2N5IA

Pltl-pyrrolyl
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
90
structure length
90
Chain Sequence
MDGEEVKEKIRRYIMEDLIGPSAKEDELDDQTPLLEWGILNSMNIVKLMVYIRDEMGVSIPSTHITGKYFKDLNAISRTVEQLKAESALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl carrier protein PltL
publication title Structure and Substrate Sequestration in the Pyoluteorin Type II Peptidyl Carrier Protein PltL.
pubmed doi rcsb
source organism Pseudomonas protegens pf-5
molecule tags Transport protein
total genus 26
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n5iA00
2JU2A 2JU1A 4CA3A 2N5IA 2MD9A 2JGPA 1NQ4A 2MF4A 2N50A 1DNYA 5KP8B 2VSQA 2CNRA 2AFDA 5KP6B 2KORA 4DG9A 2QNWA 1KLPA 2KGAA 2KGEA 2K0XA 2KG9A 2ROQA 2L4BA 2MY5A 2N5HA 2N98A 2FQ1A 2GDYA 2MR7A 1L0HA 4NEOA 1T8KA 2KG8A 2FADA 2KGDA 2LPKA 2MR8A 3CE7A 4MRTC 2FQ2A 3EJDA 2KR5A 2LL8A 2N6YA 1DV5A 2LTEA 2K0YA 2LKIA 2CQ8A 4R0MA 2KG6A 2AFEA 2PNGA 4H2WC 4H2XC 2L0QA 5KP7B 2FAEA 2FACA 2KOOA 4BPGA 5CZDB 2KW2A 2FVAA 2LIWA 2K93A 2CGQA 1HQBA 2XZ1C 2GDXA 2K92A 2AVAA 2LIUA 2N6ZA 3GZLA 5HVCA 2L22A 1AF8A 2AF8A 4PWVB 4IZ6A 2M5RA 2KOQA 4BPFA 2GDWA 2EHSA 2EHTA 2FVEA 2KGCA 2MVUA 5EJDA 2KOSA 2K2QA 1OR5A 3RG2A 1VKUA 2XZ0D 1X3OA 3LMOA 2FHSC 4PXHB 2L9FA 2DNWA 2X2BA 3GZMA 3NY7B 2K94A 2JQ4A 1HY8A 1ACPA 2CG5B 2FQ0A 1F80D 4HKGA 2LOLA 3EJBA 2MVVA 2KWLA 5HV8A 2KOPA 4H2YC 2FVFA 1L0IA 3EJEA 2LMLA 4BPHA
chains in the Genus database with same CATH superfamily
1D1DA 1YHQP 3GKLC 2M8LA 3VRLC 1VQKP 4WYMA 1VQ8P 1IUQA 2VSQA 3G1IA 5HGLA 2OTJP 2CNRA 2JYGA 2GZJA 3DS5A 3G1GA 2KGAA 1GXHA 1M90Q 2LF4A 2E1MA 1GXGA 3CCSP 2MY5A 2FQ1A 2VLNA 2GDYA 4NEOA 1K9MQ 3G0VA 2VLQA 5HGNA 1VQ7P 4UHPB 2KR5A 2GYKA 2LKIA 3P05A 2K5XA 1RO2A 4XROA 2AFEA 2PNGA 4H2XC 3H4EA 5EW5E 2VLPA 1YIJP 2FACA 2FAEA 4XFYA 2KOOA 1EIAA 2EIAA 4BPGA 3B4QA 2ONTA 2KW2A 2LIWA 1YJNP 1HQBA 1N8RQ 3CMAP 2N6ZA 3GZLA 1UJZA 2BUOA 2L6EA 3CCVP 2DGYA 3G71P 1VQ4P 4U0DA 1GPJA 2K2QA 4U0FA 3LRYA 3H0DA 2EG5A 1X3OA 2X2BA 2K94A 1Q81Q 5F2NA 4HKGA 1F80D 4U0BA 3HYBA 2KOPA 1YITP 2XV6A 1W2BO 3EJEA 1VQ5P 4GR6A 4BPHA 2JU2A 2Z45A 2CWOA 5HGMA 4M0IA 