2N5IA

Pltl-pyrrolyl
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
90
structure length
90
Chain Sequence
MDGEEVKEKIRRYIMEDLIGPSAKEDELDDQTPLLEWGILNSMNIVKLMVYIRDEMGVSIPSTHITGKYFKDLNAISRTVEQLKAESALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Peptidyl carrier protein PltL
publication title Structure and Substrate Sequestration in the Pyoluteorin Type II Peptidyl Carrier Protein PltL.
pubmed doi rcsb
source organism Pseudomonas protegens pf-5
total genus 26
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n5iA00
2KW2A 2M5RA 3GZLA 2KR5A 2N98A 5EJDA 2FACA 1KLPA 2CGQA 2LIUA 1DNYA 2FAEA 2N5HA 2LIWA 1NQ4A 2XZ0D 2K2QA 4BPGA 2FVEA 2QNWA 3NY7B 2AFEA 2JU1A 5KP7B 2AVAA 4IZ6A 2KG8A 2MF4A 2MY5A 3EJDA 2K92A 4NEOA 2LKIA 2MD9A 4H2YC 2MR8A 2L4BA 1L0HA 2LPKA 4R0MA 2LTEA 2PNGA 4HKGA 1OR5A 2FVAA 2L9FA 2K94A 1HY8A 2AF8A 3RG2A 1T8KA 2AFDA 2KGEA 3LMOA 1VKUA 2KOSA 1DV5A 3CE7A 2JU2A 2LMLA 2KOQA 5HV8A 2MVVA 2K0XA 2GDXA 2FQ2A 2K93A 2LL8A 4BPFA 2FVFA 2FADA 2DNWA 1HQBA 3EJEA 2KG9A 2KWLA 2KGAA 2FHSC 2X2BA 4H2WC 2KOPA 5HVCA 4BPHA 2N6ZA 1AF8A 2VSQA 2MR7A 2KGDA 4MRTC 2XZ1C 2CG5B 2EHSA 2L22A 1L0IA 2KOOA 2FQ1A 2CNRA 1X3OA 2L0QA 2JGPA 3GZMA 4H2XC 5KP6B 5KP8B 2N5IA 5CZDB 2N50A 2FQ0A 4DG9A 2KORA 2JQ4A 4PXHB 2CQ8A 2N6YA 2KGCA 2K0YA 4CA3A 3EJBA 2KG6A 2LOLA 2EHTA 2GDWA 2ROQA 1F80D 2MVUA 2GDYA 4PWVB 1ACPA
chains in the Genus database with same CATH superfamily
2PEMA 5EJDA 1A8OA 4U0DA 3LRYA 2N5HA 1Q81Q 3DS0A 1NQ4A 3NY7B 2MF4A 3G71P 3EJDA 2LKIA 1GPJA 2MD9A 4H2YC 2GZGA 1M90Q 1BXIA 2LPKA 4R0MA 2JYGA 2LTEA 1QRJA 4GR2A 3G1IA 2Z45A 3RG2A 1K73Q 2JB0A 1AUMA 1T8KA 2KGEA 1VKUA 3G6EP 3CCRP 2JU2A 1VQLP 2WPTA 5F2KA 2FQ2A 1VQ5P 1VQMP 4BPFA 2FADA 4XRQA 2JYLA 3CCUP 2KG9A 4XFXA 5BS1A 1RO0A 2NO8A 2KODA 1M6EX 4U0EA 2K5XA 2E1MA 2N6ZA 1AF8A 1VQPP 2CG5B 2L22A 2XXMA 1YI2P 3CCSP 2CNRA 3DS5A 1W2BO 5DCKA 3CC7P 1UNKA 2M8PA 2EFJA 1IMQA 1VQ9P 2VLOA 5KP8B 4PH0A 3HYBA 1FR2A 2CQ8A 3M1MA 4CA3A 5F2NA 2KG6A 3DS4A 1E6JP 1IMPA 3CCQP 3U43A 4F37A 2Z46A 1GXHA 2M5RA 3E2DA 2EG5A 1VQNP 2P9XA 2Z44A 2FACA 1E0HA 2CGQA 2LIUA 2XT1A 2FAEA 