3DS5A

Hiv-1 capsid c-terminal domain mutant (n183a)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
73
structure length
73
Chain Sequence
b'SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKAWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 CAPSID PROTEIN
publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 28
structure length 73
sequence length 73
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ds5A00
3DS2A 4PH0A 5HGOA 2KODA 3DS0A 4PH1A 3H4EA 4U0CA 4U0DA 3VRLC 1D1DA 3P05A 2L6EA 1E6JP 4WYMA 3DS3A 4COPA 3G26A 1EOQA 2M8NA 5HGMA 5JPAA 3G21A 5I4TG 3G1IA 2JYGA 3DS4A 2XV6A 2LF4A 4M0IA 2ONTA 3G1GA 5HGNA 3DS5A 4XFYA 3DPHA 2XT1A 1BAJA 3DTJA 4U0AA 3G29A 4XFZA 4U0FA 3MGEA 1AUMA 4XROA 2M8LA 3G28A 2BUOA 4IPYA 5HGLA 3G0VA 4COCA 1QRJA 4XRQA 4U0EA 2JYLA 1A8OA 1EIAA 2JO0A 2M8PA 1A43A 2XXMA 3NTEA 5DCKA 3H47A 4XFXA 4U0BA 3LRYA 2EIAA 4QNBA 3DS1A
chains in the Genus database with same CATH superfamily
3VRLC 3CCRP 2GZEA 3GKLC 2KOSA 3Q20A 2FQ0A 1KC8Q 1W2BO 2FQ1A 2QNWA 3G1GA 2GZGA 1AYIA 1DNYA 2N5HA 1GPJA 2ROQA 1YITP 2LIUA 1QRJA 4U0EA 2GDXA 3DS3A 1HQBA 1M1KQ 1VQMP 2XZ1C 2ONTA 2VLOA 3I56P 2FAEA 1AUMA 1AF8A 4GR2A 2JYLA 2KG8A 1VQ7P 1S72P 1NQ4A 2FHSC 1IUQA 3CMEP 2GZIA 2GZJA 2MY5A 5HGMA 2KR5A 5I4TG 3CCUP 5KP6B 3CE7A 5HGNA 4PXHB 2CG5B 3H0DA 3DPHA 3CMAP 1GXHA 3G29A 3MGEA 2DNWA 2K5XA 1K73Q 2KG9A 5BS2A 1IMQA 3H47A 2BHVA 2MR8A 4U0CA 2M8NA 1YJ9P 3CC2P 5HVCA 2L0QA 2LF4A 1Q82Q 1OR5A 2XT1A 4UHPB 1YJWP 7CEIA 1Q7YQ 2OTJP 2LL8A 1M6NA 2N98A 2CNRA 2AFDA 3GZMA 2K93A 1GXGA 3CCSP 1BAJA 2MR7A 3B4QA 1VKUA 4XRQA 2LTEA 3NTEA 1FR2A 4XFXA 2K94A 2PEMA 1M90Q 3CC7P 1DV5A 2N50A 1UJZA 2KGCA 3CCQP 2PEIA 2K92A 2M8LA 5HGLA 1EIAA 4PWVB 2GYKA 1QVFO 4F37A 4NEOA 1VQ8P 2M5RA 2VLQA 5EW5E 2MVVA 3G71P 4R0MA 2ERHA 2KOOA 1VQ9P 4U0FA 2K0DX 1X3OA 5CZDB 1ACPA 3M1MA 1YIJP 1VQNP 3LRYA 3OW2O 2KODA 1IMPA 2L6EA 1YHQP 2VLPA 5F2OA 3RG6C 3DS4A 2XV6A 2FADA 3LMOA 1ZMBA 2JB0A 4QKOA 1Z6MA 2JO0A 3GJNA 2Z46A 2EIAA 3DS1A 2JU1A 5HGOA 3EJDA 2CWOA 1K30A 1RO2A 3G21A 5JPAA 5BS1A 2KWLA 1E0HA 4BPGA 1ZNVA 