3DS5A

Hiv-1 capsid c-terminal domain mutant (n183a)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
73
structure length
73
Chain Sequence
SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKAWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 CAPSID PROTEIN
publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 28
structure length 73
sequence length 73
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ds5A00
3G1GA 5HGMA 1EIAA 4M0IA 3DS4A 4U0CA 2XT1A 4XFZA 3H47A 3DTJA 4IPYA 3G21A 5HGLA 2LF4A 5JPAA 5HGOA 2JO0A 5HGNA 4XROA 2XXMA 2M8LA 1A8OA 2JYGA 1A43A 2ONTA 4PH0A 4COCA 4U0BA 2BUOA 2JYLA 1E6JP 3G1IA 4XRQA 3G26A 1AUMA 4WYMA 4XFXA 3DS0A 3P05A 4U0EA 3G29A 1BAJA 3DS3A 5DCKA 4COPA 3H4EA 4PH1A 3VRLC 3DS1A 4QNBA 1QRJA 2EIAA 3MGEA 3G0VA 4U0FA 3DS5A 4U0DA 2XV6A 5I4TG 3DS2A 2M8NA 2M8PA 3G28A 4XFYA 3DPHA 4U0AA 1EOQA 2KODA 1D1DA 3NTEA 2L6EA 3LRYA
chains in the Genus database with same CATH superfamily
1K9MQ 3H0DA 3GZLA 2PEJA 3G1IA 3G26A 1BAJA 2NO8A 3CC4P 1L0IA 2M8NA 3CCSP 2K93A 5HGLA 4H2XC 2JBGA 2N6YA 2L6EA 2ROQA 2M8LA 2GZGA 2MVUA 1VQ8P 2X2BA 2PEMA 3CCQP 2LL8A 3G21A 4MRTC 1IMQA 1VQ6P 2JO0A 4DG9A 1VQ9P 2LKIA 7CEIA 2MF4A 1M6EX 4CA3A 2K92A 3DPHA 2GDYA 1X3OA 1JJ2O 4HKGA 4XFZA 2GZJA 1VQPP 5HGOA 3CE7A 2EHTA 3HYBA 3CCVP 2QEXP 2L22A 1Q81Q 3DS1A 2EIAA 5HVCA 1Q7YQ 3G28A 2M8PA 4XFYA 1N8RQ 2PEKA 1EIAA 2K2QA 1AYIA 1HY8A 2AFDA 3CCEP 1F80D 1OR5A 4COCA 4U0BA 1E0HA 3CC7P 5F2KA 3CMAP 4COPA 2VLOA 1FR2A 2KGCA 1VQMP 1EMVA 3EJDA 2JAZA 2AFEA 4PXHB 2P9XA 1UNKA 2N98A 1QVFO 2CG5B 1Z6MA 2ERHA 2MVVA 1K73Q 4H2WC 1CEIA 5F2OA 1M1KQ 3DS0A 1YIJP 1VQKP 5EJDA 1YITP 5DCKA 2XZ1C 2Z44A 3H4EA 1L0HA 2N50A 2FVAA 2N6ZA 2FVEA 2PEIA 3DS4A 1ZMBA 3U43A 2MD9A 1M6NA 1VQNP 4NEOA 1YJNP 3CCLP 2K94A 2KOPA 3GKLC 3E2DA 2LIWA 1D1DA 4U0FA 3DS2A 3RG6C 3LMOA 3G6EP 3M1MA 2OTLP 2GZFA 2K0XA 1GPJA 4PWVB 4QKOA 4GR6A 5JPAA 4BPHA 2FQ1A 2AF8A 2LIUA 4XRQA 4U0EA 1GXHA 3G29A 3CD6P 2GYKA 3VRLC 3CPWO 3Q20A 3GZMA 2K0YA 1ACPA 3G1GA 2DGYA 2K5XA 2GDXA 2LPKA 1IUQA 3DS3A 1KLPA 4BPGA 2JB0A 3G0VA 2GDWA 1KD1Q 