2N5IA

Pltl-pyrrolyl
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
90
structure length
90
Chain Sequence
MDGEEVKEKIRRYIMEDLIGPSAKEDELDDQTPLLEWGILNSMNIVKLMVYIRDEMGVSIPSTHITGKYFKDLNAISRTVEQLKAESALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Substrate Sequestration in the Pyoluteorin Type II Peptidyl Carrier Protein PltL.
pubmed doi rcsb
source organism Pseudomonas protegens pf-5
molecule tags Transport protein
molecule keywords Peptidyl carrier protein PltL
total genus 26
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n5iA00
1L0HA 2L4BA 1ACPA 2K94A 2MVVA 2AFDA 2KW2A 4BPGA 3GZMA 2K0YA 2KOQA 2L0QA 4IZ6A 5CZDB 1X3OA 4BPHA 1OR5A 2L9FA 2FQ2A 2LPKA 2KOSA 2K2QA 4DG9A 2LKIA 2EHTA 2GDWA 3GZLA 4R0MA 2LMLA 3EJBA 5KP6B 2QNWA 2LOLA 2K92A 2KOPA 5HVCA 1NQ4A 2LL8A 2KGDA 2N6YA 2JU2A 2M5RA 2KGCA 1T8KA 2FACA 2KORA 1AF8A 2DNWA 5KP8B 2FADA 3NY7B 3RG2A 4H2WC 2LIWA 1HQBA 2N5IA 2N98A 2KGEA 2KG9A 2MR7A 2AVAA 2K0XA 2KOOA 2KGAA 4H2XC 1DV5A 1VKUA 4PWVB 2MR8A 1L0IA 2CNRA 5HV8A 2MVUA 2JQ4A 5EJDA 2FVAA 4HKGA 2FVEA 4CA3A 3LMOA 2XZ1C 2N6ZA 4BPFA 2AF8A 2JU1A 2KG6A 2FHSC 2CG5B 4NEOA 4PXHB 3CE7A 2FQ0A 2GDXA 2FAEA 2K93A 2LIUA 2L22A 2ROQA 1F80D 2XZ0D 2CQ8A 1HY8A 2FQ1A 2FVFA 2PNGA 2KWLA 1KLPA 3EJEA 2MF4A 2MD9A 2VSQA 2JGPA 2N50A 2KG8A 2KR5A 2LTEA 2N5HA 2CGQA 2GDYA 4H2YC 3EJDA 2MY5A 4MRTC 1DNYA 2AFEA 2X2BA 2EHSA 5KP7B
chains in the Genus database with same CATH superfamily
1VQLP 4BPGA 2L0QA 2KODA 5CZDB 2L9FA 3U43A 2FQ2A 2LPKA 1YJWP 1M6EX 1N8RQ 5KP6B 1QRJA 1GXHA 2K92A 2KOPA 1NQ4A 2KGDA 5HGOA 7CEIA 2EG5A 3B5IA 1CEIA 1AF8A 2FADA 4U0DA 2ONTA 3RG2A 1VQOP 1HQBA 2N98A 4PH0A 4GR6A 2AVAA 2L6EA 3G1IA 3I55P 2K0XA 2JBGA 2KGAA 4H2XC 4PWVB 3HYBA 1L0IA 1ZMBA 3G21A 5F2KA 3MGEA 2JQ4A 5EJDA 2NO8A 2Z45A 4F37A 2EIAA 2XZ1C 3DPHA 2PEOA 1VQ6P 2FHSC 2CG5B 4QNBA 1YIJP 4PXHB 2K5XA 5F2NA 5JPAA 2L22A 1VQMP 2CQ8A 1EIAA 2KWLA 1KLPA 2PEKA 2VSQA 2WPTA 4GR2A 2CGQA 2GZGA 2OARA 3G28A 3EJDA 1YJ9P 3WBHA 3CCEP 1ZNVA 1L0HA 3CC7P 2DGYA 1ACPA 2AFDA 2KW2A 3GZMA 1RNIA 2JO0A 1UJZA 2K0DX 2EHTA 2XT1A 1BAJA 3CCRP 5EW5E 1K73Q 2QNWA 