3GJNA

Following evolutionary paths to high affinity and selectivity protein-protein interactions using colicin7 and immunity proteins
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLQLVTTICDAEATSEEELDKLITHFEEMTEHPSGSDLIYWPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Following evolutionary paths to protein-protein interactions with high affinity and selectivity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Colicin-E9 immunity protein
total genus 27
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 3gjnA00
1UNKA 1IMQA 1IMPA 1FR2A 4F37A 2GZFA 2K5XA 2GZJA 1CEIA 2GZEA 2VLOA 3GKLC 4UHPB 3U43A 1E0HA 2GZIA 7CEIA 2WPTA 1GXHA 3GJNA 1ZNVA 5EW5E 1EMVA 2VLQA 1AYIA 2GZGA 1UJZA 2JBGA 2JAZA 2VLNA 2GYKA 1MZ8A 2ERHA 2NO8A 2JB0A 1GXGA 2VLPA 1BXIA 4QKOA 2K0DX
chains in the Genus database with same CATH superfamily
1FR2A 4U0FA 2MR7A 2DNWA 3DS0A 5F2NA 1VQ7P 5CZDB 2KWLA 1VQ4P 2LMLA 2KG9A 3M1MA 2ERHA 3GZLA 4U0CA 1BXIA 4QKOA 1AF8A 1VQ9P 3CE7A 4COCA 4PWVB 3CC7P 3G6EP 2GZFA 5JPAA 2L6EA 4PH0A 1YITP 1T8KA 2N5IA 2AF8A 1NQ4A 2FVEA 2QNWA 2MR8A 3EJEA 4PXHB 5HGMA 1Q82Q 1VHNA 3EJBA 5I4TG 2K0DX 4PH1A 2FVAA 1VQMP 2M8PA 1W2BO 2K2QA 1YI2P 2JQ4A 2FQ0A 1M74A 5HGOA 2ROQA 1YIJP 2VLPA 1ZMBA 2PY8A 1DV5A 3HZQA 3CCMP 4XFZA 2AFEA 3CCEP 2KOSA 2QEXP 1RNIA 1M6EX 3CCVP 2GZGA 4BPGA 1E6JP 4IPYA 2K0XA 1UJZA 1L0HA 2K93A 2LL8A 3H0DA 2MVVA 2N98A 1Z6MA 2FVFA 5KP8B 5HV8A 2K5XA 2OTLP 1M6NA 1VQ5P 2LIUA 4NEOA 2N50A 4XFXA 1VQPP 2JBGA 2KOPA 2PEQA 2JAZA 2JB0A 1GXGA 2KOOA 1QVFO 2XXMA 3EJDA 2X2BA 4M0IA 3CC4P 3H4EA 4U0AA 5DCKA 3CXCO 2EIAA 2CQ8A 2VLQA 3H47A 3NY7B 3CCUP 5HGLA 4R0MA 1L0IA 2Z44A 2K92A 2PEKA 2CGQA 1AUMA 2KGEA 2XZ0D 1VQ6P 2CWOA 3Q20A 1A43A 1VQOP 1EOQA 2K94A 3G21A 3GKLC 2KG8A 1K9MQ 1YJNP 2MVUA 1YJ9P 2FAEA 2KG6A 2EHTA 1BAJA 1Q7YQ 3CCLP 2M5RA 2FQ1A 4CA3A 2KOQA 1A8OA 3CC2P 1IMQA 2M8NA 1K73Q 1ACPA 3CCRP 2L9FA 2PEIA 2VLOA 5KP6B 2AFDA 2WPTA 2LF4A 5EW5E 1VQKP 1DNYA 2P9XA 1KQSO 3DS5A 2MD9A 5BS1A 1S72P 2Z45A 3G1IA 3LMOA 3G4SP 3DS2A 2MY5A 3LRYA 4GR6A 1CEIA 2KORA 7CEIA 3CD6P 2GDYA 2GYKA 2K0YA 3P05A 4XROA 2FACA 1VQLP 2KR5A 4BPHA 3CCSP 4U0BA 2JU2A 2QA4P 5KP7B 2XZ1C 1IUQA 4WYMA 4COPA 1GPJA 2EG5A 5F2OA 2PEJA 1KLPA 4H2YC 2PENA 2JO0A 1VQ8P 2GZIA 4XFYA 1K30A 1ZNVA 3VRLC 2LPKA 2EHSA 2MF4A 3G0VA 3DTJA 3DPHA 3OW2O 2FHSC 2PEMA 2XV6A 3CCJP 3CCQP 4U0DA 3E2DA 3G26A 1UNKA 3G29A 3G1GA 2JU1A 1IMPA 3MGEA 3CPWO 2AVAA 2JYLA 3U43A 2FADA 2GDWA 1GXHA 4GR2A 2JYGA 1JJ2O 2N5HA 3G71P 1MZ8A 1HQBA 4BPFA 1YJWP 2KGCA 1QVGO 2KGAA 2L0QA 5HVCA 1RO2A 3DS1A 2LTEA 2E1MA 4QNBA 3I56P 1M90Q 