1QVGO 3B5IA 2EFJA 3G71P 2CWOA 2KORA 2CNRA 2FVFA 1UJZA 2KG6A 3NY7B 2L4BA 2MR7A 2LMLA 2M5RA 1K8AQ 1ZNVA 1IMPA 4U0DA 5KP8B 3OW2O 4M0IA 2VLPA 2N5HA 2XT1A 1NQ4A 1BXIA 2JU2A 2Z45A 1RO2A 1AUMA 3GJNA 4H2YC 2BHVA 1KC8Q 2LTEA 1QRJA 2KOSA 5I4TG 1MZ8A 3CCJP 2KGEA 2OTJP 2FAEA 4IZ6A 1DV5A 2MR8A 1RNIA 1RO0A 2KGAA 1VQLP 3EJBA 2JYLA 3B4QA 3CCUP 4BPFA 1YJWP 2QA4P 2PY8A 3CCMP 2MY5A 2PEOA 2DNWA 4U0CA 3H47A 2FADA 1VQ4P 3CXCO 1Q82Q 5HGNA 4XROA 1YJ9P 4PH0A 3I56P 2JGPA 5F2NA 3I55P 2BUOA 2KOOA 3CCRP 2VLQA 4PH1A 2QNWA 3MGEA 3DS5A 2AVAA 1S72P 1VQ5P 3NTEA 2CQ8A 2L0QA 2KG8A 2XZ0D 1VKUA 2KWLA 1GXGA 4IPYA 1YI2P 1W2BO 2CGQA 2KW2A 1VQOP 2N5IA 3EJEA 4WYMA 2VLNA 1VHNA 1NJIQ 5BS2A 4QNBA 2EHSA 2GZEA 4GR2A 2OARA 5KP7B 3HZQA 5HGMA 2FQ2A 1Q86Q 2K0DX 1M90Q 2L9FA 1VQ7P 2FQ0A 2KG9A 1AF8A 3RG2A 5HV8A 2XXMA 2ONTA 5KP6B 4UHPB 1E6JP 2KGDA 5EW5E 1YHQP 2FHSC 3P05A 2WPTA 2JU1A 3CMEP 2XV6A 2KOQA 1T8KA 1EOQA 2E1MA 4R0MA 2VSQA 3DTJA 1A8OA 2JYGA 1DNYA 5CZDB 1HQBA 2JQ4A 4XFXA 2GZIA 1M74A 2KODA 3LRYA 2FACA 2PNGA 2LF4A 2Z46A 2PENA 1A43A 2LOLA 3G4SP 2EG5A 5BS1A 3CC2P 2KR5A 1KQSO 2PEQA 4U0AA 1K30A 4F37A 3WBHA
chains in the Genus database with same CATH topology
2P9XA 2EFJA 1QVFO 3G71P 1K9MQ 4IPYA 3H0DA 2CWOA 1YI2P 1W2BO 2PEJA 1VQOP 3G1IA 1K73Q 3G26A 5F2OA 1M1KQ 4WYMA 3DS0A 1YIJP 1VQKP 1BAJA 1YITP 1NJIQ 5DCKA 2Z44A 5BS2A 3H4EA 1K8AQ 3CC4P 4QNBA 4U0DA 4GR2A 2M8NA 2OARA 3CCSP 5HGLA 3OW2O 4M0IA 2M8LA 2L6EA 3HZQA 2PEIA 5HGMA 1Q86Q 1M90Q 3DS4A 1VQ7P 1VQ8P 2XT1A 2PEMA 1ZMBA 3CCQP 3G21A 1VQ6P 1M6NA 2JO0A 1VQNP 2XXMA 1VQ9P 2ONTA 1YJNP 1E6JP 2Z45A 1RO2A 1AUMA 1YHQP 3CCLP 3P05A 2BHVA 1KC8Q 3E2DA 3CMEP 1D1DA 1QRJA 4U0FA 5I4TG 1M6EX 2XV6A 3CCJP 3DS2A 3DPHA 1EOQA 3RG6C 2E1MA 3G6EP 3M1MA 2OTJP 2OTLP 1JJ2O 4XFZA 3DTJA 1RNIA 1RO0A 4GR6A 5HGOA 5JPAA 1VQPP 1A8OA 2JYGA 1VQLP 2JYLA 4XRQA 3HYBA 4XFXA 3CCUP 3CCVP 4U0EA 3G29A 2QEXP 3CD6P 1Q81Q 3VRLC 3DS1A 1YJWP 2QA4P 2PY8A 3Q20A 2EIAA 3CPWO 3CCMP 1Q7YQ 3G28A 2M8PA 2PEOA 4XFYA 1N8RQ 2KODA 1M74A 3LRYA 3G1GA 2PEKA 1EIAA 2DGYA 4U0CA 3H47A 3CCEP 2LF4A 1VQ4P 3CXCO 1Q82Q 