2E1MA 1S72P 2LL8A 2JU2A 2GZJA 1Z6MA 3G6EP 2M5RA 1AUMA 4PH1A 2DNWA 1YI2P 2KGEA 3GKLC 4QKOA 2LF4A 4XFZA 1DV5A 1VKUA 3OW2O 4M0IA 2VLQA 5HV8A 1QVGO 1KQSO 3I56P 5HGMA 3G0VA 1IMQA 1GXGA 1UNKA 1Q81Q 1EOQA 1VQPP 2GDXA 1FR2A 3H4EA 3G71P 3CC2P 1JJ2O 4U0AA 2FQ1A 2MF4A 2GYKA 2MD9A 3G4SP 2N50A 2KG8A 2LTEA 2Z44A 2N5HA 2GDYA 3CMAP 3DS1A 4MRTC 1EMVA 1DNYA 2M8PA 2AFEA 4XROA 3DS0A 1VQ5P 5HGNA 2L4BA 1VQ8P 5DCKA 2MVVA 1IMPA 2EFJA 3CCJP 1X3OA 2JYGA 4BPHA 3DS4A 4WYMA 3RG6C 1W2BO 1K9MQ 2K2QA 1M6NA 1KD1Q 2GDWA 1GPJA 2QEXP 3M1MA 3NTEA 3GZLA 4R0MA 3EJBA 3DTJA 2GZFA 5HVCA 2PEMA 3DS2A 4COCA 1RO2A 1T8KA 2FACA 3CCUP 2ERHA 5HGLA 3DS3A 1VQNP 3CCVP 1IUQA 2MR8A 3E2DA 2CNRA 1VQ4P 3GJNA 4UHPB 1BXIA 2OTLP 2BHVA 3LRYA 2N6ZA 3P05A 4BPFA 2AF8A 3G29A 2JU1A 2JB0A 3G26A 3CCQP 1MZ8A 2QA4P 4NEOA 3CE7A 2JAZA 1RO0A 2VLOA 2K93A 4U0FA 2ROQA 1F80D 2XZ0D 4U0BA 4U0CA 1VQ7P 1YJNP 1HY8A 2FVFA 4XRQA 3EJEA 2JGPA 3H0DA 5BS2A 3G1GA 2MY5A 3CCLP 2X2BA 2EHSA 1NJIQ 1E0HA 1KC8Q 3CCSP 2K94A 2K0YA 2PY8A 2KOQA 4IZ6A 1OR5A 1YHQP 2KOSA 4DG9A 3HZQA 2GZEA 2LKIA 1VHNA 4COPA 3CPWO 3DS5A 2PEQA 4U0EA 1AYIA 1M1KQ 2LMLA 2XXMA 3H47A 2LOLA 2N6YA 1VQKP 2JYLA 1A8OA 2KGCA 2KORA 2P9XA 5KP8B 1Q7YQ 3NY7B 4H2WC 2LIWA 2N5IA 2KG9A 2MR7A 2BUOA 1Q86Q 1D1DA 1YITP 2PENA 3B4QA 2KOOA 5F2OA 3CMEP 2PEIA 2M8LA 3Q20A 3CCMP 2MVUA 2XV6A 1VQ9P 2CWOA 3CXCO 2FVAA 4HKGA 2FVEA 4CA3A 3LMOA 2OTJP 2KG6A 3CD6P 2FQ0A 3VRLC 2FAEA 2PEJA 4IPYA 2LIUA 1A43A 2PNGA 2M8NA 3CC4P 5I4TG 1Q82Q 5BS1A 2KR5A 4XFYA 1K8AQ 2Z46A 1K30A 4H2YC 2VLPA 2GZIA 1M74A 1M90Q 1E6JP 2VLNA 4XFXA 1QVFO 5KP7B
chains in the Genus database with same CATH topology
1L0HA 2L4BA 1ACPA 2K94A 2MVVA 2AFDA 2KW2A 4BPGA 3GZMA 2K0YA 2KOQA 2L0QA 4IZ6A 5CZDB 1X3OA 4BPHA 1OR5A 2L9FA 2FQ2A 2LPKA 2KOSA 2K2QA 4DG9A 2LKIA 2EHTA 2GDWA 3GZLA 4R0MA 2LMLA 3EJBA 5KP6B 2QNWA 2LOLA 2K92A 2KOPA 5HVCA 1NQ4A 2LL8A 2KGDA 2N6YA 2JU2A 2M5RA 2KGCA 1T8KA 2FACA 2KORA 1AF8A 2DNWA 5KP8B 2FADA 3NY7B 3RG2A 4H2WC 2LIWA 1HQBA 2N5IA 2N98A 2KGEA 2KG9A 2MR7A 2AVAA 2K0XA 2KOOA 2KGAA 4H2XC 1DV5A 1VKUA 4PWVB 2MR8A 1L0IA 2CNRA 5HV8A 2MVUA 2JQ4A 5EJDA 2FVAA 