3DS5A

Hiv-1 capsid c-terminal domain mutant (n183a)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
73
structure length
73
Chain Sequence
SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKAWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords HIV-1 CAPSID PROTEIN
publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 28
structure length 73
sequence length 73
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ds5A00
3DS3A 3DS5A 4XFZA 4U0BA 3DS2A 3G1IA 4U0AA 3DS1A 4PH1A 2LF4A 1E6JP 5HGLA 3G21A 3H4EA 3NTEA 2L6EA 3DS0A 3G28A 2XV6A 4WYMA 4XFYA 4XRQA 3G29A 3H47A 1BAJA 4XFXA 4M0IA 5HGOA 2KODA 4U0FA 2JYGA 1A8OA 3G26A 2ONTA 1AUMA 2M8LA 1QRJA 2EIAA 2M8NA 5JPAA 2JYLA 2XXMA 3LRYA 4IPYA 3DS4A 3DTJA 5HGMA 3MGEA 4QNBA 5HGNA 3P05A 5I4TG 4COCA 1EIAA 2BUOA 4U0CA 5DCKA 4COPA 2JO0A 2M8PA 4U0DA 2XT1A 1D1DA 1A43A 3DPHA 4U0EA 3VRLC 4XROA 4PH0A 1EOQA 3G1GA 3G0VA
chains in the Genus database with same CATH superfamily
1VQLP 3H4EA 2K0DX 2PEOA 3GZLA 3I55P 2KW2A 1YIJP 3CCQP 1DNYA 2VLPA 1L0HA 3CCUP 1YI2P 3OW2O 5I4TG 2GYKA 1VQ5P 1EIAA 4U0CA 1YJ9P 2EFJA 3NY7B 3B5IA 2GZGA 1VQKP 1VHNA 4PWVB 3G4SP 3NTEA 3G71P 1AF8A 1Q7YQ 2WPTA 2JQ4A 4QNBA 1M74A 5HV8A 3RG6C 4GR2A 1L0IA 4U0BA 2EHSA 1VQOP 2FAEA 2M5RA 3I56P 2XV6A 3G29A 1BAJA 1KLPA 3CCJP 2GDXA 2ONTA 5KP8B 2LMLA 1K73Q 2MVUA 2NO8A 2KGDA 3CCVP 1D1DA 3CD6P 1UJZA 3VRLC 4U0EA 3B4QA 2GZFA 2LL8A 1GXGA 4WYMA 7CEIA 3CMEP 2PEQA 2XXMA 2FACA 2LIWA 1DV5A 4BPFA 3CC4P 1N8RQ 3E2DA 2JO0A 4U0DA 2BHVA 5HVCA 3CPWO 4XROA 5HGNA 2FHSC 1K30A 5HGOA 1E6JP 3U43A 3G21A 2KODA 2MVVA 2CWOA 2EIAA 1KD1Q 4IZ6A 2PNGA 2QEXP 3MGEA 3P05A 2JAZA 2JU2A 5EJDA 2KGEA 2PEIA 4U0AA 1NQ4A 2JGPA 2KWLA 3GJNA 3EJEA 1ACPA 5HGMA 2KOOA 2PENA 2ERHA 2N6YA 2KOQA 2CG5B 2KGCA 3DS5A 2KGAA 2QNWA 1VQ8P 1VQ7P 2K0XA 2K94A 2X2BA 2JYGA 5JPAA 2GDWA 4HKGA 1AYIA 2KG6A 4UHPB 3H0DA 2N50A 2CQ8A 2K2QA 4COPA 2KOPA 2PEJA 1YJNP 2Z45A 5BS1A 1RNIA 2PEKA 3DS1A 1T8KA 2QA4P 5CZDB 2EHTA 1M1KQ 2JB0A 1QVGO 2LPKA 1A8OA 1K8AQ 2XZ0D 2K92A 2LIUA 1MZ8A 2BUOA 5DCKA 4GR6A 3CC7P 1E0HA 2AFDA 2KG8A 