3GJNA

Following evolutionary paths to high affinity and selectivity protein-protein interactions using colicin7 and immunity proteins
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLQLVTTICDAEATSEEELDKLITHFEEMTEHPSGSDLIYWPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Following evolutionary paths to protein-protein interactions with high affinity and selectivity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Colicin-E9 immunity protein
total genus 27
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 3gjnA00
2ERHA 1CEIA 2GZEA 4F37A 1E0HA 1UJZA 3GKLC 5EW5E 3U43A 2WPTA 1MZ8A 4QKOA 1GXHA 2K5XA 2JBGA 2VLQA 2VLPA 3GJNA 2GZJA 1GXGA 4UHPB 2VLOA 1IMQA 1AYIA 2GYKA 2K0DX 2GZGA 1IMPA 2GZFA 1ZNVA 2NO8A 1FR2A 2JB0A 1EMVA 1BXIA 2VLNA 2GZIA 1UNKA 7CEIA 2JAZA
chains in the Genus database with same CATH superfamily
2FVEA 2JGPA 2KG6A 2GZEA 2DGYA 2KGAA 4DG9A 1EOQA 1KQSO 2MY5A 1M6NA 3CCUP 2PENA 1RO0A 1DV5A 1IMQA 3I56P 2LOLA 3CCRP 1VQNP 2GZIA 2LIWA 2L22A 4U0AA 2BHVA 2K0YA 2KODA 2JAZA 5JPAA 2L9FA 3OW2O 3GKLC 2LMLA 2FQ0A 3G0VA 2PY8A 1QVGO 1VQMP 1K9MQ 2CG5B 4BPGA 4H2WC 3H47A 2JB0A 1EMVA 3I55P 2MVUA 1VQPP 1VQ4P 2AVAA 2FAEA 1E6JP 3CCEP 4QKOA 2KW2A 1YJWP 2GZJA 1YI2P 4WYMA 3E2DA 2OTJP 2JQ4A 4U0BA 1BAJA 2K94A 2M8PA 4PH0A 2K2QA 1DNYA 1N8RQ 1GXHA 3RG6C 2PEOA 1Q86Q 3CCMP 4HKGA 2KWLA 3RG2A 1M6EX 1L0HA 1RO2A 4PH1A 5KP8B 2MD9A 2QNWA 3CE7A 4IZ6A 4U0FA 1ZMBA 2PEIA 3DPHA 4BPHA 2EHSA 3P05A 2ONTA 4CA3A 2GDXA 3G29A 1YHQP 2FQ1A 3H4EA 1M90Q 2XZ0D 2MF4A 1VQ7P 2LKIA 3CC4P 2KOQA 3DS0A 1K8AQ 5KP6B 1IUQA 3HYBA 2AF8A 1VQOP 1L0IA 4COCA 1EIAA 2N6ZA 2L4BA 2N6YA 2OARA 1D1DA 5HGLA 3MGEA 3G21A 3DS3A 4M0IA 3DTJA 1VQ8P 4XFXA 5HGMA 3GZLA 2Z46A 2XZ1C 3LMOA 2XXMA 1VQLP 5BS1A 5BS2A 4GR2A 1UJZA 3CXCO 1VQ9P 4U0EA 5HGNA 1Q81Q 3CPWO 3G28A 2FVAA 1HY8A 3H0DA 1Q82Q 2FHSC 2KG9A 3EJDA 2GZFA 5DCKA 1M1KQ 1BXIA 3G6EP 2P9XA 1KD1Q 1YIJP 2KR5A 5HVCA 4F37A 2KG8A 5KP7B 3G26A 5CZDB 2FQ2A 2BUOA 2PEKA 2EFJA 4XFYA 2N5IA 4QNBA 2GYKA 1GPJA 3VRLC 2PEMA 3CMEP 1AF8A 4H2XC 1UNKA 2K0XA 3DS1A 1NQ4A 2JO0A 1YJ9P 2VLQA 2LL8A 4H2YC 1GXGA 5F2KA 2OTLP 3EJBA 3CMAP 3M1MA 1OR5A 2KOPA 1JJ2O 2KGDA 3DS2A 1A8OA 2M8LA 2JU1A 3B5IA 3B4QA 2L6EA 2EHTA 3CD6P 2AFEA 5HV8A 2KGEA 5I4TG 3GZMA 2VLPA 2CQ8A 3GJNA 2LF4A 3CC2P 2XT1A 1K73Q 2N50A 2VLOA 3NTEA 3CC7P 1IMPA 1ZNVA 2L0QA 2NO8A 4IPYA 2KGCA 4BPFA 3DS5A 2Z45A 2ERHA 3U43A 3NY7B 1X3OA 2K5XA 2N5HA 1T8KA 2QA4P 2CGQA 2GDWA 1VKUA 3Q20A 2KOSA 5HGOA 4GR6A 3LRYA 2CWOA 1KLPA 3CCVP 3G4SP 2VSQA 2CNRA 1QVFO 1E0HA 2KORA 4XROA 3CCJP 2FACA 1VQ6P 2MR8A 2MR7A 4MRTC 