5F2KA 4MRTC 4H2XC 1KD1Q 2KODA 3RG2A 4U0EA 1QRJA 2LKIA 3DS4A 2GZJA 2LIWA 2GZEA 3DS3A 3WBHA 4DG9A 3G28A 2CNRA 2KW2A 1HY8A 1K8AQ 2BUOA 3HYBA 2OARA 1M1KQ 2PNGA 3RG6C 2KGDA 2JGPA 2L4BA 5HGNA 1RO0A 1Q81Q 2VSQA 2ONTA 3I55P 2OTJP 1D1DA 1NJIQ 4UHPB 4HKGA 3B4QA 1E0HA 2PEOA 2GDXA 1F80D 2LOLA 2EFJA 2CG5B 1X3OA 2M8LA 2NO8A 2DGYA 3CMAP 2Z46A 1YHQP 5BS2A 3CMEP 4F37A 3B5IA 3GZMA 1OR5A 2N6YA 2BHVA 1Q86Q 4XRQA 5EJDA 3NTEA 3GJNA 1N8RQ 4H2WC 1EMVA 2N6ZA 2XT1A 1AYIA 1EIAA 2VLNA 1VKUA 2FQ2A 1KC8Q 1VQNP 2L22A 4IZ6A
chains in the Genus database with same CATH topology
1UNKA 1IMQA 1IMPA 1FR2A 4F37A 2GZFA 2K5XA 2GZJA 1CEIA 2GZEA 2VLOA 3GKLC 4UHPB 3U43A 1E0HA 2GZIA 7CEIA 2WPTA 1GXHA 3GJNA 1ZNVA 5EW5E 1EMVA 2VLQA 1AYIA 2GZGA 1UJZA 2JBGA 2JAZA 2VLNA 2GYKA 1MZ8A 2ERHA 2NO8A 2JB0A 1GXGA 2VLPA 1BXIA 4QKOA 2K0DX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UNK A;  1IMQ A;  1IMP A;  1FR2 A;  4F37 A;  2GZF A;  2K5X A;  2GZJ A;  1CEI A;  2GZE A;  2VLO A;  3GKL C;  4UHP B;  3U43 A;  1E0H A;  2GZI A;  7CEI A;  2WPT A;  1GXH A;  3GJN A;  1ZNV A;  5EW5 E;  1EMV A;  2VLQ A;  1AYI A;  2GZG A;  1UJZ A;  2JBG A;  2JAZ A;  2VLN A;  2GYK A;  1MZ8 A;  2ERH A;  2NO8 A;  2JB0 A;  1GXG A;  2VLP A;  1BXI A;  4QKO A;  2K0D X; 
#chains in the Genus database with same CATH topology
 1FR2 A;  4U0F A;  2MR7 A;  2DNW A;  3DS0 A;  5F2N A;  1VQ7 P;  5CZD B;  2KWL A;  1VQ4 P;  2LML A;  2KG9 A;  3M1M A;  2ERH A;  3GZL A;  4U0C A;  1BXI A;  4QKO A;  1AF8 A;  1VQ9 P;  3CE7 A;  4COC A;  4PWV B;  3CC7 P;  3G6E P;  2GZF A;  5JPA A;  2L6E A;  4PH0 A;  1YIT P;  1T8K A;  2N5I A;  2AF8 A;  1NQ4 A;  2FVE A;  2QNW A;  2MR8 A;  3EJE A;  4PXH B;  5HGM A;  1Q82 Q;  1VHN A;  3EJB A;  5I4T G;  2K0D X;  4PH1 A;  2FVA A;  1VQM P;  2M8P A;  1W2B O;  2K2Q A;  1YI2 P;  2JQ4 A;  2FQ0 A;  1M74 A;  5HGO A;  2ROQ A;  1YIJ P;  2VLP A;  1ZMB A;  2PY8 A;  1DV5 A;  3HZQ A;  3CCM P;  4XFZ A;  2AFE A;  3CCE P;  2KOS A;  2QEX P;  1RNI A;  1M6E X;  3CCV P;  2GZG A;  4BPG A;  1E6J P;  4IPY A;  2K0X A;  1UJZ A;  1L0H A;  2K93 A;  2LL8 A;  3H0D A;  2MVV A;  2N98 A;  1Z6M A;  2FVF A;  5KP8 B;  5HV8 A;  2K5X A;  2OTL P;  1M6N A;  1VQ5 P;  2LIU A;  4NEO A;  2N50 A;  4XFX A;  1VQP P;  2JBG A;  2KOP A;  2PEQ A;  2JAZ A;  2JB0 A;  1GXG A;  2KOO A;  1QVF O;  2XXM A;  3EJD A;  2X2B A;  4M0I A;  3CC4 P;  3H4E A;  4U0A A;  5DCK A;  3CXC O;  2EIA A;  2CQ8 A;  2VLQ A;  3H47 A;  3NY7 B;  3CCU P;  5HGL A;  4R0M A;  1L0I A;  2Z44 A;  2K92 A;  2PEK A;  2CGQ A;  1AUM A;  2KGE A;  2XZ0 D;  1VQ6 P;  2CWO A;  3Q20 