2CGQA 2FVAA 2GZJA 2M8LA 3EJBA 1KC8Q 2AF8A 2M8NA 3CCEP 2N5IA 3HYBA 4CA3A 4H2XC 2JU1A 2DNWA 1X3OA 1W2BO 1QVFO 2K0YA 2LOLA 2MR7A 2MY5A 2MR8A 3EJDA 4H2WC 2P9XA 1K9MQ 2Z44A 2ROQA 2LKIA 1YJWP 1IMPA 1HY8A 4XFXA 1RO0A 3G6EP 4IPYA 3DS4A 2L9FA 2GDYA 4COCA 1RO2A 3CE7A 3LMOA 1OR5A 2PY8A 1BXIA 2EG5A 5F2NA 4PXHB 2XZ1C 2VLNA 5EW5E 3H47A 2Z46A 3CC2P 1AUMA 1QRJA 2JYLA 2OTLP 3CCLP 3DTJA 1UNKA 2FADA 5F2KA 5F2OA 1A43A 2VLQA 1EOQA 1VQPP 1CEIA 3G1IA 5HGLA 4XFYA 2FQ0A 3DS0A 1KQSO 1NJIQ 3M1MA 3WBHA 2KOSA 2GZEA 3G26A 4QKOA 2PEMA 2MF4A 2K93A 2MD9A 1IUQA 3Q20A 3CCMP 3G0VA 1YHQP 4DG9A 2FQ2A 1VKUA 3G28A 1VQ9P 1VQMP 1YITP 4BPHA 1VQ4P 4U0FA 1VQNP 1VQ6P 3GKLC 4R0MA 4NEOA 2VSQA 3HZQA 3CXCO 2L22A 2N5HA 1ZMBA 2XT1A 1GXHA 1Z6MA 5KP7B 4PH0A 2LTEA 1Q81Q 3G1GA 2L0QA 3CCRP 4F37A 4M0IA 2DGYA 1M90Q 3GZMA 1GPJA 1M6NA 2JBGA 1Q86Q 5BS2A 2OARA 3LRYA 2N6ZA 2KR5A 2OTJP 2M8PA 3RG2A 2FQ1A 3DPHA 1FR2A 4PH1A 2LF4A 2FVFA 3CMAP 4XRQA 2L6EA 2L4BA 1EMVA 2FVEA 4MRTC 2AVAA 2E1MA 2VLOA 1M6EX 2N98A 1F80D 1S72P 2CNRA 3DS3A 4XFZA 3DS2A 1Q82Q 2K5XA 4H2YC 2AFEA 1IMQA 1HQBA 4BPGA 3CCSP 2KORA 2KG9A 1JJ2O 5KP6B 2GZIA 1ZNVA
chains in the Genus database with same CATH topology
1VQLP 1K30A 5HGOA 1E6JP 3G21A 3H4EA 3G28A 2PEOA 3I55P 1VQ9P 1VQMP 1YITP 2KODA 1VQ4P 2CWOA 1YIJP 4U0FA 1VQNP 2M8LA 1KC8Q 1VQ6P 2EIAA 3CCQP 2M8NA 3CCEP 1KD1Q 3HYBA 1YI2P 3CCUP 3HZQA 3CXCO 3CC7P 2QEXP 3OW2O 3MGEA 5I4TG 3P05A 1W2BO 1VQ5P 1QVFO 1EIAA 4U0CA 1YJ9P 1ZMBA 2EFJA 2XT1A 2P9XA 1K9MQ 3B5IA 4PH0A 1Q81Q 3G1GA 2Z44A 2PEIA 1VQKP 3CCRP 3G4SP 4U0AA 1YJWP 3NTEA 3G71P 4XFXA 4M0IA 2DGYA 1M90Q 1Q7YQ 1M6NA 1RO0A 3G6EP 1Q86Q 5BS2A 2OARA 3LRYA 3DS4A 4IPYA 5HGMA 4QNBA 4COCA 1RO2A 2PENA 1M74A 2OTJP 2M8PA 3RG6C 3DPHA 2PY8A 4GR2A 3DS5A 4U0BA 1VQOP 1VQ8P 2EG5A 1VQ7P 5F2NA 4PH1A 2LF4A 3CMAP 4XRQA 2L6EA 3I56P 2XV6A 3G29A 3H47A 1BAJA 2Z46A 3CC2P 3CCJP 2JYGA 2ONTA 1AUMA 1QRJA 2E1MA 5JPAA 2JYLA 2OTLP 1K73Q 3CCLP 3DTJA 3H0DA 1M6EX 4COPA 2PEJA 5F2KA 5F2OA 3CCVP 1D1DA 1YJNP 1A43A 3VRLC 4U0EA 3CD6P 2Z45A 1EOQA 1S72P 3DS3A 4XFZA 5BS1A 1RNIA 1VQPP 2PEKA 