4HKGA 2FVEA 4CA3A 3LMOA 2XZ1C 2N6ZA 4BPFA 2AF8A 2JU1A 2KG6A 2FHSC 2CG5B 4NEOA 4PXHB 3CE7A 2FQ0A 2GDXA 2FAEA 2K93A 2LIUA 2L22A 2ROQA 1F80D 2XZ0D 2CQ8A 1HY8A 2FQ1A 2FVFA 2PNGA 2KWLA 1KLPA 3EJEA 2MF4A 2MD9A 2VSQA 2JGPA 2N50A 2KG8A 2KR5A 2LTEA 2N5HA 2CGQA 2GDYA 4H2YC 3EJDA 2MY5A 4MRTC 1DNYA 2AFEA 2X2BA 2EHSA 5KP7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0H A;  2L4B A;  1ACP A;  2K94 A;  2MVV A;  2AFD A;  2KW2 A;  4BPG A;  3GZM A;  2K0Y A;  2KOQ A;  2L0Q A;  4IZ6 A;  5CZD B;  1X3O A;  4BPH A;  1OR5 A;  2L9F A;  2FQ2 A;  2LPK A;  2KOS A;  2K2Q A;  4DG9 A;  2LKI A;  2EHT A;  2GDW A;  3GZL A;  4R0M A;  2LML A;  3EJB A;  5KP6 B;  2QNW A;  2LOL A;  2K92 A;  2KOP A;  5HVC A;  1NQ4 A;  2LL8 A;  2KGD A;  2N6Y A;  2JU2 A;  2M5R A;  2KGC A;  1T8K A;  2FAC A;  2KOR A;  1AF8 A;  2DNW A;  5KP8 B;  2FAD A;  3NY7 B;  3RG2 A;  4H2W C;  2LIW A;  1HQB A;  2N5I A;  2N98 A;  2KGE A;  2KG9 A;  2MR7 A;  2AVA A;  2K0X A;  2KOO A;  2KGA A;  4H2X C;  1DV5 A;  1VKU A;  4PWV B;  2MR8 A;  1L0I A;  2CNR A;  5HV8 A;  2MVU A;  2JQ4 A;  5EJD A;  2FVA A;  4HKG A;  2FVE A;  4CA3 A;  3LMO A;  2XZ1 C;  2N6Z A;  4BPF A;  2AF8 A;  2JU1 A;  2KG6 A;  2FHS C;  2CG5 B;  4NEO A;  4PXH B;  3CE7 A;  2FQ0 A;  2GDX A;  2FAE A;  2K93 A;  2LIU A;  2L22 A;  2ROQ A;  1F80 D;  2XZ0 D;  2CQ8 A;  1HY8 A;  2FQ1 A;  2FVF A;  2PNG A;  2KWL A;  1KLP A;  3EJE A;  2MF4 A;  2MD9 A;  2VSQ A;  2JGP A;  2N50 A;  2KG8 A;  2KR5 A;  2LTE A;  2N5H A;  2CGQ A;  2GDY A;  4H2Y C;  3EJD A;  2MY5 A;  4MRT C;  1DNY A;  2AFE A;  2X2B A;  2EHS A;  5KP7 B; 
#chains in the Genus database with same CATH topology
 1VQL P;  4BPG A;  2L0Q A;  2KOD A;  5CZD B;  2L9F A;  3U43 A;  2FQ2 A;  2LPK A;  1YJW P;  1M6E X;  1N8R Q;  5KP6 B;  1QRJ A;  1GXH A;  2K92 A;  2KOP A;  1NQ4 A;  2KGD A;  5HGO A;  7CEI A;  2EG5 A;  3B5I A;  1CEI A;  1AF8 A;  2FAD A;  4U0D A;  2ONT A;  3RG2 A;  1VQO P;  1HQB A;  2N98 A;  4PH0 A;  4GR6 A;  2AVA A;  2L6E A;  3G1I A;  3I55 P;  2K0X A;  2JBG A;  2KGA A;  4H2X C;  4PWV B;  3HYB A;  1L0I A;  1ZMB A;  3G21 A;  5F2K A;  