2PEQA 2VLNA 1RNIA 1VHNA 4XRQA 1S72P 2JU2A 2LPKA 2FADA 1Z6MA 2K92A 2E1MA 2LTEA 1K30A 2Z44A 3G71P 1A43A 3G1GA 1VQ5P 1AUMA 4UHPB 1QRJA 4PXHB 2K93A 2GDYA 2M5RA 3EJEA 7CEIA 2PEJA 2KOOA 1YJNP 1Q7YQ 4NEOA 1M74A 2JYLA 2WPTA 1MZ8A 1HQBA 3CCLP 2FVFA 1AYIA 2EG5A 2X2BA 2MVVA 3G1IA 3DS4A 4U0CA 2EIAA 1KC8Q 1YITP 2JYGA 2ROQA 2DNWA 5EJDA 4PWVB 1VQKP 4XFZA 3CCSP 1CEIA 2XV6A 5EW5E 3WBHA 3HZQA 2JBGA 1F80D 5F2NA 2AFDA 4U0DA 1ACPA 2N98A 2LIUA 2PNGA 2QEXP 4COPA 4R0MA 2M8NA 2K0DX 2GZGA 1FR2A 5F2OA 1NJIQ 3CCQP 1W2BO
chains in the Genus database with same CATH topology
2ERHA 1CEIA 2GZEA 4F37A 1E0HA 1UJZA 3GKLC 5EW5E 3U43A 2WPTA 1MZ8A 4QKOA 1GXHA 2K5XA 2JBGA 2VLQA 2VLPA 3GJNA 2GZJA 1GXGA 4UHPB 2VLOA 1IMQA 1AYIA 2GYKA 2K0DX 2GZGA 1IMPA 2GZFA 1ZNVA 2NO8A 1FR2A 2JB0A 1EMVA 1BXIA 2VLNA 2GZIA 1UNKA 7CEIA 2JAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERH A;  1CEI A;  2GZE A;  4F37 A;  1E0H A;  1UJZ A;  3GKL C;  5EW5 E;  3U43 A;  2WPT A;  1MZ8 A;  4QKO A;  1GXH A;  2K5X A;  2JBG A;  2VLQ A;  2VLP A;  3GJN A;  2GZJ A;  1GXG A;  4UHP B;  2VLO A;  1IMQ A;  1AYI A;  2GYK A;  2K0D X;  2GZG A;  1IMP A;  2GZF A;  1ZNV A;  2NO8 A;  1FR2 A;  2JB0 A;  1EMV A;  1BXI A;  2VLN A;  2GZI A;  1UNK A;  7CEI A;  2JAZ A; 
#chains in the Genus database with same CATH topology
 2FVE A;  2JGP A;  2KG6 A;  2GZE A;  2DGY A;  2KGA A;  4DG9 A;  1EOQ A;  1KQS O;  2MY5 A;  1M6N A;  3CCU P;  2PEN A;  1RO0 A;  1DV5 A;  1IMQ A;  3I56 P;  2LOL A;  3CCR P;  1VQN P;  2GZI A;  2LIW A;  2L22 A;  4U0A A;  2BHV A;  2K0Y A;  2KOD A;  2JAZ A;  5JPA A;  2L9F A;  3OW2 O;  3GKL C;  2LML A;  2FQ0 A;  3G0V A;  2PY8 A;  1QVG O;  1VQM P;  1K9M Q;  2CG5 B;  4BPG A;  4H2W C;  3H47 A;  2JB0 A;  1EMV A;  3I55 P;  2MVU A;  1VQP P;  1VQ4 P;  2AVA A;  2FAE A;  1E6J P;  3CCE P;  4QKO A;  2KW2 A;  1YJW P;  2GZJ A;  1YI2 P;  4WYM A;  3E2D A;  2OTJ P;  2JQ4 A;  4U0B A;  1BAJ A;  2K94 A;  2M8P A;  4PH0 A;  2K2Q A;  1DNY A;  1N8R Q;  1GXH A;  3RG6 C;  2PEO A;  1Q86 Q;  3CCM P;  4HKG A;  2KWL A;  3RG2 A;  1M6E X;  1L0H A;  1RO2 A;  4PH1 A;  5KP8 B;  2MD9 A;  2QNW A;  3CE7 A;  4IZ6 A;  4U0F A;  1ZMB A;  2PEI A;  3DPH A;  4BPH A;  2EHS A;  3P05 A;  2ONT A;  4CA3 A;  2GDX A;  3G29 A;  1YHQ P;  2FQ1 A;  3H4E A;  1M90 Q;  2XZ0 D;  2MF4 A;  1VQ7 P;  2LKI A;  3CC4 P;  2KOQ A;  3DS0 A;  1K8A Q;  5KP6 B;  1IUQ A;  3HYB A;  2AF8 A;  1VQO P;  1L0I A;  4COC A;  1EIA A;  2N6Z A;  2L4B A;  2N6Y A;  2OAR A;  1D1D A;  5HGL A;  3MGE A;  3G21 A;  3DS3 A;  4M0I A;  3DTJ A;  1VQ8 P;  4XFX A;  5HGM A;  3GZL