H2WC 2L6EA 4WYMA 2N50A 1VQNP 2KWLA 2JO0A 2FHSC 4PWVB 1ZMBA 3CCQP 1AUMA 3U43A 2DGYA 2KG6A 3GZLA 3MGEA 4UHPB 3CCLP 2KOQA 2PEJA 2N5IA 4QKOA 3CCJP 1KQSO 3CCSP 5KP6B 3DS4A 1HQBA 3DS3A 5KP7B 1YIJP 3CC7P 3M1MA 5HV8A 1VQ6P 2PENA 1M6NA 4U0BA 3EJBA 1EMVA 2L22A 2LMLA 3DTJA 2EIAA 3DPHA 3GKLC 1NQ4A 1K8AQ 4U0FA 2ROQA 4U0CA 5CZDB 1DNYA 2EG5A 2BHVA 2PEMA 4QNBA 1YJWP 1NJIQ 2KGDA 3LMOA 1VQ4P 1QRJA 2MF4A 2CGQA 2FVFA 2OTLP 3Q20A 1BXIA 3DS1A 1VQ7P 3CC4P 1L0HA 3H4EA 3RG6C 5KP8B 4XFZA 4PH1A 4HKGA 3I55P 1VQLP 1YITP 5BS2A 1VQKP 2LIWA 2LPKA 3VRLC 1K73Q 3NY7B 4U0DA 1IMPA 3CPWO 3OW2O 1K30A 2WPTA 3CXCO 5I4TG 1GPJA 5JPAA 2CWOA 2PEIA 2LIUA 1D1DA 5EW5E 2MR8A 2M8PA 5F2OA 2FQ1A 2FADA 4U0EA 4XRQA 3G6EP 2EHTA 2FACA 2KG8A 2ONTA 1Q7YQ 3CCEP 2KGEA 1F80D 2E1MA 2OARA 1VKUA 2PNGA 2GDWA 1KC8Q 1CEIA 3B5IA 2VLPA 2K92A 1HY8A 2Z44A 3GZMA 5F2NA 2GDYA 2MVVA 3H47A 2JB0A 3LRYA 1RNIA 2MVUA 1VQMP 2PEKA 3EJEA 1Q81Q 2FVEA 1GXHA 2JBGA 2CNRA 2FAEA 2P9XA 2EFJA 5EJDA 1M90Q 3EJDA 5HVCA 2K93A 1T8KA 4XFXA 2CG5B 1KD1Q 2ERHA 2L4BA 2XT1A 1VQ9P 4H2XC 4GR2A 3HZQA 2GDXA 1VQ5P 1QVGO 3CC2P 2LL8A 4COPA 2VSQA 5HGLA 5HGNA 1VQPP 2AFDA 4MRTC 3G71P 4GR6A 2NO8A 2LF4A 2KOOA 1M1KQ 2FVAA 2KODA 5F2KA 3G1IA 1JJ2O 1M74A 2MD9A 2K0YA 1VHNA 2KR5A 2KGCA 1DV5A 2QNWA 4IZ6A 4XROA 1UNKA 3G1GA 2K94A 1RO2A 3CMEP 4BPGA 4BPHA 3CMAP 2JQ4A 2JU1A 4NEOA 4PH0A 2N6YA 2LTEA 2KG9A 1ZNVA 3E2DA 1MZ8A 2M8NA 2KOSA 3HYBA 2LOLA 1FR2A 3G0VA 4M0IA 2GZEA 5BS1A 1YI2P 2JYGA 1K9MQ 1EOQA 2VLOA 4F37A 1YJ9P 2VLNA 1Q86Q 1IMQA 3RG2A 2KGAA 2OTJP 1X3OA 1QVFO 2VLQA 2L9FA 1VQ8P 2XZ0D 3G4SP 2MR7A 2KW2A 1M6EX 2N5HA 3H0DA 4DG9A 3CCMP 1KLPA 3I56P 2XXMA 3G29A 2KOPA 1YJNP 3P05A 2K0XA 3G21A 1E0HA 1IUQA 3G28A 2XZ1C 2AFEA 2Z45A 3CCRP 1A43A 2LKIA 1Q82Q 3NTEA 3G26A 3CE7A 1YHQP 2L0QA 1E6JP 2AF8A 2K5XA 3WBHA 2JAZA 1EIAA 2GZIA 4CA3A 1AF8A 3GJNA 4U0AA 2XV6A 3CCUP
chains in the Genus database with same CATH topology