3MGE A;  2JQ4 A;  5EJD A;  2NO8 A;  2Z45 A;  4F37 A;  2EIA A;  2XZ1 C;  3DPH A;  2PEO A;  1VQ6 P;  2FHS C;  2CG5 B;  4QNB A;  1YIJ P;  4PXH B;  2K5X A;  5F2N A;  5JPA A;  2L22 A;  1VQM P;  2CQ8 A;  1EIA A;  2KWL A;  1KLP A;  2PEK A;  2VSQ A;  2WPT A;  4GR2 A;  2CGQ A;  2GZG A;  2OAR A;  3G28 A;  3EJD A;  1YJ9 P;  3WBH A;  3CCE P;  1ZNV A;  1L0H A;  3CC7 P;  2DGY A;  1ACP A;  2AFD A;  2KW2 A;  3GZM A;  1RNI A;  2JO0 A;  1UJZ A;  2K0D X;  2EHT A;  2XT1 A;  1BAJ A;  3CCR P;  5EW5 E;  1K73 Q;  2QNW A;  2E1M A;  1S72 P;  2LL8 A;  2JU2 A;  2GZJ A;  1Z6M A;  3G6E P;  2M5R A;  1AUM A;  4PH1 A;  2DNW A;  1YI2 P;  2KGE A;  3GKL C;  4QKO A;  2LF4 A;  4XFZ A;  1DV5 A;  1VKU A;  3OW2 O;  4M0I A;  2VLQ A;  5HV8 A;  1QVG O;  1KQS O;  3I56 P;  5HGM A;  3G0V A;  1IMQ A;  1GXG A;  1UNK A;  1Q81 Q;  1EOQ A;  1VQP P;  2GDX A;  1FR2 A;  3H4E A;  3G71 P;  3CC2 P;  1JJ2 O;  4U0A A;  2FQ1 A;  2MF4 A;  2GYK A;  2MD9 A;  3G4S P;  2N50 A;  2KG8 A;  2LTE A;  2Z44 A;  2N5H A;  2GDY A;  3CMA P;  3DS1 A;  4MRT C;  1EMV A;  1DNY A;  2M8P A;  2AFE A;  4XRO A;  3DS0 A;  1VQ5 P;  5HGN A;  2L4B A;  1VQ8 P;  5DCK A;  2MVV A;  1IMP A;  2EFJ A;  3CCJ P;  1X3O A;  2JYG A;  4BPH A;  3DS4 A;  4WYM A;  3RG6 C;  1W2B O;  1K9M Q;  2K2Q A;  1M6N A;  1KD1 Q;  2GDW A;  1GPJ A;  2QEX P;  3M1M A;  3NTE A;  3GZL A;  4R0M A;  3EJB A;  3DTJ A;  2GZF A;  5HVC A;  2PEM A;  3DS2 A;  4COC A;  1RO2 A;  1T8K A;  2FAC A;  3CCU P;  2ERH A;  5HGL A;  3DS3 A;  1VQN P;  3CCV P;  1IUQ A;  2MR8 A;  3E2D A;  2CNR A;  1VQ4 P;  3GJN A;  4UHP B;  1BXI A;  2OTL P;  2BHV A;  3LRY A;  2N6Z A;  3P05 A;  4BPF A;  2AF8 A;  3G29 A;  2JU1 A;  2JB0 A;  3G26 A;  3CCQ P;  1MZ8 A;  2QA4 P;  4NEO A;  3CE7 A;  2JAZ A;  1RO0 A;  2VLO A;  2K93 A;  4U0F A;  2ROQ A;  1F80 D;  2XZ0 D;  4U0B A;  4U0C A;  1VQ7 P;  1YJN P;  1HY8 A;  2FVF A;  4XRQ A;  3EJE A;  2JGP A;  3H0D A;  5BS2 A;  3G1G A;  2MY5 A;  3CCL P;  2X2B A;  2EHS A;  1NJI Q;  1E0H A;  1KC8 Q;  3CCS P;  2K94 A;  2K0Y A;  2PY8 A;  2KOQ A;  4IZ6 A;  1OR5 A;  1YHQ P;  2KOS A;  4DG9 A;  3HZQ A;  2GZE