2JU1A 2M8NA 2MF4A 4U0EA 5KP8B 3CCRP 2XT1A 3CC7P 3B5IA 2EFJA 4U0AA 3DS0A 2MR7A 2KG8A 3DS4A 2LPKA 3CC4P 3DS1A 1ZNVA 1A8OA 1DV5A 2CQ8A 1UNKA 1M74A 2L0QA 1EMVA 2JBGA 5BS1A 2FVAA 1ZMBA 2XZ1C 2K92A 2QEXP 5HVCA 2L22A 1AF8A 1BAJA 1VQPP 2GDWA 2OTLP 3GJNA 3CCEP 4COCA 3G29A 4COPA 2MVUA 1VQLP 1OR5A 1VKUA 1IMQA 4QNBA 3LMOA 2FHSC 4PXHB 2L9FA 3NY7B 1RO0A 2JQ4A 2CG5B 1AYIA 1KC8Q 2Z44A 2KWLA 2FVFA 1NJIQ 2PEKA 3MGEA 2LMLA 3NTEA 1A43A 2PY8A 4IPYA 3DTJA 3CCUP 2K0DX 2MD9A 1NQ4A 3DS2A 1Q82Q 2N50A 1DNYA 5BS2A 5KP6B 2KORA 4DG9A 2QNWA 1KLPA 1KQSO 3OW2O 3G28A 3CPWO 1IMPA 1Z6MA 2ROQA 2XXMA 1VQ9P 2L4BA 2N98A 1L0HA 2JO0A 1T8KA 2KGDA 2FADA 3CE7A 1K8AQ 2M8PA 3CCLP 1M1KQ 3EJDA 2LL8A 3Q20A 2LTEA 1VQMP 5CZDB 5F2KA 2CGQA 4XRQA 2GDXA 2AVAA 3M1MA 1Q7YQ 3I55P 2LIUA 2GZGA 1K73Q 2JYLA 2PENA 4PWVB 2M5RA 3CXCO 4BPFA 2PEIA 1E6JP 2EHSA 1CEIA 2EHTA 3DPHA 5I4TG 1Q86Q 2KGCA 5F2OA 2KOSA 3WBHA 3RG2A 2DNWA 1E0HA 4U0CA 2Z46A 1HY8A 1VQNP 1YJWP 2LOLA 2MVVA 5HV8A 3RG6C 3CCJP 3G21A 2QA4P 2WPTA 3I56P 4CA3A 1AUMA 2N5IA 2JGPA 2OARA 1YJ9P 3U43A 2AFDA 4PH1A 1QRJA 2KGEA 2VLOA 2K0XA 4XFXA 2KG9A 3CCMP 1M6EX 1QVFO 3G26A 3E2DA 1VHNA 2N5HA 3G4SP 4MRTC 2MR8A 7CEIA 1QVGO 2FQ2A 2N6YA 2K0YA 4GR2A 1RNIA 2NO8A 4R0MA 2KG6A 2KODA 3CCQP 5DCKA 1BXIA 4H2WC 3DS3A 2JB0A 3G6EP 5KP7B 1YI2P 2PEOA 1MZ8A 2K93A 1K30A 3CD6P 4PH0A 1VQ6P 4XFZA 1S72P 1KD1Q 2P9XA 3HZQA 2AF8A 1FR2A 2GZFA 4F37A 4IZ6A 1VQOP 2KOQA 2FVEA 3CC2P 5EJDA 1JJ2O 2PEQA 2XZ0D 2GZEA 2BHVA 3GZMA 2JAZA 1M6NA 1ACPA 2PEMA 1EOQA 2FQ0A 3EJBA 3CMEP 2ERHA 2GZIA 4H2YC 1L0IA 5JPAA 2PEJA 4QKOA 5HGOA 3H47A
chains in the Genus database with same CATH topology
2JU2A 2JU1A 4CA3A 2N5IA 2MD9A 2JGPA 1NQ4A 2MF4A 2N50A 1DNYA 5KP8B 2VSQA 2CNRA 2AFDA 5KP6B 2KORA 4DG9A 2QNWA 1KLPA 2KGAA 2KGEA 2K0XA 2KG9A 2ROQA 2L4BA 2MY5A 2N5HA 2N98A 2FQ1A 2GDYA 2MR7A 1L0HA 4NEOA 1T8KA 2KG8A 2FADA 2KGDA 2LPKA 2MR8A 3CE7A 4MRTC 2FQ2A 3EJDA 2KR5A 2LL8A 2N6YA 1DV5A 2LTEA 2K0YA 2LKIA 2CQ8A 4R0MA 2KG6A 2AFEA 2PNGA 4H2WC 4H2XC 2L0QA 5KP7B 2FAEA 2FACA 2KOOA 4BPGA 5CZDB 2KW2A 2FVAA 2LIWA 2K93A 2CGQA 1HQBA 2XZ1C 2GDXA 2K92A 2AVAA 2LIUA 