3GJNA

Following evolutionary paths to high affinity and selectivity protein-protein interactions using colicin7 and immunity proteins
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLQLVTTICDAEATSEEELDKLITHFEEMTEHPSGSDLIYWPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Colicin-E9 immunity protein
publication title Following evolutionary paths to protein-protein interactions with high affinity and selectivity
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 3gjnA00
1GXGA 2GZGA 2ERHA 4QKOA 2GZEA 2K0DX 3U43A 7CEIA 2VLOA 1MZ8A 1BXIA 1IMQA 1EMVA 2GZFA 2JBGA 4UHPB 3GJNA 2JAZA 2GZIA 1GXHA 5EW5E 2GZJA 1FR2A 1AYIA 1CEIA 1ZNVA 2WPTA 1UJZA 1E0HA 2VLNA 3GKLC 4F37A 2K5XA 1IMPA 2VLQA 2NO8A 1UNKA 2JB0A 2VLPA 2GYKA
chains in the Genus database with same CATH superfamily
5CZDB 3NY7B 2K93A 2PEIA 2GZEA 2XV6A 2LMLA 1K30A 1BXIA 2FQ2A 4U0FA 2M8NA 1K9MQ 1K73Q 2VSQA 2L22A 2WPTA 3G4SP 3GKLC 4GR2A 2K5XA 1E6JP 3CXCO 1GXGA 5F2OA 5BS1A 5JPAA 1NJIQ 4R0MA 3CCMP 2JYGA 2LKIA 2MF4A 5HGOA 7CEIA 3CPWO 2CNRA 2E1MA 1M1KQ 2KG6A 3CCLP 2PEMA 1VQKP 1AF8A 3CC4P 3CCEP 1Q82Q 5KP6B 4PH1A 4PWVB 2QEXP 4U0AA 2LOLA 1QVFO 2AF8A 3CCVP 1VQPP 2FVEA 1N8RQ 2CG5B 1YJ9P 5EJDA 1L0IA 5HGLA 3G21A 4XFZA 2Z45A 2KW2A 1W2BO 2KWLA 3U43A 3DS1A 3EJDA 1RO2A 1L0HA 2CGQA 3GZLA 1FR2A 2PEQA 3HYBA 2FADA 3CCSP 2LIUA 3G0VA 3I55P 2JU2A 1VQ8P 2CWOA 1QVGO 2EFJA 2AVAA 1YITP 3G26A 1AUMA 4BPFA 2KR5A 3DPHA 5HV8A 5EW5E 4WYMA 3CCRP 2KOOA 3H4EA 1AYIA 2JQ4A 4MRTC 2LPKA 1ZNVA 1KQSO 1EOQA 2AFDA 2NO8A 1JJ2O 1A8OA 2K0DX 2K92A 2N6ZA 1EMVA 2GZFA 2XXMA 3CC2P 2GDYA 3CCQP 5HVCA 4PXHB 2MR8A 5KP7B 3RG2A 2L0QA 5F2NA 3G6EP 2DGYA 4XROA 3B5IA 2MD9A 3NTEA 2MVVA 4IPYA 4GR6A 3EJBA 1M6EX 3G29A 3M1MA 3P05A 1K8AQ 2EIAA 5I4TG 3DS3A 2KG9A 3LMOA 2PENA 1Q7YQ 5DCKA 2FVAA 1OR5A 2JO0A 1VHNA 4XFXA 3DS0A 2KOSA 2LL8A 2BHVA 4U0CA 2VLNA 1VQ7P 3CCUP 5BS2A 3B4QA 3DTJA 2KORA 3LRYA 2OTJP 2M5RA 1KC8Q 2EG5A 3GJNA 4U0BA 3CCJP 2FACA 2KODA 1DV5A 1VQMP 2KGDA 1GPJA 1E0HA 3Q20A 2FHSC 1BAJA 4PH0A 3CC7P 2M8PA 4DG9A 3WBHA 2VLOA 3CMAP 1RNIA 2X2BA 2N50A 3E2DA 3CMEP 2GZJA 2OARA 2DNWA 1YJNP 1VQ9P 1CEIA 3I56P 2PEKA 4F37A 3H0DA 1M90Q 4H2XC 2KG8A 1KD1Q 2JU1A 4CA3A 2LIWA 2KOQA 3G28A 1HY8A 2GDXA 2CQ8A 4XRQA 2JAZA 2GZIA 1KLPA 2EHSA 2XZ1C 2PY8A 1UJZA 2EHTA 2K0YA 3CE7A 4BPGA 1YHQP 5F2KA 5HGMA 2ERHA 4QKOA 3DS4A 1ACPA 1Z6MA 1GXHA 3H47A 1X3OA 1QRJA 3VRLC 4QNBA 3GZMA 4H2WC 2P9XA 2AFEA 2OTLP 1YIJP 2GYKA 1YJWP 1EIAA 2GZGA 5KP8B 3G1GA 2JGPA 1M6NA 1M74A 2Z44A 2KGEA 3CD6P 2FQ1A 2MR7A 3G1IA 3DS5A 2PEOA 2K0XA 2K94A 2FAEA 1IUQA 