A;  2Z46 A;  2XZ1 C;  3LMO A;  2XXM A;  1VQL P;  5BS1 A;  5BS2 A;  4GR2 A;  1UJZ A;  3CXC O;  1VQ9 P;  4U0E A;  5HGN A;  1Q81 Q;  3CPW O;  3G28 A;  2FVA A;  1HY8 A;  3H0D A;  1Q82 Q;  2FHS C;  2KG9 A;  3EJD A;  2GZF A;  5DCK A;  1M1K Q;  1BXI A;  3G6E P;  2P9X A;  1KD1 Q;  1YIJ P;  2KR5 A;  5HVC A;  4F37 A;  2KG8 A;  5KP7 B;  3G26 A;  5CZD B;  2FQ2 A;  2BUO A;  2PEK A;  2EFJ A;  4XFY A;  2N5I A;  4QNB A;  2GYK A;  1GPJ A;  3VRL C;  2PEM A;  3CME P;  1AF8 A;  4H2X C;  1UNK A;  2K0X A;  3DS1 A;  1NQ4 A;  2JO0 A;  1YJ9 P;  2VLQ A;  2LL8 A;  4H2Y C;  1GXG A;  5F2K A;  2OTL P;  3EJB A;  3CMA P;  3M1M A;  1OR5 A;  2KOP A;  1JJ2 O;  2KGD A;  3DS2 A;  1A8O A;  2M8L A;  2JU1 A;  3B5I A;  3B4Q A;  2L6E A;  2EHT A;  3CD6 P;  2AFE A;  5HV8 A;  2KGE A;  5I4T G;  3GZM A;  2VLP A;  2CQ8 A;  3GJN A;  2LF4 A;  3CC2 P;  2XT1 A;  1K73 Q;  2N50 A;  2VLO A;  3NTE A;  3CC7 P;  1IMP A;  1ZNV A;  2L0Q A;  2NO8 A;  4IPY A;  2KGC A;  4BPF A;  3DS5 A;  2Z45 A;  2ERH A;  3U43 A;  3NY7 B;  1X3O A;  2K5X A;  2N5H A;  1T8K A;  2QA4 P;  2CGQ A;  2GDW A;  1VKU A;  3Q20 A;  2KOS A;  5HGO A;  4GR6 A;  3LRY A;  2CWO A;  1KLP A;  3CCV P;  3G4S P;  2VSQ A;  2CNR A;  1QVF O;  1E0H A;  2KOR A;  4XRO A;  3CCJ P;  2FAC A;  1VQ6 P;  2MR8 A;  2MR7 A;  4MRT C;  2PEQ A;  2VLN A;  1RNI A;  1VHN A;  4XRQ A;  1S72 P;  2JU2 A;  2LPK A;  2FAD A;  1Z6M A;  2K92 A;  2E1M A;  2LTE A;  1K30 A;  2Z44 A;  3G71 P;  1A43 A;  3G1G A;  1VQ5 P;  1AUM A;  4UHP B;  1QRJ A;  4PXH B;  2K93 A;  2GDY A;  2M5R A;  3EJE A;  7CEI A;  2PEJ A;  2KOO A;  1YJN P;  1Q7Y Q;  4NEO A;  1M74 A;  2JYL A;  2WPT A;  1MZ8 A;  1HQB A;  3CCL P;  2FVF A;  1AYI A;  2EG5 A;  2X2B A;  2MVV A;  3G1I A;  3DS4 A;  4U0C A;  2EIA A;  1KC8 Q;  1YIT P;  2JYG A;  2ROQ A;  2DNW A;  5EJD A;  4PWV B;  1VQK P;  4XFZ A;  3CCS P;  1CEI A;  2XV6 A;  5EW5 E;  3WBH A;  3HZQ A;  2JBG A;  1F80 D;  5F2N A;  2AFD A;  4U0D A;  1ACP A;  2N98 A;  2LIU A;  2PNG A;  2QEX P;  4COP A;  4R0M A;  2M8N A;  2K0D X;  2GZG A;  1FR2 A;  5F2O A;  1NJI Q;  3CCQ P;  1W2B O; 
#chains in the Genus database with same CATH homology
 2ERH A;  1CEI A;  2GZE A;  4F37 A;  1E0H A;  1UJZ A;  3GKL C;  5EW5 E;  3U43 A;  2WPT A;  1MZ8 A;  4QKO A;  1GXH A;  2K5X A;  2JBG A;  2VLQ A;  2VLP A;  3GJN A;  2GZJ A;  1GXG A;  4UHP B;  2VLO A;  1IMQ A;  1AYI A;  2GYK A;  2K0D X;  2GZG A;  1IMP A;  2GZF A;  1ZNV A;  2NO8 A;  1FR2 A;  2JB0 A;  1EMV A;  1BXI A;  2VLN A;  2GZI A;  1UNK A;  7CEI A;  2JAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...