1ZNVA 3U43A 1GXHA 1GXGA 1MZ8A 4UHPB 2VLNA 2GZFA 2JBGA 1IMQA 4QKOA 2K5XA 1UNKA 1E0HA 5EW5E 1AYIA 1CEIA 1FR2A 2GYKA 2VLQA 2GZJA 2NO8A 2JAZA 2VLPA 1UJZA 2GZIA 1BXIA 2K0DX 7CEIA 2GZEA 2ERHA 3GJNA 1EMVA 2VLOA 2JB0A 1IMPA 2GZGA 4F37A 3GKLC 2WPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZNV A;  3U43 A;  1GXH A;  1GXG A;  1MZ8 A;  4UHP B;  2VLN A;  2GZF A;  2JBG A;  1IMQ A;  4QKO A;  2K5X A;  1UNK A;  1E0H A;  5EW5 E;  1AYI A;  1CEI A;  1FR2 A;  2GYK A;  2VLQ A;  2GZJ A;  2NO8 A;  2JAZ A;  2VLP A;  1UJZ A;  2GZI A;  1BXI A;  2K0D X;  7CEI A;  2GZE A;  2ERH A;  3GJN A;  1EMV A;  2VLO A;  2JB0 A;  1IMP A;  2GZG A;  4F37 A;  3GKL C;  2WPT A; 
#chains in the Genus database with same CATH topology
 2FQ2 A;  5HGO A;  1RO0 A;  3DS0 A;  2GYK A;  1N8R Q;  2M8L A;  5DCK A;  1W2B O;  2EHS A;  2KOR A;  2M5R A;  2JGP A;  2GZG A;  1BAJ A;  3CCV P;  2AVA A;  5HGM A;  2DNW A;  3DS2 A;  1A8O A;  2Z46 A;  2JYL A;  1AYI A;  2GZJ A;  4XFY A;  4COC A;  2PEQ A;  2PEO A;  7CEI A;  4BPF A;  1OR5 A;  1Z6M A;  2MY5 A;  2PY8 A;  2K2Q A;  2QA4 P;  1ACP A;  2X2B A;  2QEX P;  2GZF A;  2JU2 A;  2FQ0 A;  1VQO P;  3DS5 A;  3B4Q A;  2N98 A;  2BUO A;  1UJZ A;  2K0D X;  4R0M A;  4PXH B;  2CQ8 A;  1S72 P;  4IPY A;  4H2Y C;  1GXG A;  2N6Z A;  1L0I A;  3CD6 P;  4H2W C;  2L6E A;  4WYM A;  2N50 A;  1VQN P;  2KWL A;  2JO0 A;  2FHS C;  4PWV B;  1ZMB A;  3CCQ P;  1AUM A;  3U43 A;  2DGY A;  2KG6 A;  3GZL A;  3MGE A;  4UHP B;  3CCL P;  2KOQ A;  2PEJ A;  2N5I A;  4QKO A;  3CCJ P;  1KQS O;  3CCS P;  5KP6 B;  3DS4 A;  1HQB A;  3DS3 A;  5KP7 B;  1YIJ P;  3CC7 P;  3M1M A;  5HV8 A;  1VQ6 P;  2PEN A;  1M6N A;  4U0B A;  3EJB A;  1EMV A;  2L22 A;  2LML A;  3DTJ A;  2EIA A;  3DPH A;  3GKL C;  1NQ4 A;  1K8A Q;  4U0F A;  2ROQ A;  4U0C A;  5CZD B;  1DNY A;  2EG5 A;  2BHV A;  2PEM A;  4QNB A;  1YJW P;  1NJI Q;  2KGD A;  3LMO A;  1VQ4 P;  1QRJ A;  2MF4 A;  2CGQ A;  2FVF A;  2OTL P;  3Q20 A;  1BXI A;  3DS1 A;  1VQ7 P;  3CC4 P;  1L0H A;  3H4E A;  3RG6 C;  5KP8 B;  4XFZ A;  4PH1 A;  4HKG A;  3I55 P;  1VQL P;  1YIT P;  5BS2 A;  1VQK P;  2LIW A;  2LPK A;  3VRL C;  1K73 Q;  3NY7 B;  4U0D A;  1IMP A;  3CPW O;  3OW2 O;  1K30 A;  2WPT A;  3CXC O;  5I4T G;  1GPJ A;  5JPA A;  2CWO A;  2PEI A;  2LIU A;  1D1D A;  5EW5 E;  2MR8 A;  2M8P A;  5F2O A;  2FQ1 A;  2FAD A;  4U0E A;  4XRQ A;  3G6E P;  2EHT A;  2FAC A;  2KG8 A;  2ONT