3GZLA 1RO0A 3CPWO 2FVEA 2KW2A 3HZQA 5EJDA 3B5IA 4PH0A 2QEXP 2PEKA 1VQPP 3CXCO 1F80D 2MF4A 2VLNA 3EJBA 2PEJA 2AF8A 3G6EP 2JU2A 4BPFA 2LMLA 4XROA 2LOLA 1L0HA 2PEQA 3U43A 2E1MA 2NO8A 5DCKA 1A43A 4IZ6A 2KGAA 2LIWA 3DS0A 2KG6A 2PY8A 2PNGA 3WBHA 4H2WC 1YJNP 1YI2P 2K0YA 2MD9A 2CQ8A 1KLPA 4U0AA 2OARA 3G0VA 4CA3A 2XXMA 3CCLP 1D1DA 4H2XC 4QNBA 2X2BA 4DG9A 2LPKA 3P05A 1E6JP 2JAZA 2JBGA 1EOQA 1VQ6P 1VQ4P 3G1IA 2QA4P 3CCEP 2EFJA 2Z44A 5F2NA 3DS5A 4MRTC 5KP8B 2VSQA 4XFZA 4BPHA 2CGQA 2K0XA 2EHTA 2MVUA 3CCVP 2AVAA 2L4BA 1RNIA 2EG5A 2P9XA 3EJEA 2DGYA 4COCA 3DS2A 3CCMP 2PENA 5F2KA 2LKIA 1CEIA 1KQSO 2OTLP 3HYBA 4H2YC 1M6EX 2L9FA 3G28A 1Q81Q 1K8AQ 1VHNA 2XZ0D 1A8OA 1EMVA 4HKGA 3NY7B 4PH1A 2GZFA 1Q86Q 3RG2A 3CC4P 1VQOP 2FQ2A 1BXIA 1N8RQ 2FACA 1VQLP 2JYGA 5KP7B 2FVAA 3DTJA 2WPTA 2EHSA 2K2QA 2AFEA 2N5IA 1QVGO 4WYMA 1M74A 3G26A 2N6YA 1NJIQ 1VQ5P 2L22A 4M0IA 1VQKP 2KOQA 2FVFA 1K9MQ 2JGPA 1L0IA 2JQ4A 2KORA 5HV8A 2PEOA 1T8KA 2BUOA 2M8PA 1MZ8A 2KGEA 4U0BA 4GR6A 1KD1Q 4U0DA 3H4EA 4COPA 2N6ZA 1HY8A 2GDWA 3I55P 2KOPA 1UNKA 3CD6P 4XFYA 3G4SP 2KGDA 3CCJP 2Z45A 4IPYA 3E2DA 1JJ2O 2GDYA
chains in the Genus database with same CATH topology
3DS2A 5HGOA 3CCMP 2PENA 3VRLC 3CCRP 3Q20A 5F2KA 2CWOA 1K30A 1RO2A 3G21A 5JPAA 1KC8Q 1KQSO 1W2BO 2OTLP 3HYBA 5BS1A 3G1GA 3CCSP 1BAJA 1M6EX 1YITP 3G28A 1Q81Q 1K8AQ 1QRJA 4XRQA 4U0EA 1RO0A 3NTEA 1A8OA 3CPWO 4XFXA 3HZQA 2PEMA 3B5IA 4PH0A 2QEXP 4PH1A 1M90Q 2PEKA 1Q86Q 3CC4P 3CC7P 3DS3A 1VQOP 1VQPP 3CXCO 1N8RQ 1VQLP 1M1KQ 2JYGA 1VQMP 2PEJA 2ONTA 3G6EP 3I56P 3DTJA 3CCQP 2PEIA 1AUMA 4XROA 2M8LA 2PEQA 4GR2A 5HGLA 2E1MA 1EIAA 2JYLA 5DCKA 1VQ7P 1A43A 1S72P 1QVFO 1VQ8P 3DS0A 1IUQA 2PY8A 4WYMA 1QVGO 3CMEP 1M74A 3G26A 3WBHA 3G71P 5HGMA 1NJIQ 1YJNP 1VQ5P 5I4TG 1YI2P 4M0IA 3CCUP 1VQKP 5HGNA 1K9MQ 3H0DA 3CMAP 3DPHA 4U0AA 3G29A 1VQ9P 4U0FA 3MGEA 2PEOA 2BUOA 1K73Q 2OARA 3G0VA 3M1MA 2M8PA 5BS2A 1YIJP 2XXMA 3H47A 1VQNP 3CCLP 4U0BA 3LRYA 3OW2O 1D1DA 4QNBA 4GR6A 1KD1Q 2BHVA 2KODA 4U0DA 3H4EA 4U0CA 3P05A 2L6EA 1E6JP 1YHQP 4COPA 1EOQA 5F2OA 2M8NA 1VQ6P 1YJ9P 