5HGNA 4XROA 2Z46A 2PENA 1A43A 3G4SP 4PH0A 3I56P 4COCA 1YJ9P 3I55P 4U0BA 2EG5A 5BS1A 2BUOA 5F2NA 3CC2P 3CC7P 5F2KA 3CMAP 1IUQA 1KQSO 3DS3A 3CCRP 4COPA 4PH1A 3MGEA 2PEQA 3G0VA 3DS5A 1VQMP 1S72P 1KD1Q 4U0AA 1K30A 1VQ5P 3NTEA 1QVGO 3WBHA 3B5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1G A;  5HGM A;  1EIA A;  4M0I A;  3DS4 A;  4U0C A;  2XT1 A;  4XFZ A;  3H47 A;  3DTJ A;  4IPY A;  3G21 A;  5HGL A;  2LF4 A;  5JPA A;  5HGO A;  2JO0 A;  5HGN A;  4XRO A;  2XXM A;  2M8L A;  1A8O A;  2JYG A;  1A43 A;  2ONT A;  4PH0 A;  4COC A;  4U0B A;  2BUO A;  2JYL A;  1E6J P;  3G1I A;  4XRQ A;  3G26 A;  1AUM A;  4WYM A;  4XFX A;  3DS0 A;  3P05 A;  4U0E A;  3G29 A;  1BAJ A;  3DS3 A;  5DCK A;  4COP A;  3H4E A;  4PH1 A;  3VRL C;  3DS1 A;  4QNB A;  1QRJ A;  2EIA A;  3MGE A;  3G0V A;  4U0F A;  3DS5 A;  4U0D A;  2XV6 A;  5I4T G;  3DS2 A;  2M8N A;  2M8P A;  3G28 A;  4XFY A;  3DPH A;  4U0A A;  1EOQ A;  2KOD A;  1D1D A;  3NTE A;  2L6E A;  3LRY A; 
#chains in the Genus database with same CATH topology
 1K9M Q;  3H0D A;  3GZL A;  2PEJ A;  3G1I A;  3G26 A;  1BAJ A;  2NO8 A;  3CC4 P;  1L0I A;  2M8N A;  3CCS P;  2K93 A;  5HGL A;  4H2X C;  2JBG A;  2N6Y A;  2L6E A;  2ROQ A;  2M8L A;  2GZG A;  2MVU A;  1VQ8 P;  2X2B A;  2PEM A;  3CCQ P;  2LL8 A;  3G21 A;  4MRT C;  1IMQ A;  1VQ6 P;  2JO0 A;  4DG9 A;  1VQ9 P;  2LKI A;  7CEI A;  2MF4 A;  1M6E X;  4CA3 A;  2K92 A;  3DPH A;  2GDY A;  1X3O A;  1JJ2 O;  4HKG A;  4XFZ A;  2GZJ A;  1VQP P;  5HGO A;  3CE7 A;  2EHT A;  3HYB A;  3CCV P;  2QEX P;  2L22 A;  1Q81 Q;  3DS1 A;  2EIA A;  5HVC A;  1Q7Y Q;  3G28 A;  2M8P A;  4XFY A;  1N8R Q;  2PEK A;  1EIA A;  2K2Q A;  1AYI A;  1HY8 A;  2AFD A;  3CCE P;  1F80 D;  1OR5 A;  4COC A;  4U0B A;  1E0H A;  3CC7 P;  5F2K A;  3CMA P;  4COP A;  2VLO A;  1FR2 A;  2KGC A;  1VQM P;  1EMV A;  3EJD A;  2JAZ A;  2AFE A;  4PXH B;  2P9X A;  1UNK A;  2N98 A;  1QVF O;  2CG5 B;  1Z6M A;  2ERH A;  2MVV A;  1K73 Q;  4H2W C;  1CEI A;  5F2O A;  1M1K Q;  3DS0 A;  1YIJ P;  1VQK P;  5EJD A;  1YIT P;  5DCK A;  2XZ1 