2N6ZA 3GZLA 5HVCA 2L22A 1AF8A 2AF8A 4PWVB 4IZ6A 2M5RA 2KOQA 4BPFA 2GDWA 2EHSA 2EHTA 2FVEA 2KGCA 2MVUA 5EJDA 2KOSA 2K2QA 1OR5A 3RG2A 1VKUA 2XZ0D 1X3OA 3LMOA 2FHSC 4PXHB 2L9FA 2DNWA 2X2BA 3GZMA 3NY7B 2K94A 2JQ4A 1HY8A 1ACPA 2CG5B 2FQ0A 1F80D 4HKGA 2LOLA 3EJBA 2MVVA 2KWLA 5HV8A 2KOPA 4H2YC 2FVFA 1L0IA 3EJEA 2LMLA 4BPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JU2 A;  2JU1 A;  4CA3 A;  2N5I A;  2MD9 A;  2JGP A;  1NQ4 A;  2MF4 A;  2N50 A;  1DNY A;  5KP8 B;  2VSQ A;  2CNR A;  2AFD A;  5KP6 B;  2KOR A;  4DG9 A;  2QNW A;  1KLP A;  2KGA A;  2KGE A;  2K0X A;  2KG9 A;  2ROQ A;  2L4B A;  2MY5 A;  2N5H A;  2N98 A;  2FQ1 A;  2GDY A;  2MR7 A;  1L0H A;  4NEO A;  1T8K A;  2KG8 A;  2FAD A;  2KGD A;  2LPK A;  2MR8 A;  3CE7 A;  4MRT C;  2FQ2 A;  3EJD A;  2KR5 A;  2LL8 A;  2N6Y A;  1DV5 A;  2LTE A;  2K0Y A;  2LKI A;  2CQ8 A;  4R0M A;  2KG6 A;  2AFE A;  2PNG A;  4H2W C;  4H2X C;  2L0Q A;  5KP7 B;  2FAE A;  2FAC A;  2KOO A;  4BPG A;  5CZD B;  2KW2 A;  2FVA A;  2LIW A;  2K93 A;  2CGQ A;  1HQB A;  2XZ1 C;  2GDX A;  2K92 A;  2AVA A;  2LIU A;  2N6Z A;  3GZL A;  5HVC A;  2L22 A;  1AF8 A;  2AF8 A;  4PWV B;  4IZ6 A;  2M5R A;  2KOQ A;  4BPF A;  2GDW A;  2EHS A;  2EHT A;  2FVE A;  2KGC A;  2MVU A;  5EJD A;  2KOS A;  2K2Q A;  1OR5 A;  3RG2 A;  1VKU A;  2XZ0 D;  1X3O A;  3LMO A;  2FHS C;  4PXH B;  2L9F A;  2DNW A;  2X2B A;  3GZM A;  3NY7 B;  2K94 A;  2JQ4 A;  1HY8 A;  1ACP A;  2CG5 B;  2FQ0 A;  1F80 D;  4HKG A;  2LOL A;  3EJB A;  2MVV A;  2KWL A;  5HV8 A;  2KOP A;  4H2Y C;  2FVF A;  1L0I A;  3EJE A;  2LML A;  4BPH A; 
#chains in the Genus database with same CATH topology
 1D1D A;  1YHQ P;  3GKL C;  2M8L A;  3VRL C;  1VQK P;  4WYM A;  1VQ8 P;  1IUQ A;  2VSQ A;  3G1I A;  5HGL A;  2OTJ P;  2CNR A;  2JYG A;  2GZJ A;  3DS5 A;  3G1G A;  2KGA A;  1GXH A;  1M90 Q;  2LF4 A;  2E1M A;  1GXG A;  3CCS P;  2MY5 A;  2FQ1 A;  2VLN A;  2GDY A;  4NEO A;  1K9M Q;  3G0V A;  2VLQ A;  5HGN A;  1VQ7 P;  4UHP B;  2KR5 A;  2GYK A;  2LKI A;  3P05 A;  2K5X A;  1RO2 A;  4XRO A;  2AFE A;  2PNG A;  4H2X C;  3H4E A;  5EW5 