1M1KQ 2VLNA 3DS1A 5HGMA 4BPGA 2AFEA 2GZJA 5KP7B 2AVAA 1IUQA 2K92A 4XFZA 3G21A 1Q7YQ 1L0HA 3P05A 2JBGA 2BHVA 2L9FA 2JO0A 2K94A 3DPHA 2AFDA 2LF4A 1YJNP 2LMLA 3G26A 5HV8A 2K0XA 2BUOA 1MZ8A 2FVFA 4WYMA 1KC8Q 1M6NA 5BS2A 2X2BA 4H2WC 2KOPA 3H47A 5I4TG 3DS2A 2XZ1C 1EIAA 1L0IA 2FQ1A 3CMAP 1EMVA 2L0QA 3G0VA 1JJ2O 3CC2P 2PEKA 3B4QA 4COPA 3G29A 2FQ0A 2JQ4A 4PXHB 2N6YA 2OARA 2K0YA 2LOLA 2EHTA 2GDWA 2PEOA 4COCA 5HGOA 2GYKA 4PWVB 4U0FA 1ACPA 4M0IA 3GZLA 2KR5A 3DS3A 1KQSO 1M74A 4QNBA 1KLPA 1K30A 1A43A 3GKLC 3RG6C 1Q82Q 4QKOA 3GJNA 2LIWA 2K2QA 2FVEA 2QNWA 5HGLA 3G28A 3WBHA 2JU1A 1YIJP 1Q86Q 2ONTA 4IZ6A 3CCVP 2KG8A 1ZNVA 4NEOA 1RNIA 2MR8A 1VQ6P 1VHNA 1CEIA 3CD6P 4HKGA 2FVAA 5EW5E 1HY8A 2AF8A 2PEJA 2VLPA 2KOSA 1Z6MA 3CE7A 2M8LA 1EOQA 3CCEP 2OTLP 2K93A 3EJEA 2VLQA 3H0DA 3H4EA 2KGAA 1K9MQ 5HVCA 4BPHA 2M8NA 1VQ4P 2VSQA 2MR7A 4MRTC 4XFYA 3B5IA 1VQKP 3OW2O 1BAJA 5KP6B 2N5IA 5CZDB 1YHQP 4PH1A 3CMEP 2GZIA 2QA4P 3VRLC 4DG9A 2KORA 2PEIA 4XROA 2ERHA 1AYIA 1D1DA 4U0BA 2EIAA 3EJBA 3HZQA 1GXGA 1NJIQ 2MVUA 2GDYA 3NTEA 1VQ8P 2JAZA 4GR6A 2KW2A 1N8RQ 2N98A 1DNYA 4UHPB 3CPWO 2XZ0D 4U0AA 2DGYA 2QEXP 2PENA 3I55P 2MY5A 1QVFO 1QVGO 2L4BA 1YJWP 2OTJP 1RO2A 2PNGA 1OR5A 2XV6A 4U0CA 3LMOA 1DV5A 3CCLP 5HGNA 1S72P 2KOQA 5F2OA 3CCJP 2MVVA 3Q20A 2K0DX 2GDXA 2PEQA 7CEIA 2LL8A 2DNWA 1HQBA 2KWLA 1VQ7P 5JPAA 3CXCO 2FHSC 3CCMP 2KGDA 2EHSA 2KOOA 3CC4P 1YJ9P 1X3OA 3G1GA 1KD1Q 3DTJA 4IPYA 1YITP 1VQOP 2GZEA 2CWOA 1ZMBA 2JGPA 3GZMA 4H2XC 2L6EA 2N50A 1K8AQ 3G4SP 1UJZA 2KGCA 2PY8A 3MGEA 2ROQA 3I56P 1F80D 2GZFA
chains in the Genus database with same CATH topology
2KW2A 2M5RA 3GZLA 2KR5A 2N98A 5EJDA 2FACA 1KLPA 2CGQA 2LIUA 1DNYA 2FAEA 2N5HA 2LIWA 1NQ4A 2XZ0D 2K2QA 4BPGA 2FVEA 2QNWA 3NY7B 2AFEA 2JU1A 5KP7B 2AVAA 4IZ6A 2KG8A 2MF4A 2MY5A 3EJDA 2K92A 4NEOA 2LKIA 2MD9A 4H2YC 2MR8A 2L4BA 1L0HA 2LPKA 4R0MA 2LTEA 2PNGA 4HKGA 1OR5A 2FVAA 2L9FA 2K94A 1HY8A 2AF8A 3RG2A 1T8KA 2AFDA 2KGEA 3LMOA 1VKUA 2KOSA 1DV5A 3CE7A 2JU2A 2LMLA 2KOQA 5HV8A 2MVVA 2K0XA 2GDXA 2FQ2A 2K93A 2LL8A 4BPFA 2FVFA 2FADA 2DNWA 1HQBA 3EJEA 2KG9A 2KWLA 2KGAA 2FHSC 