3CC2P 3RG6C 3I55P 1VQ4P 3G1IA 2QA4P 3DS4A 2XV6A 2LF4A 3CCEP 2EFJA 2Z44A 5F2NA 3CD6P 3DS5A 1Q82Q 4XFYA 2XT1A 3G4SP 1ZMBA 4XFZA 1YJWP 3CCJP 1Q7YQ 2OTJP 2Z45A 4IPYA 3E2DA 4COCA 3CCVP 2JO0A 1M6NA 1RNIA 2EG5A 2P9XA 2Z46A 1JJ2O 2EIAA 2DGYA 3DS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS2 A;  4PH0 A;  5HGO A;  2KOD A;  3DS0 A;  4PH1 A;  3H4E A;  4U0C A;  4U0D A;  3VRL C;  1D1D A;  3P05 A;  2L6E A;  1E6J P;  4WYM A;  3DS3 A;  4COP A;  3G26 A;  1EOQ A;  2M8N A;  5HGM A;  5JPA A;  3G21 A;  5I4T G;  3G1I A;  2JYG A;  3DS4 A;  2XV6 A;  2LF4 A;  4M0I A;  2ONT A;  3G1G A;  5HGN A;  3DS5 A;  4XFY A;  3DPH A;  2XT1 A;  1BAJ A;  3DTJ A;  4U0A A;  3G29 A;  4XFZ A;  4U0F A;  3MGE A;  1AUM A;  4XRO A;  2M8L A;  3G28 A;  2BUO A;  4IPY A;  5HGL A;  3G0V A;  4COC A;  1QRJ A;  4XRQ A;  4U0E A;  2JYL A;  1A8O A;  1EIA A;  2JO0 A;  2M8P A;  1A43 A;  2XXM A;  3NTE A;  5DCK A;  3H47 A;  4XFX A;  4U0B A;  3LRY A;  2EIA A;  4QNB A;  3DS1 A; 
#chains in the Genus database with same CATH topology
 3VRL C;  3CCR P;  2GZE A;  3GKL C;  2KOS A;  3Q20 A;  2FQ0 A;  1KC8 Q;  1W2B O;  2FQ1 A;  2QNW A;  3G1G A;  2GZG A;  1AYI A;  1DNY A;  2N5H A;  1GPJ A;  2ROQ A;  1YIT P;  2LIU A;  1QRJ A;  4U0E A;  2GDX A;  3DS3 A;  1HQB A;  1M1K Q;  1VQM P;  2XZ1 C;  2ONT A;  2VLO A;  3I56 P;  2FAE A;  1AUM A;  1AF8 A;  4GR2 A;  2JYL A;  2KG8 A;  1VQ7 P;  1S72 P;  1NQ4 A;  2FHS C;  1IUQ A;  3CME P;  2GZI A;  2GZJ A;  2MY5 A;  5HGM A;  2KR5 A;  5I4T G;  3CCU P;  5KP6 B;  3CE7 A;  5HGN A;  4PXH B;  2CG5 B;  3H0D A;  3DPH A;  3CMA P;  1GXH A;  3G29 A;  3MGE A;  2DNW A;  2K5X A;  1K73 Q;  2KG9 A;  5BS2 A;  1IMQ A;  3H47 A;  2BHV A;  2MR8 A;  4U0C A;  2M8N A;  1YJ9 P;  3CC2 P;  5HVC A;  2L0Q A;  2LF4 A;  1Q82 Q;  1OR5 A;  2XT1 A;  4UHP B;  1YJW P;  7CEI A;  1Q7Y Q;  2OTJ P;  2LL8 A;  1M6N A;  2N98 A;  2CNR A;  2AFD A;  3GZM A;  2K93 A;  1GXG A;  3CCS P;  1BAJ A;  2MR7 A;  3B4Q A;  1VKU A;  4XRQ A;  2LTE A;  3NTE A;  1FR2 A;  4XFX A;  2K94 A;  2PEM A;  1M90 Q;  3CC7 P;  1DV5 A;  2N50 