2N6YA 2XZ0D 4BPHA 4UHPB 2ROQA 3EJEA 1A43A 4NEOA 2MY5A 2LF4A 2L9FA 2MVUA 2QNWA 3DS2A 2N5IA 1VQOP 2GDWA 2N5HA 2QA4P 2Z46A 2VLQA 2JB0A 3MGEA 1HQBA 1YI2P 4U0DA 4COPA 4HKGA 2N98A 1MZ8A 5HGNA 2KOPA 2JBGA 3OW2O 3G71P 2KGCA 2L6EA 4U0EA 1VQLP 2PNGA 1VKUA 4COCA 1RO0A 2K2QA 1DNYA 2ONTA 1IMPA 1VQNP 2VLPA 2PEJA 2BUOA 2M8LA 4M0IA 2LTEA 1T8KA 1ZMBA 1VQ5P 1D1DA 4IZ6A 1IMQA 1VQ4P 1Q86Q 1NQ4A 2FQ0A 1Q81Q 3RG6C 1S72P 2XT1A 2L4BA 1F80D 2FVFA 4H2YC 2KGAA 1VQ6P 1UNKA 4XFYA 2JYLA 3HZQA
chains in the Genus database with same CATH topology
1GXGA 2GZGA 2ERHA 4QKOA 2GZEA 2K0DX 3U43A 7CEIA 2VLOA 1MZ8A 1BXIA 1IMQA 1EMVA 2GZFA 2JBGA 4UHPB 3GJNA 2JAZA 2GZIA 1GXHA 5EW5E 2GZJA 1FR2A 1AYIA 1CEIA 1ZNVA 2WPTA 1UJZA 1E0HA 2VLNA 3GKLC 4F37A 2K5XA 1IMPA 2VLQA 2NO8A 1UNKA 2JB0A 2VLPA 2GYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXG A;  2GZG A;  2ERH A;  4QKO A;  2GZE A;  2K0D X;  3U43 A;  7CEI A;  2VLO A;  1MZ8 A;  1BXI A;  1IMQ A;  1EMV A;  2GZF A;  2JBG A;  4UHP B;  3GJN A;  2JAZ A;  2GZI A;  1GXH A;  5EW5 E;  2GZJ A;  1FR2 A;  1AYI A;  1CEI A;  1ZNV A;  2WPT A;  1UJZ A;  1E0H A;  2VLN A;  3GKL C;  4F37 A;  2K5X A;  1IMP A;  2VLQ A;  2NO8 A;  1UNK A;  2JB0 A;  2VLP A;  2GYK A; 
#chains in the Genus database with same CATH topology
 5CZD B;  3NY7 B;  2K93 A;  2PEI A;  2GZE A;  2XV6 A;  2LML A;  1K30 A;  1BXI A;  2FQ2 A;  4U0F A;  2M8N A;  1K9M Q;  1K73 Q;  2VSQ A;  2L22 A;  2WPT A;  3G4S P;  3GKL C;  4GR2 A;  2K5X A;  1E6J P;  3CXC O;  1GXG A;  5F2O A;  5BS1 A;  5JPA A;  1NJI Q;  4R0M A;  3CCM P;  2JYG A;  2LKI A;  2MF4 A;  5HGO A;  7CEI A;  3CPW O;  2CNR A;  2E1M A;  1M1K Q;  2KG6 A;  3CCL P;  2PEM A;  1VQK P;  1AF8 A;  3CC4 P;  3CCE P;  1Q82 Q;  5KP6 B;  4PH1 A;  4PWV B;  2QEX P;  4U0A A;  2LOL A;  1QVF O;  2AF8 A;  3CCV P;  1VQP P;  2FVE A;  1N8R Q;  2CG5 B;  1YJ9 P;  5EJD A;  1L0I A;  5HGL A;  3G21 A;  4XFZ A;  2Z45 A;  2KW2 A;  1W2B O;  2KWL A;  3U43 A;  3DS1 A;  3EJD A;  1RO2 A;  1L0H A;  2CGQ A;  3GZL A;  1FR2 A;  2PEQ A;  3HYB A;  2FAD A;  3CCS P;  2LIU A;  3G0V A;  3I55 P;  2JU2 A;  1VQ8 P;  2CWO A;  1QVG O;  2EFJ A;  2AVA A;  1YIT P;  3G26 A;  1AUM A;  4BPF A;  2KR5 A;  3DPH A;  5HV8 A;  5EW5 E;  4WYM A;  3CCR P;  2KOO A;  3H4E A;  1AYI A;  2JQ4 A;  4MRT C;  2LPK A;  1ZNV A;  1KQS O;  1EOQ A;  2AFD A;  2NO8 A;  1JJ2 O;  1A8O A;  2K0D X;  2K92 A;  2N6Z A;  1EMV A;  2GZF A;  2XXM A;  3CC2 P;  2GDY A;  3CCQ P;  5HVC A;  4PXH B;  2MR8 A;  5KP7 B;  3RG2 A;  2L0Q A;  5F2N A;  3G6E P;  2DGY A;  4XRO A;  3B5I A;  2MD9 