2N5IA

Pltl-pyrrolyl
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
90
structure length
90
Chain Sequence
MDGEEVKEKIRRYIMEDLIGPSAKEDELDDQTPLLEWGILNSMNIVKLMVYIRDEMGVSIPSTHITGKYFKDLNAISRTVEQLKAESALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Substrate Sequestration in the Pyoluteorin Type II Peptidyl Carrier Protein PltL.
pubmed doi rcsb
source organism Pseudomonas protegens pf-5
molecule tags Transport protein
molecule keywords Peptidyl carrier protein PltL
total genus 26
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n5iA00
2LPKA 1F80D 2ROQA 2PNGA 2LIWA 2AFDA 2M5RA 2KOOA 3NY7B 2LKIA 2KGAA 2KOPA 2FADA 3GZLA 4PXHB 2KR5A 2KWLA 2AVAA 2N98A 5HVCA 2KOQA 2DNWA 2QNWA 3GZMA 2XZ1C 2JU1A 2MVUA 2N5IA 2MR8A 4DG9A 5EJDA 2KORA 2L0QA 2MVVA 1T8KA 1HQBA 4MRTC 1AF8A 2EHSA 2LTEA 2FHSC 2KW2A 2JQ4A 4NEOA 4R0MA 2AF8A 5KP7B 4CA3A 5KP8B 1L0IA 3CE7A 2KGCA 2CNRA 2FQ2A 2KG8A 2MR7A 2FVAA 2FQ0A 1HY8A 2K2QA 2MF4A 4H2YC 3EJEA 2K94A 5KP6B 2KGDA 2FACA 2FQ1A 2JGPA 2XZ0D 1L0HA 2FVEA 1OR5A 2N6ZA 4BPHA 2K0YA 2LOLA 2LMLA 2KG6A 2N6YA 4H2WC 2EHTA 2LIUA 4HKGA 2L9FA 1ACPA 2VSQA 3EJBA 2MD9A 2X2BA 4PWVB 4BPFA 2LL8A 4H2XC 2KOSA 2KGEA 2L22A 5HV8A 1KLPA 2MY5A 2CG5B 2K0XA 2JU2A 1NQ4A 5CZDB 4IZ6A 2CGQA 2GDWA 2N5HA 3LMOA 2L4BA 4BPGA 1X3OA 2CQ8A 2FVFA 2GDXA 3RG2A 2GDYA 3EJDA 2N50A 1DV5A 2AFEA 2KG9A 2K92A 2FAEA 1VKUA 1DNYA 2K93A
chains in the Genus database with same CATH superfamily
1JJ2O 2LPKA 2LIWA 1QVGO 1YI2P 2KOOA 3NY7B 4WYMA 2KGAA 2KOPA 1S72P 2GZEA 3GZLA 2KR5A 2AVAA 2N98A 2DNWA 2XZ1C 2MVUA 1Q82Q 1T8KA 3CC7P 2PEMA 3Q20A 3LRYA 2BUOA 1GXGA 2ERHA 4U0BA 4XROA 1W2BO 3CE7A 2FQ0A 2MF4A 1YIJP 3EJEA 2FQ1A 3NTEA 2GYKA 1N8RQ 1Q7YQ 4BPHA 2K0YA 2M8PA 2KG6A 2BHVA 1VQPP 4HKGA 1ACPA 2VSQA 3H47A 4F37A 3EJBA 2EFJA 3HZQA 2KOSA 4QKOA 5HGNA 5EW5E 3CCRP 4XFXA 5HV8A 1YJWP 2E1MA 1VQMP 1NQ4A 1K73Q 1MZ8A 3DS4A 4IZ6A 2CGQA 2GDWA 2N5HA 3LMOA 4BPGA 4U0AA 1X3OA 2FVFA 1BXIA 3GJNA 3DS5A 