A;  1UJZ A;  2KGC A;  3CCQ P;  2PEI A;  2K92 A;  2M8L A;  5HGL A;  1EIA A;  4PWV B;  2GYK A;  1QVF O;  4F37 A;  4NEO A;  1VQ8 P;  2M5R A;  2VLQ A;  5EW5 E;  2MVV A;  3G71 P;  4R0M A;  2ERH A;  2KOO A;  1VQ9 P;  4U0F A;  2K0D X;  1X3O A;  5CZD B;  1ACP A;  3M1M A;  1YIJ P;  1VQN P;  3LRY A;  3OW2 O;  2KOD A;  1IMP A;  2L6E A;  1YHQ P;  2VLP A;  5F2O A;  3RG6 C;  3DS4 A;  2XV6 A;  2FAD A;  3LMO A;  1ZMB A;  2JB0 A;  4QKO A;  1Z6M A;  2JO0 A;  3GJN A;  2Z46 A;  2EIA A;  3DS1 A;  2JU1 A;  5HGO A;  3EJD A;  2CWO A;  1K30 A;  1RO2 A;  3G21 A;  5JPA A;  5BS1 A;  2KWL A;  1E0H A;  4BPG A;  1ZNV A;  3GZL A;  1RO0 A;  3CPW O;  2FVE A;  2KW2 A;  3HZQ A;  5EJD A;  3B5I A;  4PH0 A;  2QEX P;  2PEK A;  1VQP P;  3CXC O;  1F80 D;  2MF4 A;  2VLN A;  3EJB A;  2PEJ A;  2AF8 A;  3G6E P;  2JU2 A;  4BPF A;  2LML A;  4XRO A;  2LOL A;  1L0H A;  2PEQ A;  3U43 A;  2E1M A;  2NO8 A;  5DCK A;  1A43 A;  4IZ6 A;  2KGA A;  2LIW A;  3DS0 A;  2KG6 A;  2PY8 A;  2PNG A;  3WBH A;  4H2W C;  1YJN P;  1YI2 P;  2K0Y A;  2MD9 A;  2CQ8 A;  1KLP A;  4U0A A;  2OAR A;  3G0V A;  4CA3 A;  2XXM A;  3CCL P;  1D1D A;  4H2X C;  4QNB A;  2X2B A;  4DG9 A;  2LPK A;  3P05 A;  1E6J P;  2JAZ A;  2JBG A;  1EOQ A;  1VQ6 P;  1VQ4 P;  3G1I A;  2QA4 P;  3CCE P;  2EFJ A;  2Z44 A;  5F2N A;  3DS5 A;  4MRT C;  5KP8 B;  2VSQ A;  4XFZ A;  4BPH A;  2CGQ A;  2K0X A;  2EHT A;  2MVU A;  3CCV P;  2AVA A;  2L4B A;  1RNI A;  2EG5 A;  2P9X A;  3EJE A;  2DGY A;  4COC A;  3DS2 A;  3CCM P;  2PEN A;  5F2K A;  2LKI A;  1CEI A;  1KQS O;  2OTL P;  3HYB A;  4H2Y C;  1M6E X;  2L9F A;  3G28 A;  1Q81 Q;  1K8A Q;  1VHN A;  2XZ0 D;  1A8O A;  1EMV A;  4HKG A;  3NY7 B;  4PH1 A;  2GZF A;  1Q86 Q;  3RG2 A;  3CC4 P;  1VQO P;  2FQ2 A;  1BXI A;  1N8R Q;  2FAC A;  1VQL P;  2JYG A;  5KP7 B;  2FVA A;  3DTJ A;  2WPT A;  2EHS A;  2K2Q A;  2AFE A;  2N5I A;  1QVG O;  4WYM A;  1M74 A;  3G26 A;  2N6Y A;  1NJI Q;  1VQ5 P;  2L22 A;  4M0I A;  1VQK P;  2KOQ A;  2FVF A;  1K9M Q;  2JGP A;  1L0I A;  2JQ4 A;  2KOR A;  5HV8 A;  2PEO A;  1T8K A;  2BUO A;  2M8P A;  1MZ8 A;  2KGE A;  4U0B A;  4GR6 A;  1KD1 Q;  4U0D A;  3H4E A;  4COP A;  2N6Z A;  1HY8 A;  2GDW A;  3I55 P;  2KOP A;  1UNK A;  3CD6 P;  4XFY A;  3G4S P;  2KGD A;  3CCJ P;  2Z45 A;  4IPY A;  3E2D A;  1JJ2 O;  2GDY A; 