C;  2Z44 A;  3H4E A;  1L0H A;  2N50 A;  2FVA A;  2N6Z A;  2FVE A;  2PEI A;  3DS4 A;  1ZMB A;  3U43 A;  2MD9 A;  1M6N A;  1VQN P;  4NEO A;  1YJN P;  3CCL P;  2K94 A;  2KOP A;  3GKL C;  3E2D A;  2LIW A;  1D1D A;  4U0F A;  3DS2 A;  3RG6 C;  3LMO A;  3G6E P;  3M1M A;  2OTL P;  2GZF A;  2K0X A;  1GPJ A;  4PWV B;  4QKO A;  4GR6 A;  5JPA A;  4BPH A;  2FQ1 A;  2AF8 A;  2LIU A;  4XRQ A;  4U0E A;  1GXH A;  3G29 A;  3CD6 P;  2GYK A;  3VRL C;  3CPW O;  3Q20 A;  3GZM A;  2K0Y A;  1ACP A;  3G1G A;  2DGY A;  2K5X A;  2GDX A;  2LPK A;  1IUQ A;  3DS3 A;  1KLP A;  4BPG A;  2JB0 A;  3G0V A;  2GDW A;  1KD1 Q;  1QVG O;  3B5I A;  2EFJ A;  3G71 P;  2CWO A;  2KOR A;  2CNR A;  2FVF A;  1UJZ A;  2KG6 A;  3NY7 B;  2L4B A;  2MR7 A;  2LML A;  2M5R A;  1K8A Q;  1ZNV A;  1IMP A;  4U0D A;  5KP8 B;  3OW2 O;  4M0I A;  2VLP A;  2N5H A;  2XT1 A;  1NQ4 A;  1BXI A;  2JU2 A;  2Z45 A;  1RO2 A;  1AUM A;  3GJN A;  4H2Y C;  2BHV A;  1KC8 Q;  2LTE A;  1QRJ A;  2KOS A;  5I4T G;  1MZ8 A;  3CCJ P;  2KGE A;  2OTJ P;  2FAE A;  4IZ6 A;  1DV5 A;  2MR8 A;  1RNI A;  1RO0 A;  2KGA A;  1VQL P;  3EJB A;  2JYL A;  3B4Q A;  3CCU P;  4BPF A;  1YJW P;  2QA4 P;  2PY8 A;  3CCM P;  2MY5 A;  2PEO A;  2DNW A;  4U0C A;  3H47 A;  2FAD A;  1VQ4 P;  3CXC O;  1Q82 Q;  5HGN A;  4XRO A;  1YJ9 P;  4PH0 A;  3I56 P;  2JGP A;  5F2N A;  3I55 P;  2BUO A;  2KOO A;  3CCR P;  2VLQ A;  4PH1 A;  2QNW A;  3MGE A;  3DS5 A;  2AVA A;  1S72 P;  1VQ5 P;  3NTE A;  2CQ8 A;  2L0Q A;  2KG8 A;  2XZ0 D;  1VKU A;  2KWL A;  1GXG A;  4IPY A;  1YI2 P;  1W2B O;  2CGQ A;  2KW2 A;  1VQO P;  2N5I A;  3EJE A;  4WYM A;  2VLN A;  1VHN A;  1NJI Q;  5BS2 A;  4QNB A;  2EHS A;  2GZE A;  4GR2 A;  2OAR A;  5KP7 B;  3HZQ A;  5HGM A;  2FQ2 A;  1Q86 Q;  2K0D X;  1M90 Q;  2L9F A;  1VQ7 P;  2FQ0 A;  2KG9 A;  1AF8 A;  3RG2 A;  5HV8 A;  2XXM A;  2ONT A;  5KP6 B;  4UHP B;  1E6J P;  2KGD A;  5EW5 E;  1YHQ P;  2FHS C;  3P05 A;  2WPT A;  2JU1 A;  3CME P;  2XV6 A;  2KOQ A;  1T8K A;  1EOQ A;  2E1M A;  4R0M A;  2VSQ A;  3DTJ A;  1A8O A;  2JYG A;  1DNY A;  5CZD B;  1HQB A;  2JQ4 A;  4XFX A;  2GZI A;  1M74 A;  2KOD A;  3LRY A;  2FAC A;  2PNG A;  2LF4 A;  2Z46 A;  2PEN A;  1A43 A;  2LOL A;  3G4S P;  2EG5 A;  5BS1 A;  3CC2 P;  2KR5 A;  1KQS O;  2PEQ A;  4U0A A;  1K30 A;  4F37 A;  3WBH A; 