E;  2VLP A;  1YIJ P;  2FAC A;  2FAE A;  4XFY A;  2KOO A;  1EIA A;  2EIA A;  4BPG A;  3B4Q A;  2ONT A;  2KW2 A;  2LIW A;  1YJN P;  1HQB A;  1N8R Q;  3CMA P;  2N6Z A;  3GZL A;  1UJZ A;  2BUO A;  2L6E A;  3CCV P;  2DGY A;  3G71 P;  1VQ4 P;  4U0D A;  1GPJ A;  2K2Q A;  4U0F A;  3LRY A;  3H0D A;  2EG5 A;  1X3O A;  2X2B A;  2K94 A;  1Q81 Q;  5F2N A;  4HKG A;  1F80 D;  4U0B A;  3HYB A;  2KOP A;  1YIT P;  2XV6 A;  1W2B O;  3EJE A;  1VQ5 P;  4GR6 A;  4BPH A;  2JU2 A;  2Z45 A;  2CWO A;  5HGM A;  4M0I A;  2JU1 A;  2M8N A;  2MF4 A;  4U0E A;  5KP8 B;  3CCR P;  2XT1 A;  3CC7 P;  3B5I A;  2EFJ A;  4U0A A;  3DS0 A;  2MR7 A;  2KG8 A;  3DS4 A;  2LPK A;  3CC4 P;  3DS1 A;  1ZNV A;  1A8O A;  1DV5 A;  2CQ8 A;  1UNK A;  1M74 A;  2L0Q A;  1EMV A;  2JBG A;  5BS1 A;  2FVA A;  1ZMB A;  2XZ1 C;  2K92 A;  2QEX P;  5HVC A;  2L22 A;  1AF8 A;  1BAJ A;  1VQP P;  2GDW A;  2OTL P;  3GJN A;  3CCE P;  4COC A;  3G29 A;  4COP A;  2MVU A;  1VQL P;  1OR5 A;  1VKU A;  1IMQ A;  4QNB A;  3LMO A;  2FHS C;  4PXH B;  2L9F A;  3NY7 B;  1RO0 A;  2JQ4 A;  2CG5 B;  1AYI A;  1KC8 Q;  2Z44 A;  2KWL A;  2FVF A;  1NJI Q;  2PEK A;  3MGE A;  2LML A;  3NTE A;  1A43 A;  2PY8 A;  4IPY A;  3DTJ A;  3CCU P;  2K0D X;  2MD9 A;  1NQ4 A;  3DS2 A;  1Q82 Q;  2N50 A;  1DNY A;  5BS2 A;  5KP6 B;  2KOR A;  4DG9 A;  2QNW A;  1KLP A;  1KQS O;  3OW2 O;  3G28 A;  3CPW O;  1IMP A;  1Z6M A;  2ROQ A;  2XXM A;  1VQ9 P;  2L4B A;  2N98 A;  1L0H A;  2JO0 A;  1T8K A;  2KGD A;  2FAD A;  3CE7 A;  1K8A Q;  2M8P A;  3CCL P;  1M1K Q;  3EJD A;  2LL8 A;  3Q20 A;  2LTE A;  1VQM P;  5CZD B;  5F2K A;  2CGQ A;  4XRQ A;  2GDX A;  2AVA A;  3M1M A;  1Q7Y Q;  3I55 P;  2LIU A;  2GZG A;  1K73 Q;  2JYL A;  2PEN A;  4PWV B;  2M5R A;  3CXC O;  4BPF A;  2PEI A;  1E6J P;  2EHS A;  1CEI A;  2EHT A;  3DPH A;  5I4T G;  1Q86 Q;  2KGC A;  5F2O A;  2KOS A;  3WBH A;  3RG2 A;  2DNW A;  1E0H A;  4U0C A;  2Z46 A;  1HY8 A;  1VQN P;  1YJW P;  2LOL A;  2MVV A;  5HV8 A;  3RG6 C;  3CCJ P;  3G21 A;  2QA4 P;  2WPT A;  3I56 P;  4CA3 A;  1AUM A;  2N5I A;  2JGP A;  2OAR A;  1YJ9 P;  3U43 A;  