3DS2A 3G1IA 5HGLA 3DS1A 2QA4P 1Q82Q 4XFYA 3DS0A 1M1KQ 4WYMA 1QVGO 1KQSO 1NJIQ 3M1MA 3WBHA 3CMEP 1A8OA 3G26A 2PEMA 1K8AQ 2PEQA 2XXMA 3CCSP 1JJ2O 3CC4P 1IUQA 2BUOA 3E2DA 3Q20A 5DCKA 1N8RQ 2JO0A 4U0DA 2BHVA 3CPWO 4GR6A 3CCMP 4XROA 5HGNA 3G0VA 1YHQP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS3 A;  3DS5 A;  4XFZ A;  4U0B A;  3DS2 A;  3G1I A;  4U0A A;  3DS1 A;  4PH1 A;  2LF4 A;  1E6J P;  5HGL A;  3G21 A;  3H4E A;  3NTE A;  2L6E A;  3DS0 A;  3G28 A;  2XV6 A;  4WYM A;  4XFY A;  4XRQ A;  3G29 A;  3H47 A;  1BAJ A;  4XFX A;  4M0I A;  5HGO A;  2KOD A;  4U0F A;  2JYG A;  1A8O A;  3G26 A;  2ONT A;  1AUM A;  2M8L A;  1QRJ A;  2EIA A;  2M8N A;  5JPA A;  2JYL A;  2XXM A;  3LRY A;  4IPY A;  3DS4 A;  3DTJ A;  5HGM A;  3MGE A;  4QNB A;  5HGN A;  3P05 A;  5I4T G;  4COC A;  1EIA A;  2BUO A;  4U0C A;  5DCK A;  4COP A;  2JO0 A;  2M8P A;  4U0D A;  2XT1 A;  1D1D A;  1A43 A;  3DPH A;  4U0E A;  3VRL C;  4XRO A;  4PH0 A;  1EOQ A;  3G1G A;  3G0V A; 
#chains in the Genus database with same CATH topology
 1VQL P;  3H4E A;  2K0D X;  2PEO A;  3GZL A;  3I55 P;  2KW2 A;  1YIJ P;  3CCQ P;  1DNY A;  2VLP A;  1L0H A;  3CCU P;  1YI2 P;  3OW2 O;  5I4T G;  2GYK A;  1VQ5 P;  1EIA A;  4U0C A;  1YJ9 P;  2EFJ A;  3NY7 B;  3B5I A;  2GZG A;  1VQK P;  1VHN A;  4PWV B;  3G4S P;  3NTE A;  3G71 P;  1AF8 A;  1Q7Y Q;  2WPT A;  2JQ4 A;  4QNB A;  1M74 A;  5HV8 A;  3RG6 C;  4GR2 A;  1L0I A;  4U0B A;  2EHS A;  1VQO P;  2FAE A;  2M5R A;  3I56 P;  2XV6 A;  3G29 A;  1BAJ A;  1KLP A;  3CCJ P;  2GDX A;  2ONT A;  5KP8 B;  2LML A;  1K73 Q;  2MVU A;  2NO8 A;  2KGD A;  3CCV P;  1D1D A;  3CD6 P;  1UJZ A;  3VRL C;  4U0E A;  3B4Q A;  2GZF A;  2LL8 A;  1GXG A;  4WYM A;  7CEI A;  3CME P;  2PEQ A;  2XXM A;  2FAC A;  2LIW A;  1DV5 A;  4BPF A;  3CC4 P;  1N8R Q;  3E2D A;  2JO0 A;  4U0D A;  2BHV A;  5HVC A;  3CPW O;  4XRO A;  5HGN A;  2FHS C;  1K30 A;  5HGO A;  1E6J P;  3U43 A;  3G21 A;  2KOD A;  2MVV A;  2CWO A;  2EIA A;  1KD1 Q;  4IZ6 A;  2PNG A;  2QEX P;  3MGE A;  3P05 A;  2JAZ A;  2JU2 A;  5EJD A;  