A;  3NTE A;  2MVV A;  4IPY A;  4GR6 A;  3EJB A;  1M6E X;  3G29 A;  3M1M A;  3P05 A;  1K8A Q;  2EIA A;  5I4T G;  3DS3 A;  2KG9 A;  3LMO A;  2PEN A;  1Q7Y Q;  5DCK A;  2FVA A;  1OR5 A;  2JO0 A;  1VHN A;  4XFX A;  3DS0 A;  2KOS A;  2LL8 A;  2BHV A;  4U0C A;  2VLN A;  1VQ7 P;  3CCU P;  5BS2 A;  3B4Q A;  3DTJ A;  2KOR A;  3LRY A;  2OTJ P;  2M5R A;  1KC8 Q;  2EG5 A;  3GJN A;  4U0B A;  3CCJ P;  2FAC A;  2KOD A;  1DV5 A;  1VQM P;  2KGD A;  1GPJ A;  1E0H A;  3Q20 A;  2FHS C;  1BAJ A;  4PH0 A;  3CC7 P;  2M8P A;  4DG9 A;  3WBH A;  2VLO A;  3CMA P;  1RNI A;  2X2B A;  2N50 A;  3E2D A;  3CME P;  2GZJ A;  2OAR A;  2DNW A;  1YJN P;  1VQ9 P;  1CEI A;  3I56 P;  2PEK A;  4F37 A;  3H0D A;  1M90 Q;  4H2X C;  2KG8 A;  1KD1 Q;  2JU1 A;  4CA3 A;  2LIW A;  2KOQ A;  3G28 A;  1HY8 A;  2GDX A;  2CQ8 A;  4XRQ A;  2JAZ A;  2GZI A;  1KLP A;  2EHS A;  2XZ1 C;  2PY8 A;  1UJZ A;  2EHT A;  2K0Y A;  3CE7 A;  4BPG A;  1YHQ P;  5F2K A;  5HGM A;  2ERH A;  4QKO A;  3DS4 A;  1ACP A;  1Z6M A;  1GXH A;  3H47 A;  1X3O A;  1QRJ A;  3VRL C;  4QNB A;  3GZM A;  4H2W C;  2P9X A;  2AFE A;  2OTL P;  1YIJ P;  2GYK A;  1YJW P;  1EIA A;  2GZG A;  5KP8 B;  3G1G A;  2JGP A;  1M6N A;  1M74 A;  2Z44 A;  2KGE A;  3CD6 P;  2FQ1 A;  2MR7 A;  3G1I A;  3DS5 A;  2PEO A;  2K0X A;  2K94 A;  2FAE A;  1IUQ A;  2N6Y A;  2XZ0 D;  4BPH A;  4UHP B;  2ROQ A;  3EJE A;  1A43 A;  4NEO A;  2MY5 A;  2LF4 A;  2L9F A;  2MVU A;  2QNW A;  3DS2 A;  2N5I A;  1VQO P;  2GDW A;  2N5H A;  2QA4 P;  2Z46 A;  2VLQ A;  2JB0 A;  3MGE A;  1HQB A;  1YI2 P;  4U0D A;  4COP A;  4HKG A;  2N98 A;  1MZ8 A;  5HGN A;  2KOP A;  2JBG A;  3OW2 O;  3G71 P;  2KGC A;  2L6E A;  4U0E A;  1VQL P;  2PNG A;  1VKU A;  4COC A;  1RO0 A;  2K2Q A;  1DNY A;  2ONT A;  1IMP A;  1VQN P;  2VLP A;  2PEJ A;  2BUO A;  2M8L A;  4M0I A;  2LTE A;  1T8K A;  1ZMB A;  1VQ5 P;  1D1D A;  4IZ6 A;  1IMQ A;  1VQ4 P;  1Q86 Q;  1NQ4 A;  2FQ0 A;  1Q81 Q;  3RG6 C;  1S72 P;  2XT1 A;  2L4B A;  1F80 D;  2FVF A;  4H2Y C;  2KGA A;  1VQ6 P;  1UNK A;  4XFY A;  2JYL A;  3HZQ A; 
#chains in the Genus database with same CATH homology
 1GXG A;  2GZG A;  2ERH A;  4QKO A;  2GZE A;  2K0D X;  3U43 A;  7CEI A;  2VLO A;  1MZ8 A;  1BXI A;  1IMQ A;  1EMV A;  2GZF A;  2JBG A;  4UHP B;  3GJN A;  2JAZ A;  2GZI A;  1GXH A;  5EW5 E;  2GZJ A;  1FR2 A;  1AYI A;  1CEI A;  1ZNV A;  2WPT A;  1UJZ A;  1E0H A;  2VLN A;  3GKL C;  4F37 A;  2K5X A;  1IMP A;  2VLQ A;  2NO8 A;  1UNK A;  2JB0 A;  2VLP A;  2GYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...