2X2BA 4H2WC 2KOPA 5HVCA 4BPHA 2N6ZA 1AF8A 2VSQA 2MR7A 2KGDA 4MRTC 2XZ1C 2CG5B 2EHSA 2L22A 1L0IA 2KOOA 2FQ1A 2CNRA 1X3OA 2L0QA 2JGPA 3GZMA 4H2XC 5KP6B 5KP8B 2N5IA 5CZDB 2N50A 2FQ0A 4DG9A 2KORA 2JQ4A 4PXHB 2CQ8A 2N6YA 2KGCA 2K0YA 4CA3A 3EJBA 2KG6A 2LOLA 2EHTA 2GDWA 2ROQA 1F80D 2MVUA 2GDYA 4PWVB 1ACPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW2 A;  2M5R A;  3GZL A;  2KR5 A;  2N98 A;  5EJD A;  2FAC A;  1KLP A;  2CGQ A;  2LIU A;  1DNY A;  2FAE A;  2N5H A;  2LIW A;  1NQ4 A;  2XZ0 D;  2K2Q A;  4BPG A;  2FVE A;  2QNW A;  3NY7 B;  2AFE A;  2JU1 A;  5KP7 B;  2AVA A;  4IZ6 A;  2KG8 A;  2MF4 A;  2MY5 A;  3EJD A;  2K92 A;  4NEO A;  2LKI A;  2MD9 A;  4H2Y C;  2MR8 A;  2L4B A;  1L0H A;  2LPK A;  4R0M A;  2LTE A;  2PNG A;  4HKG A;  1OR5 A;  2FVA A;  2L9F A;  2K94 A;  1HY8 A;  2AF8 A;  3RG2 A;  1T8K A;  2AFD A;  2KGE A;  3LMO A;  1VKU A;  2KOS A;  1DV5 A;  3CE7 A;  2JU2 A;  2LML A;  2KOQ A;  5HV8 A;  2MVV A;  2K0X A;  2GDX A;  2FQ2 A;  2K93 A;  2LL8 A;  4BPF A;  2FVF A;  2FAD A;  2DNW A;  1HQB A;  3EJE A;  2KG9 A;  2KWL A;  2KGA A;  2FHS C;  2X2B A;  4H2W C;  2KOP A;  5HVC A;  4BPH A;  2N6Z A;  1AF8 A;  2VSQ A;  2MR7 A;  2KGD A;  4MRT C;  2XZ1 C;  2CG5 B;  2EHS A;  2L22 A;  1L0I A;  2KOO A;  2FQ1 A;  2CNR A;  1X3O A;  2L0Q A;  2JGP A;  3GZM A;  4H2X C;  5KP6 B;  5KP8 B;  2N5I A;  5CZD B;  2N50 A;  2FQ0 A;  4DG9 A;  2KOR A;  2JQ4 A;  4PXH B;  2CQ8 A;  2N6Y A;  2KGC A;  2K0Y A;  4CA3 A;  3EJB A;  2KG6 A;  2LOL A;  2EHT A;  2GDW A;  2ROQ A;  1F80 D;  2MVU A;  2GDY A;  4PWV B;  1ACP A; 
#chains in the Genus database with same CATH topology
 2PEM A;  5EJD A;  1A8O A;  4U0D A;  3LRY A;  2N5H A;  1Q81 Q;  3DS0 A;  1NQ4 A;  3NY7 B;  2MF4 A;  3G71 P;  3EJD A;  2LKI A;  1GPJ A;  2MD9 A;  4H2Y C;  2GZG A;  1M90 Q;  1BXI A;  2LPK A;  4R0M A;  2JYG A;  2LTE A;  1QRJ A;  4GR2 A;  3G1I A;  2Z45 A;  3RG2 A;  1K73 Q;  2JB0 A;  1AUM A;  1T8K A;  2KGE A;  1VKU A;  3G6E P;  3CCR P;  2JU2 A;  1VQL P;  2WPT A;  5F2K A;  2FQ2 A;  1VQ5 P;  1VQM P;  4BPF A;  2FAD A;  4XRQ A;  2JYL A;  3CCU P;  