2KGE A;  2PEI A;  4U0A A;  1NQ4 A;  2JGP A;  2KWL A;  3GJN A;  3EJE A;  1ACP A;  5HGM A;  2KOO A;  2PEN A;  2ERH A;  2N6Y A;  2KOQ A;  2CG5 B;  2KGC A;  3DS5 A;  2KGA A;  2QNW A;  1VQ8 P;  1VQ7 P;  2K0X A;  2K94 A;  2X2B A;  2JYG A;  5JPA A;  2GDW A;  4HKG A;  1AYI A;  2KG6 A;  4UHP B;  3H0D A;  2N50 A;  2CQ8 A;  2K2Q A;  4COP A;  2KOP A;  2PEJ A;  1YJN P;  2Z45 A;  5BS1 A;  1RNI A;  2PEK A;  3DS1 A;  1T8K A;  2QA4 P;  5CZD B;  2EHT A;  1M1K Q;  2JB0 A;  1QVG O;  2LPK A;  1A8O A;  1K8A Q;  2XZ0 D;  2K92 A;  2LIU A;  1MZ8 A;  2BUO A;  5DCK A;  4GR6 A;  3CC7 P;  1E0H A;  2AFD A;  2KG8 A;  2CGQ A;  2FVA A;  2GZJ A;  2M8L A;  3EJB A;  1KC8 Q;  2AF8 A;  2M8N A;  3CCE P;  2N5I A;  3HYB A;  4CA3 A;  4H2X C;  2JU1 A;  2DNW A;  1X3O A;  1W2B O;  1QVF O;  2K0Y A;  2LOL A;  2MR7 A;  2MY5 A;  2MR8 A;  3EJD A;  4H2W C;  2P9X A;  1K9M Q;  2Z44 A;  2ROQ A;  2LKI A;  1YJW P;  1IMP A;  1HY8 A;  4XFX A;  1RO0 A;  3G6E P;  4IPY A;  3DS4 A;  2L9F A;  2GDY A;  4COC A;  1RO2 A;  3CE7 A;  3LMO A;  1OR5 A;  2PY8 A;  1BXI A;  2EG5 A;  5F2N A;  4PXH B;  2XZ1 C;  2VLN A;  5EW5 E;  3H47 A;  2Z46 A;  3CC2 P;  1AUM A;  1QRJ A;  2JYL A;  2OTL P;  3CCL P;  3DTJ A;  1UNK A;  2FAD A;  5F2K A;  5F2O A;  1A43 A;  2VLQ A;  1EOQ A;  1VQP P;  1CEI A;  3G1I A;  5HGL A;  4XFY A;  2FQ0 A;  3DS0 A;  1KQS O;  1NJI Q;  3M1M A;  3WBH A;  2KOS A;  2GZE A;  3G26 A;  4QKO A;  2PEM A;  2MF4 A;  2K93 A;  2MD9 A;  1IUQ A;  3Q20 A;  3CCM P;  3G0V A;  1YHQ P;  4DG9 A;  2FQ2 A;  1VKU A;  3G28 A;  1VQ9 P;  1VQM P;  1YIT P;  4BPH A;  1VQ4 P;  4U0F A;  1VQN P;  1VQ6 P;  3GKL C;  4R0M A;  4NEO A;  2VSQ A;  3HZQ A;  3CXC O;  2L22 A;  2N5H A;  1ZMB A;  2XT1 A;  1GXH A;  1Z6M A;  5KP7 B;  4PH0 A;  2LTE A;  1Q81 Q;  3G1G A;  2L0Q A;  3CCR P;  4F37 A;  4M0I A;  2DGY A;  1M90 Q;  3GZM A;  1GPJ A;  1M6N A;  2JBG A;  1Q86 Q;  5BS2 A;  2OAR A;  3LRY A;  2N6Z A;  2KR5 A;  2OTJ P;  2M8P A;  3RG2 A;  2FQ1 A;  3DPH A;  1FR2 A;  4PH1 A;  2LF4 A;  2FVF A;  3CMA P;  4XRQ A;  2L6E A;  2L4B A;  1EMV A;  2FVE A;  4MRT C;  2AVA A;  2E1M A;  2VLO A;  1M6E X;  2N98 A;  1F80 D;  1S72 P;  2CNR A;  3DS3 A;  4XFZ A;  3DS2 A;  1Q82 Q;  2K5X A;  4H2Y C;  2AFE A;  1IMQ A;  1HQB A;  4BPG A;  3CCS P;  2KOR A;  2KG9 A;  1JJ2 O;  5KP6 B;  2GZI A;  1ZNV A; 