2AFD A;  4PH1 A;  1QRJ A;  2KGE A;  2VLO A;  2K0X A;  4XFX A;  2KG9 A;  3CCM P;  1M6E X;  1QVF O;  3G26 A;  3E2D A;  1VHN A;  2N5H A;  3G4S P;  4MRT C;  2MR8 A;  7CEI A;  1QVG O;  2FQ2 A;  2N6Y A;  2K0Y A;  4GR2 A;  1RNI A;  2NO8 A;  4R0M A;  2KG6 A;  2KOD A;  3CCQ P;  5DCK A;  1BXI A;  4H2W C;  3DS3 A;  2JB0 A;  3G6E P;  5KP7 B;  1YI2 P;  2PEO A;  1MZ8 A;  2K93 A;  1K30 A;  3CD6 P;  4PH0 A;  1VQ6 P;  4XFZ A;  1S72 P;  1KD1 Q;  2P9X A;  3HZQ A;  2AF8 A;  1FR2 A;  2GZF A;  4F37 A;  4IZ6 A;  1VQO P;  2KOQ A;  2FVE A;  3CC2 P;  5EJD A;  1JJ2 O;  2PEQ A;  2XZ0 D;  2GZE A;  2BHV A;  3GZM A;  2JAZ A;  1M6N A;  1ACP A;  2PEM A;  1EOQ A;  2FQ0 A;  3EJB A;  3CME P;  2ERH A;  2GZI A;  4H2Y C;  1L0I A;  5JPA A;  2PEJ A;  4QKO A;  5HGO A;  3H47 A; 
#chains in the Genus database with same CATH homology
 2JU2 A;  2JU1 A;  4CA3 A;  2N5I A;  2MD9 A;  2JGP A;  1NQ4 A;  2MF4 A;  2N50 A;  1DNY A;  5KP8 B;  2VSQ A;  2CNR A;  2AFD A;  5KP6 B;  2KOR A;  4DG9 A;  2QNW A;  1KLP A;  2KGA A;  2KGE A;  2K0X A;  2KG9 A;  2ROQ A;  2L4B A;  2MY5 A;  2N5H A;  2N98 A;  2FQ1 A;  2GDY A;  2MR7 A;  1L0H A;  4NEO A;  1T8K A;  2KG8 A;  2FAD A;  2KGD A;  2LPK A;  2MR8 A;  3CE7 A;  4MRT C;  2FQ2 A;  3EJD A;  2KR5 A;  2LL8 A;  2N6Y A;  1DV5 A;  2LTE A;  2K0Y A;  2LKI A;  2CQ8 A;  4R0M A;  2KG6 A;  2AFE A;  2PNG A;  4H2W C;  4H2X C;  2L0Q A;  5KP7 B;  2FAE A;  2FAC A;  2KOO A;  4BPG A;  5CZD B;  2KW2 A;  2FVA A;  2LIW A;  2K93 A;  2CGQ A;  1HQB A;  2XZ1 C;  2GDX A;  2K92 A;  2AVA A;  2LIU A;  2N6Z A;  3GZL A;  5HVC A;  2L22 A;  1AF8 A;  2AF8 A;  4PWV B;  4IZ6 A;  2M5R A;  2KOQ A;  4BPF A;  2GDW A;  2EHS A;  2EHT A;  2FVE A;  2KGC A;  2MVU A;  5EJD A;  2KOS A;  2K2Q A;  1OR5 A;  3RG2 A;  1VKU A;  2XZ0 D;  1X3O A;  3LMO A;  2FHS C;  4PXH B;  2L9F A;  2DNW A;  2X2B A;  3GZM A;  3NY7 B;  2K94 A;  2JQ4 A;  1HY8 A;  1ACP A;  2CG5 B;  2FQ0 A;  1F80 D;  4HKG A;  2LOL A;  3EJB A;  2MVV A;  2KWL A;  5HV8 A;  2KOP A;  4H2Y C;  2FVF A;  1L0I A;  3EJE A;  2LML A;  4BPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...