2KG9 A;  4XFX A;  5BS1 A;  1RO0 A;  2NO8 A;  2KOD A;  1M6E X;  4U0E A;  2K5X A;  2E1M A;  2N6Z A;  1AF8 A;  1VQP P;  2CG5 B;  2L22 A;  2XXM A;  1YI2 P;  3CCS P;  2CNR A;  3DS5 A;  1W2B O;  5DCK A;  3CC7 P;  1UNK A;  2M8P A;  2EFJ A;  1IMQ A;  1VQ9 P;  2VLO A;  5KP8 B;  4PH0 A;  3HYB A;  1FR2 A;  2CQ8 A;  3M1M A;  4CA3 A;  5F2N A;  2KG6 A;  3DS4 A;  1E6J P;  1IMP A;  3CCQ P;  3U43 A;  4F37 A;  2Z46 A;  1GXH A;  2M5R A;  3E2D A;  2EG5 A;  1VQN P;  2P9X A;  2Z44 A;  2FAC A;  1E0H A;  2CGQ A;  2LIU A;  2XT1 A;  2FAE A;  1M1K Q;  2VLN A;  3DS1 A;  5HGM A;  4BPG A;  2AFE A;  2GZJ A;  5KP7 B;  2AVA A;  1IUQ A;  2K92 A;  4XFZ A;  3G21 A;  1Q7Y Q;  1L0H A;  3P05 A;  2JBG A;  2BHV A;  2L9F A;  2JO0 A;  2K94 A;  3DPH A;  2AFD A;  2LF4 A;  1YJN P;  2LML A;  3G26 A;  5HV8 A;  2K0X A;  2BUO A;  1MZ8 A;  2FVF A;  4WYM A;  1KC8 Q;  1M6N A;  5BS2 A;  2X2B A;  4H2W C;  2KOP A;  3H47 A;  5I4T G;  3DS2 A;  2XZ1 C;  1EIA A;  1L0I A;  2FQ1 A;  3CMA P;  1EMV A;  2L0Q A;  3G0V A;  1JJ2 O;  3CC2 P;  2PEK A;  3B4Q A;  4COP A;  3G29 A;  2FQ0 A;  2JQ4 A;  4PXH B;  2N6Y A;  2OAR A;  2K0Y A;  2LOL A;  2EHT A;  2GDW A;  2PEO A;  4COC A;  5HGO A;  2GYK A;  4PWV B;  4U0F A;  1ACP A;  4M0I A;  3GZL A;  2KR5 A;  3DS3 A;  1KQS O;  1M74 A;  4QNB A;  1KLP A;  1K30 A;  1A43 A;  3GKL C;  3RG6 C;  1Q82 Q;  4QKO A;  3GJN A;  2LIW A;  2K2Q A;  2FVE A;  2QNW A;  5HGL A;  3G28 A;  3WBH A;  2JU1 A;  1YIJ P;  1Q86 Q;  2ONT A;  4IZ6 A;  3CCV P;  2KG8 A;  1ZNV A;  4NEO A;  1RNI A;  2MR8 A;  1VQ6 P;  1VHN A;  1CEI A;  3CD6 P;  4HKG A;  2FVA A;  5EW5 E;  1HY8 A;  2AF8 A;  2PEJ A;  2VLP A;  2KOS A;  1Z6M A;  3CE7 A;  2M8L A;  1EOQ A;  3CCE P;  2OTL P;  2K93 A;  3EJE A;  2VLQ A;  3H0D A;  3H4E A;  2KGA A;  1K9M Q;  5HVC A;  4BPH A;  2M8N A;  1VQ4 P;  2VSQ A;  2MR7 A;  4MRT C;  4XFY A;  3B5I A;  1VQK P;  3OW2 O;  1BAJ A;  5KP6 B;  2N5I A;  5CZD B;  1YHQ P;  4PH1 A;  3CME P;  2GZI A;  2QA4 P;  3VRL C;  4DG9 A;  2KOR A;  2PEI A;  4XRO A;  2ERH A;  1AYI A;  1D1D A;  4U0B A;  2EIA A;  3EJB A;  3HZQ A;  1GXG A;  1NJI Q;  