1VQLP 2QEXP 2DGYA 1Z6MA 2OARA 4U0DA 1VKUA 1DNYA 2K93A 2Z44A 5F2OA 3M1MA 2OTLP 2PNGA 3GKLC 2AFDA 2LKIA 4XFZA 1D1DA 3CCSP 2KWLA 5HVCA 4GR6A 1EIAA 2JU1A 3G1IA 4U0FA 2MR8A 1Q81Q 2KORA 3CCMP 4U0CA 1VQ6P 2MVVA 3CCLP 2PEJA 2ONTA 3H4EA 1AF8A 2XV6A 2PEIA 2JQ4A 3CC2P 1YHQP 4NEOA 4R0MA 2K5XA 5KP8B 1L0IA 2JYGA 4PH1A 3CD6P 2KGCA 1KC8Q 2FQ2A 2KG8A 2MR7A 3CMAP 2FVAA 1HY8A 2K2QA 5F2NA 2FACA 3G6EP 2JGPA 3DPHA 1L0HA 3DS3A 2FVEA 3G28A 2LOLA 3P05A 3CCEP 2L9FA 4COPA 2JB0A 1E0HA 2P9XA 1VQ8P 2LL8A 1RO2A 2PEKA 1K8AQ 4GR2A 3DS0A 2JU2A 3HYBA 3G1GA 1EOQA 2JO0A 2PY8A 3CPWO 2GDYA 3CCJP 1M74A 3EJDA 1NJIQ 2QA4P 2K92A 2FAEA 4QNBA 2M8NA 1F80D 2ROQA 2XXMA 3B5IA 3WBHA 2M5RA 5HGOA 1A8OA 4PXHB 3G29A 3GZMA 1QVFO 2N5IA 5EJDA 4UHPB 1UNKA 4PH0A 4MRTC 2GZJA 2EG5A 1IUQA 5I4TG 2K0DX 2PEQA 1UJZA 2Z46A 5KP7B 3CCVP 1E6JP 3G21A 1YJNP 2CNRA 1IMQA 3OW2O 1AYIA 3CXCO 5HGMA 1RO0A 2KGDA 2VLNA 1YJ9P 3DS2A 2M8LA 2XZ0D 3DTJA 2N6ZA 3G4SP 2N6YA 1VQNP 5BS1A 2LIUA 1FR2A 3CMEP 3G0VA 1RNIA 3E2DA 5DCKA 2MD9A 1M6NA 2X2BA 4PWVB 4BPFA 1K30A 2L6EA 2KGEA 1VQ9P 2L22A 1KLPA 2CG5B 5CZDB 2PEOA 2KODA 3RG6C 1AUMA 2L4BA 2CQ8A 1KQSO 2VLPA 1VQOP 3RG2A 4IPYA 3B4QA 4XRQA 1DV5A 1ZNVA 1IMPA 1QRJA 2XT1A 1KD1Q 1BAJA 2VLQA 1Q86Q 4COCA 1CEIA 2FADA 1K9MQ 3MGEA 1VQ7P 1VQ5P 2KOQA 2QNWA 4DG9A 4M0IA 4U0EA 2L0QA 3CCUP 2Z45A 2OTJP 3I56P 5HGLA 2GZGA 1HQBA 7CEIA 1M1KQ 5BS2A 2EHSA 3DS1A 3U43A 2LTEA 2FHSC 3CCQP 2KW2A 3VRLC 1YITP 3H0DA 2AF8A 2NO8A 1GPJA 4CA3A 1GXHA 1VHNA 4H2YC 2EIAA 2K94A 5KP6B 1OR5A 2LMLA 2LF4A 4H2WC 2EHTA 1VQ4P 1VQKP 4H2XC 3G26A 2JBGA 1M90Q 2PENA 1ZMBA 2MY5A 2K0XA 1A43A 3G71P 2WPTA 1M6EX 5F2KA 2GDXA 1EMVA 5JPAA 3I55P 2VLOA 2N50A 2GZIA 2AFEA 2GZFA 3CC4P 2JYLA 2KG9A 4XFYA 2JAZA 2CWOA
chains in the Genus database with same CATH topology