A;  1Q7Y Q;  3CCE P;  2KGE A;  1F80 D;  2E1M A;  2OAR A;  1VKU A;  2PNG A;  2GDW A;  1KC8 Q;  1CEI A;  3B5I A;  2VLP A;  2K92 A;  1HY8 A;  2Z44 A;  3GZM A;  5F2N A;  2GDY A;  2MVV A;  3H47 A;  2JB0 A;  3LRY A;  1RNI A;  2MVU A;  1VQM P;  2PEK A;  3EJE A;  1Q81 Q;  2FVE A;  1GXH A;  2JBG A;  2CNR A;  2FAE A;  2P9X A;  2EFJ A;  5EJD A;  1M90 Q;  3EJD A;  5HVC A;  2K93 A;  1T8K A;  4XFX A;  2CG5 B;  1KD1 Q;  2ERH A;  2L4B A;  2XT1 A;  1VQ9 P;  4H2X C;  4GR2 A;  3HZQ A;  2GDX A;  1VQ5 P;  1QVG O;  3CC2 P;  2LL8 A;  4COP A;  2VSQ A;  5HGL A;  5HGN A;  1VQP P;  2AFD A;  4MRT C;  3G71 P;  4GR6 A;  2NO8 A;  2LF4 A;  2KOO A;  1M1K Q;  2FVA A;  2KOD A;  5F2K A;  3G1I A;  1JJ2 O;  1M74 A;  2MD9 A;  2K0Y A;  1VHN A;  2KR5 A;  2KGC A;  1DV5 A;  2QNW A;  4IZ6 A;  4XRO A;  1UNK A;  3G1G A;  2K94 A;  1RO2 A;  3CME P;  4BPG A;  4BPH A;  3CMA P;  2JQ4 A;  2JU1 A;  4NEO A;  4PH0 A;  2N6Y A;  2LTE A;  2KG9 A;  1ZNV A;  3E2D A;  1MZ8 A;  2M8N A;  2KOS A;  3HYB A;  2LOL A;  1FR2 A;  3G0V A;  4M0I A;  2GZE A;  5BS1 A;  1YI2 P;  2JYG A;  1K9M Q;  1EOQ A;  2VLO A;  4F37 A;  1YJ9 P;  2VLN A;  1Q86 Q;  1IMQ A;  3RG2 A;  2KGA A;  2OTJ P;  1X3O A;  1QVF O;  2VLQ A;  2L9F A;  1VQ8 P;  2XZ0 D;  3G4S P;  2MR7 A;  2KW2 A;  1M6E X;  2N5H A;  3H0D A;  4DG9 A;  3CCM P;  1KLP A;  3I56 P;  2XXM A;  3G29 A;  2KOP A;  1YJN P;  3P05 A;  2K0X A;  3G21 A;  1E0H A;  1IUQ A;  3G28 A;  2XZ1 C;  2AFE A;  2Z45 A;  3CCR P;  1A43 A;  2LKI A;  1Q82 Q;  3NTE A;  3G26 A;  3CE7 A;  1YHQ P;  2L0Q A;  1E6J P;  2AF8 A;  2K5X A;  3WBH A;  2JAZ A;  1EIA A;  2GZI A;  4CA3 A;  1AF8 A;  3GJN A;  4U0A A;  2XV6 A;  3CCU P; 
#chains in the Genus database with same CATH homology
 1ZNV A;  3U43 A;  1GXH A;  1GXG A;  1MZ8 A;  4UHP B;  2VLN A;  2GZF A;  2JBG A;  1IMQ A;  4QKO A;  2K5X A;  1UNK A;  1E0H A;  5EW5 E;  1AYI A;  1CEI A;  1FR2 A;  2GYK A;  2VLQ A;  2GZJ A;  2NO8 A;  2JAZ A;  2VLP A;  1UJZ A;  2GZI A;  1BXI A;  2K0D X;  7CEI A;  2GZE A;  2ERH A;  3GJN A;  1EMV A;  2VLO A;  2JB0 A;  1IMP A;  2GZG A;  4F37 A;  3GKL C;  2WPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...