#chains in the Genus database with same CATH homology
 1VQL P;  1K30 A;  5HGO A;  1E6J P;  3G21 A;  3H4E A;  3G28 A;  2PEO A;  3I55 P;  1VQ9 P;  1VQM P;  1YIT P;  2KOD A;  1VQ4 P;  2CWO A;  1YIJ P;  4U0F A;  1VQN P;  2M8L A;  1KC8 Q;  1VQ6 P;  2EIA A;  3CCQ P;  2M8N A;  3CCE P;  1KD1 Q;  3HYB A;  1YI2 P;  3CCU P;  3HZQ A;  3CXC O;  3CC7 P;  2QEX P;  3OW2 O;  3MGE A;  5I4T G;  3P05 A;  1W2B O;  1VQ5 P;  1QVF O;  1EIA A;  4U0C A;  1YJ9 P;  1ZMB A;  2EFJ A;  2XT1 A;  2P9X A;  1K9M Q;  3B5I A;  4PH0 A;  1Q81 Q;  3G1G A;  2Z44 A;  2PEI A;  1VQK P;  3CCR P;  3G4S P;  4U0A A;  1YJW P;  3NTE A;  3G71 P;  4XFX A;  4M0I A;  2DGY A;  1M90 Q;  1Q7Y Q;  1M6N A;  1RO0 A;  3G6E P;  1Q86 Q;  5BS2 A;  2OAR A;  3LRY A;  3DS4 A;  4IPY A;  5HGM A;  4QNB A;  4COC A;  1RO2 A;  2PEN A;  1M74 A;  2OTJ P;  2M8P A;  3RG6 C;  3DPH A;  2PY8 A;  4GR2 A;  3DS5 A;  4U0B A;  1VQO P;  1VQ8 P;  2EG5 A;  1VQ7 P;  5F2N A;  4PH1 A;  2LF4 A;  3CMA P;  4XRQ A;  2L6E A;  3I56 P;  2XV6 A;  3G29 A;  3H47 A;  1BAJ A;  2Z46 A;  3CC2 P;  3CCJ P;  2JYG A;  2ONT A;  1AUM A;  1QRJ A;  2E1M A;  5JPA A;  2JYL A;  2OTL P;  1K73 Q;  3CCL P;  3DTJ A;  3H0D A;  1M6E X;  4COP A;  2PEJ A;  5F2K A;  5F2O A;  3CCV P;  1D1D A;  1YJN P;  1A43 A;  3VRL C;  4U0E A;  3CD6 P;  2Z45 A;  1EOQ A;  1S72 P;  3DS3 A;  4XFZ A;  5BS1 A;  1RNI A;  1VQP P;  2PEK A;  3DS2 A;  3G1I A;  5HGL A;  3DS1 A;  2QA4 P;  1Q82 Q;  4XFY A;  3DS0 A;  1M1K Q;  4WYM A;  1QVG O;  1KQS O;  1NJI Q;  3M1M A;  3WBH A;  3CME P;  1A8O A;  3G26 A;  2PEM A;  1K8A Q;  2PEQ A;  2XXM A;  3CCS P;  1JJ2 O;  3CC4 P;  1IUQ A;  2BUO A;  3E2D A;  3Q20 A;  5DCK A;  1N8R Q;  2JO0 A;  4U0D A;  2BHV A;  3CPW O;  4GR6 A;  3CCM P;  4XRO A;  5HGN A;  3G0V A;  1YHQ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...