#chains in the Genus database with same CATH homology
 2P9X A;  2EFJ A;  1QVF O;  3G71 P;  1K9M Q;  4IPY A;  3H0D A;  2CWO A;  1YI2 P;  1W2B O;  2PEJ A;  1VQO P;  3G1I A;  1K73 Q;  3G26 A;  5F2O A;  1M1K Q;  4WYM A;  3DS0 A;  1YIJ P;  1VQK P;  1BAJ A;  1YIT P;  1NJI Q;  5DCK A;  2Z44 A;  5BS2 A;  3H4E A;  1K8A Q;  3CC4 P;  4QNB A;  4U0D A;  4GR2 A;  2M8N A;  2OAR A;  3CCS P;  5HGL A;  3OW2 O;  4M0I A;  2M8L A;  2L6E A;  3HZQ A;  2PEI A;  5HGM A;  1Q86 Q;  1M90 Q;  3DS4 A;  1VQ7 P;  1VQ8 P;  2XT1 A;  2PEM A;  1ZMB A;  3CCQ P;  3G21 A;  1VQ6 P;  1M6N A;  2JO0 A;  1VQN P;  2XXM A;  1VQ9 P;  2ONT A;  1YJN P;  1E6J P;  2Z45 A;  1RO2 A;  1AUM A;  1YHQ P;  3CCL P;  3P05 A;  2BHV A;  1KC8 Q;  3E2D A;  3CME P;  1D1D A;  1QRJ A;  4U0F A;  5I4T G;  1M6E X;  2XV6 A;  3CCJ P;  3DS2 A;  3DPH A;  1EOQ A;  3RG6 C;  2E1M A;  3G6E P;  3M1M A;  2OTJ P;  2OTL P;  1JJ2 O;  4XFZ A;  3DTJ A;  1RNI A;  1RO0 A;  4GR6 A;  5HGO A;  5JPA A;  1VQP P;  1A8O A;  2JYG A;  1VQL P;  2JYL A;  4XRQ A;  3HYB A;  4XFX A;  3CCU P;  3CCV P;  4U0E A;  3G29 A;  2QEX P;  3CD6 P;  1Q81 Q;  3VRL C;  3DS1 A;  1YJW P;  2QA4 P;  2PY8 A;  3Q20 A;  2EIA A;  3CPW O;  3CCM P;  1Q7Y Q;  3G28 A;  2M8P A;  2PEO A;  4XFY A;  1N8R Q;  2KOD A;  1M74 A;  3LRY A;  3G1G A;  2PEK A;  1EIA A;  2DGY A;  4U0C A;  3H47 A;  3CCE P;  2LF4 A;  1VQ4 P;  3CXC O;  1Q82 Q;  5HGN A;  4XRO A;  2Z46 A;  2PEN A;  1A43 A;  3G4S P;  4PH0 A;  3I56 P;  4COC A;  1YJ9 P;  3I55 P;  4U0B A;  2EG5 A;  5BS1 A;  2BUO A;  5F2N A;  3CC2 P;  3CC7 P;  5F2K A;  3CMA P;  1IUQ A;  1KQS O;  3DS3 A;  3CCR P;  4COP A;  4PH1 A;  3MGE A;  2PEQ A;  3G0V A;  3DS5 A;  1VQM P;  1S72 P;  1KD1 Q;  4U0A A;  1K30 A;  1VQ5 P;  3NTE A;  1QVG O;  3WBH A;  3B5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...