#chains in the Genus database with same CATH homology
 3DS2 A;  5HGO A;  3CCM P;  2PEN A;  3VRL C;  3CCR P;  3Q20 A;  5F2K A;  2CWO A;  1K30 A;  1RO2 A;  3G21 A;  5JPA A;  1KC8 Q;  1KQS O;  1W2B O;  2OTL P;  3HYB A;  5BS1 A;  3G1G A;  3CCS P;  1BAJ A;  1M6E X;  1YIT P;  3G28 A;  1Q81 Q;  1K8A Q;  1QRJ A;  4XRQ A;  4U0E A;  1RO0 A;  3NTE A;  1A8O A;  3CPW O;  4XFX A;  3HZQ A;  2PEM A;  3B5I A;  4PH0 A;  2QEX P;  4PH1 A;  1M90 Q;  2PEK A;  1Q86 Q;  3CC4 P;  3CC7 P;  3DS3 A;  1VQO P;  1VQP P;  3CXC O;  1N8R Q;  1VQL P;  1M1K Q;  2JYG A;  1VQM P;  2PEJ A;  2ONT A;  3G6E P;  3I56 P;  3DTJ A;  3CCQ P;  2PEI A;  1AUM A;  4XRO A;  2M8L A;  2PEQ A;  4GR2 A;  5HGL A;  2E1M A;  1EIA A;  2JYL A;  5DCK A;  1VQ7 P;  1A43 A;  1S72 P;  1QVF O;  1VQ8 P;  3DS0 A;  1IUQ A;  2PY8 A;  4WYM A;  1QVG O;  3CME P;  1M74 A;  3G26 A;  3WBH A;  3G71 P;  5HGM A;  1NJI Q;  1YJN P;  1VQ5 P;  5I4T G;  1YI2 P;  4M0I A;  3CCU P;  1VQK P;  5HGN A;  1K9M Q;  3H0D A;  3CMA P;  3DPH A;  4U0A A;  3G29 A;  1VQ9 P;  4U0F A;  3MGE A;  2PEO A;  2BUO A;  1K73 Q;  2OAR A;  3G0V A;  3M1M A;  2M8P A;  5BS2 A;  1YIJ P;  2XXM A;  3H47 A;  1VQN P;  3CCL P;  4U0B A;  3LRY A;  3OW2 O;  1D1D A;  4QNB A;  4GR6 A;  1KD1 Q;  2BHV A;  2KOD A;  4U0D A;  3H4E A;  4U0C A;  3P05 A;  2L6E A;  1E6J P;  1YHQ P;  4COP A;  1EOQ A;  5F2O A;  2M8N A;  1VQ6 P;  1YJ9 P;  3CC2 P;  3RG6 C;  3I55 P;  1VQ4 P;  3G1I A;  2QA4 P;  3DS4 A;  2XV6 A;  2LF4 A;  3CCE P;  2EFJ A;  2Z44 A;  5F2N A;  3CD6 P;  3DS5 A;  1Q82 Q;  4XFY A;  2XT1 A;  3G4S P;  1ZMB A;  4XFZ A;  1YJW P;  3CCJ P;  1Q7Y Q;  2OTJ P;  2Z45 A;  4IPY A;  3E2D A;  4COC A;  3CCV P;  2JO0 A;  1M6N A;  1RNI A;  2EG5 A;  2P9X A;  2Z46 A;  1JJ2 O;  2EIA A;  2DGY A;  3DS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...