A;  2LKI A;  1VHN A;  4COP A;  3CPW O;  3DS5 A;  2PEQ A;  4U0E A;  1AYI A;  1M1K Q;  2LML A;  2XXM A;  3H47 A;  2LOL A;  2N6Y A;  1VQK P;  2JYL A;  1A8O A;  2KGC A;  2KOR A;  2P9X A;  5KP8 B;  1Q7Y Q;  3NY7 B;  4H2W C;  2LIW A;  2N5I A;  2KG9 A;  2MR7 A;  2BUO A;  1Q86 Q;  1D1D A;  1YIT P;  2PEN A;  3B4Q A;  2KOO A;  5F2O A;  3CME P;  2PEI A;  2M8L A;  3Q20 A;  3CCM P;  2MVU A;  2XV6 A;  1VQ9 P;  2CWO A;  3CXC O;  2FVA A;  4HKG A;  2FVE A;  4CA3 A;  3LMO A;  2OTJ P;  2KG6 A;  3CD6 P;  2FQ0 A;  3VRL C;  2FAE A;  2PEJ A;  4IPY A;  2LIU A;  1A43 A;  2PNG A;  2M8N A;  3CC4 P;  5I4T G;  1Q82 Q;  5BS1 A;  2KR5 A;  4XFY A;  1K8A Q;  2Z46 A;  1K30 A;  4H2Y C;  2VLP A;  2GZI A;  1M74 A;  1M90 Q;  1E6J P;  2VLN A;  4XFX A;  1QVF O;  5KP7 B; 
#chains in the Genus database with same CATH homology
 1L0H A;  2L4B A;  1ACP A;  2K94 A;  2MVV A;  2AFD A;  2KW2 A;  4BPG A;  3GZM A;  2K0Y A;  2KOQ A;  2L0Q A;  4IZ6 A;  5CZD B;  1X3O A;  4BPH A;  1OR5 A;  2L9F A;  2FQ2 A;  2LPK A;  2KOS A;  2K2Q A;  4DG9 A;  2LKI A;  2EHT A;  2GDW A;  3GZL A;  4R0M A;  2LML A;  3EJB A;  5KP6 B;  2QNW A;  2LOL A;  2K92 A;  2KOP A;  5HVC A;  1NQ4 A;  2LL8 A;  2KGD A;  2N6Y A;  2JU2 A;  2M5R A;  2KGC A;  1T8K A;  2FAC A;  2KOR A;  1AF8 A;  2DNW A;  5KP8 B;  2FAD A;  3NY7 B;  3RG2 A;  4H2W C;  2LIW A;  1HQB A;  2N5I A;  2N98 A;  2KGE A;  2KG9 A;  2MR7 A;  2AVA A;  2K0X A;  2KOO A;  2KGA A;  4H2X C;  1DV5 A;  1VKU A;  4PWV B;  2MR8 A;  1L0I A;  2CNR A;  5HV8 A;  2MVU A;  2JQ4 A;  5EJD A;  2FVA A;  4HKG A;  2FVE A;  4CA3 A;  3LMO A;  2XZ1 C;  2N6Z A;  4BPF A;  2AF8 A;  2JU1 A;  2KG6 A;  2FHS C;  2CG5 B;  4NEO A;  4PXH B;  3CE7 A;  2FQ0 A;  2GDX A;  2FAE A;  2K93 A;  2LIU A;  2L22 A;  2ROQ A;  1F80 D;  2XZ0 D;  2CQ8 A;  1HY8 A;  2FQ1 A;  2FVF A;  2PNG A;  2KWL A;  1KLP A;  3EJE A;  2MF4 A;  2MD9 A;  2VSQ A;  2JGP A;  2N50 A;  2KG8 A;  2KR5 A;  2LTE A;  2N5H A;  2CGQ A;  2GDY A;  4H2Y C;  3EJD A;  2MY5 A;  4MRT C;  1DNY A;  2AFE A;  2X2B A;  2EHS A;  5KP7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...