2MVU A;  2GDY A;  3NTE A;  1VQ8 P;  2JAZ A;  4GR6 A;  2KW2 A;  1N8R Q;  2N98 A;  1DNY A;  4UHP B;  3CPW O;  2XZ0 D;  4U0A A;  2DGY A;  2QEX P;  2PEN A;  3I55 P;  2MY5 A;  1QVF O;  1QVG O;  2L4B A;  1YJW P;  2OTJ P;  1RO2 A;  2PNG A;  1OR5 A;  2XV6 A;  4U0C A;  3LMO A;  1DV5 A;  3CCL P;  5HGN A;  1S72 P;  2KOQ A;  5F2O A;  3CCJ P;  2MVV A;  3Q20 A;  2K0D X;  2GDX A;  2PEQ A;  7CEI A;  2LL8 A;  2DNW A;  1HQB A;  2KWL A;  1VQ7 P;  5JPA A;  3CXC O;  2FHS C;  3CCM P;  2KGD A;  2EHS A;  2KOO A;  3CC4 P;  1YJ9 P;  1X3O A;  3G1G A;  1KD1 Q;  3DTJ A;  4IPY A;  1YIT P;  1VQO P;  2GZE A;  2CWO A;  1ZMB A;  2JGP A;  3GZM A;  4H2X C;  2L6E A;  2N50 A;  1K8A Q;  3G4S P;  1UJZ A;  2KGC A;  2PY8 A;  3MGE A;  2ROQ A;  3I56 P;  1F80 D;  2GZF A; 
#chains in the Genus database with same CATH homology
 2KW2 A;  2M5R A;  3GZL A;  2KR5 A;  2N98 A;  5EJD A;  2FAC A;  1KLP A;  2CGQ A;  2LIU A;  1DNY A;  2FAE A;  2N5H A;  2LIW A;  1NQ4 A;  2XZ0 D;  2K2Q A;  4BPG A;  2FVE A;  2QNW A;  3NY7 B;  2AFE A;  2JU1 A;  5KP7 B;  2AVA A;  4IZ6 A;  2KG8 A;  2MF4 A;  2MY5 A;  3EJD A;  2K92 A;  4NEO A;  2LKI A;  2MD9 A;  4H2Y C;  2MR8 A;  2L4B A;  1L0H A;  2LPK A;  4R0M A;  2LTE A;  2PNG A;  4HKG A;  1OR5 A;  2FVA A;  2L9F A;  2K94 A;  1HY8 A;  2AF8 A;  3RG2 A;  1T8K A;  2AFD A;  2KGE A;  3LMO A;  1VKU A;  2KOS A;  1DV5 A;  3CE7 A;  2JU2 A;  2LML A;  2KOQ A;  5HV8 A;  2MVV A;  2K0X A;  2GDX A;  2FQ2 A;  2K93 A;  2LL8 A;  4BPF A;  2FVF A;  2FAD A;  2DNW A;  1HQB A;  3EJE A;  2KG9 A;  2KWL A;  2KGA A;  2FHS C;  2X2B A;  4H2W C;  2KOP A;  5HVC A;  4BPH A;  2N6Z A;  1AF8 A;  2VSQ A;  2MR7 A;  2KGD A;  4MRT C;  2XZ1 C;  2CG5 B;  2EHS A;  2L22 A;  1L0I A;  2KOO A;  2FQ1 A;  2CNR A;  1X3O A;  2L0Q A;  2JGP A;  3GZM A;  4H2X C;  5KP6 B;  5KP8 B;  2N5I A;  5CZD B;  2N50 A;  2FQ0 A;  4DG9 A;  2KOR A;  2JQ4 A;  4PXH B;  2CQ8 A;  2N6Y A;  2KGC A;  2K0Y A;  4CA3 A;  3EJB A;  2KG6 A;  2LOL A;  2EHT A;  2GDW A;  2ROQ A;  1F80 D;  2MVU A;  2GDY A;  4PWV B;  1ACP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...