A;  1A43 A;  1VQO P;  1EOQ A;  2K94 A;  3G21 A;  3GKL C;  2KG8 A;  1K9M Q;  1YJN P;  2MVU A;  1YJ9 P;  2FAE A;  2KG6 A;  2EHT A;  1BAJ A;  1Q7Y Q;  3CCL P;  2M5R A;  2FQ1 A;  4CA3 A;  2KOQ A;  1A8O A;  3CC2 P;  1IMQ A;  2M8N A;  1K73 Q;  1ACP A;  3CCR P;  2L9F A;  2PEI A;  2VLO A;  5KP6 B;  2AFD A;  2WPT A;  2LF4 A;  5EW5 E;  1VQK P;  1DNY A;  2P9X A;  1KQS O;  3DS5 A;  2MD9 A;  5BS1 A;  1S72 P;  2Z45 A;  3G1I A;  3LMO A;  3G4S P;  3DS2 A;  2MY5 A;  3LRY A;  4GR6 A;  1CEI A;  2KOR A;  7CEI A;  3CD6 P;  2GDY A;  2GYK A;  2K0Y A;  3P05 A;  4XRO A;  2FAC A;  1VQL P;  2KR5 A;  4BPH A;  3CCS P;  4U0B A;  2JU2 A;  2QA4 P;  5KP7 B;  2XZ1 C;  1IUQ A;  4WYM A;  4COP A;  1GPJ A;  2EG5 A;  5F2O A;  2PEJ A;  1KLP A;  4H2Y C;  2PEN A;  2JO0 A;  1VQ8 P;  2GZI A;  4XFY A;  1K30 A;  1ZNV A;  3VRL C;  2LPK A;  2EHS A;  2MF4 A;  3G0V A;  3DTJ A;  3DPH A;  3OW2 O;  2FHS C;  2PEM A;  2XV6 A;  3CCJ P;  3CCQ P;  4U0D A;  3E2D A;  3G26 A;  1UNK A;  3G29 A;  3G1G A;  2JU1 A;  1IMP A;  3MGE A;  3CPW O;  2AVA A;  2JYL A;  3U43 A;  2FAD A;  2GDW A;  1GXH A;  4GR2 A;  2JYG A;  1JJ2 O;  2N5H A;  3G71 P;  1MZ8 A;  1HQB A;  4BPF A;  1YJW P;  2KGC A;  1QVG O;  2KGA A;  2L0Q A;  5HVC A;  1RO2 A;  3DS1 A;  2LTE A;  2E1M A;  4QNB A;  3I56 P;  1M90 Q;  5F2K A;  4MRT C;  4H2X C;  1KD1 Q;  2KOD A;  3RG2 A;  4U0E A;  1QRJ A;  2LKI A;  3DS4 A;  2GZJ A;  2LIW A;  2GZE A;  3DS3 A;  3WBH A;  4DG9 A;  3G28 A;  2CNR A;  2KW2 A;  1HY8 A;  1K8A Q;  2BUO A;  3HYB A;  2OAR A;  1M1K Q;  2PNG A;  3RG6 C;  2KGD A;  2JGP A;  2L4B A;  5HGN A;  1RO0 A;  1Q81 Q;  2VSQ A;  2ONT A;  3I55 P;  2OTJ P;  1D1D A;  1NJI Q;  4UHP B;  4HKG A;  3B4Q A;  1E0H A;  2PEO A;  2GDX A;  1F80 D;  2LOL A;  2EFJ A;  2CG5 B;  1X3O A;  2M8L A;  2NO8 A;  2DGY A;  3CMA P;  2Z46 A;  1YHQ P;  5BS2 A;  3CME P;  4F37 A;  3B5I A;  3GZM A;  1OR5 A;  2N6Y A;  2BHV A;  1Q86 Q;  4XRQ A;  5EJD A;  3NTE A;  3GJN A;  1N8R Q;  4H2W C;  1EMV A;  2N6Z A;  2XT1 A;  1AYI A;  1EIA A;  2VLN A;  1VKU A;  2FQ2 A;  1KC8 Q;  1VQN P;  2L22 A;  4IZ6 A; 
#chains in the Genus database with same CATH homology
 1UNK A;  1IMQ A;  1IMP A;  1FR2 A;  4F37 A;  2GZF A;  2K5X A;  2GZJ A;  1CEI A;  2GZE A;  2VLO A;  3GKL C;  4UHP B;  3U43 A;  1E0H A;  2GZI A;  7CEI A;  2WPT A;  1GXH A;  3GJN A;  1ZNV A;  5EW5 E;  1EMV A;  2VLQ A;  1AYI A;  2GZG A;  1UJZ A;  2JBG A;  2JAZ A;  2VLN A;  2GYK A;  1MZ8 A;  2ERH A;  2NO8 A;  2JB0 A;  1GXG A;  2VLP A;  1BXI A;  4QKO A;  2K0D X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...