2LPKA 1F80D 2ROQA 2PNGA 2LIWA 2AFDA 2M5RA 2KOOA 3NY7B 2LKIA 2KGAA 2KOPA 2FADA 3GZLA 4PXHB 2KR5A 2KWLA 2AVAA 2N98A 5HVCA 2KOQA 2DNWA 2QNWA 3GZMA 2XZ1C 2JU1A 2MVUA 2N5IA 2MR8A 4DG9A 5EJDA 2KORA 2L0QA 2MVVA 1T8KA 1HQBA 4MRTC 1AF8A 2EHSA 2LTEA 2FHSC 2KW2A 2JQ4A 4NEOA 4R0MA 2AF8A 5KP7B 4CA3A 5KP8B 1L0IA 3CE7A 2KGCA 2CNRA 2FQ2A 2KG8A 2MR7A 2FVAA 2FQ0A 1HY8A 2K2QA 2MF4A 4H2YC 3EJEA 2K94A 5KP6B 2KGDA 2FACA 2FQ1A 2JGPA 2XZ0D 1L0HA 2FVEA 1OR5A 2N6ZA 4BPHA 2K0YA 2LOLA 2LMLA 2KG6A 2N6YA 4H2WC 2EHTA 2LIUA 4HKGA 2L9FA 1ACPA 2VSQA 3EJBA 2MD9A 2X2BA 4PWVB 4BPFA 2LL8A 4H2XC 2KOSA 2KGEA 2L22A 5HV8A 1KLPA 2MY5A 2CG5B 2K0XA 2JU2A 1NQ4A 5CZDB 4IZ6A 2CGQA 2GDWA 2N5HA 3LMOA 2L4BA 4BPGA 1X3OA 2CQ8A 2FVFA 2GDXA 3RG2A 2GDYA 3EJDA 2N50A 1DV5A 2AFEA 2KG9A 2K92A 2FAEA 1VKUA 1DNYA 2K93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPK A;  1F80 D;  2ROQ A;  2PNG A;  2LIW A;  2AFD A;  2M5R A;  2KOO A;  3NY7 B;  2LKI A;  2KGA A;  2KOP A;  2FAD A;  3GZL A;  4PXH B;  2KR5 A;  2KWL A;  2AVA A;  2N98 A;  5HVC A;  2KOQ A;  2DNW A;  2QNW A;  3GZM A;  2XZ1 C;  2JU1 A;  2MVU A;  2N5I A;  2MR8 A;  4DG9 A;  5EJD A;  2KOR A;  2L0Q A;  2MVV A;  1T8K A;  1HQB A;  4MRT C;  1AF8 A;  2EHS A;  2LTE A;  2FHS C;  2KW2 A;  2JQ4 A;  4NEO A;  4R0M A;  2AF8 A;  5KP7 B;  4CA3 A;  5KP8 B;  1L0I A;  3CE7 A;  2KGC A;  2CNR A;  2FQ2 A;  2KG8 A;  2MR7 A;  2FVA A;  2FQ0 A;  1HY8 A;  2K2Q A;  2MF4 A;  4H2Y C;  3EJE A;  2K94 A;  5KP6 B;  2KGD A;  2FAC A;  2FQ1 A;  2JGP A;  2XZ0 D;  1L0H A;  2FVE A;  1OR5 A;  2N6Z A;  4BPH A;  2K0Y A;  2LOL A;  2LML A;  2KG6 A;  2N6Y A;  4H2W C;  2EHT A;  2LIU A;  4HKG A;  2L9F A;  1ACP A;  2VSQ A;  3EJB A;  2MD9 A;  2X2B A;  4PWV B;  4BPF A;  2LL8 A;  4H2X C;  2KOS A;  2KGE A;  2L22 A;  5HV8 A;  1KLP A;  2MY5 A;  2CG5 B;  2K0X A;  2JU2 A;  1NQ4 A;  5CZD B;  4IZ6 A;  2CGQ A;  2GDW A;  2N5H A;  3LMO A;  2L4B A;  4BPG A;  1X3O A;  2CQ8 A;  2FVF A;  2GDX A;  3RG2 A;  2GDY A;  3EJD A;  2N50 A;  1DV5 A;  2AFE A;  2KG9 A;  2K92 A;  2FAE A;  1VKU A;  1DNY A;  2K93 A; 
#chains in the Genus database with same CATH topology
 1JJ2 O;  2LPK A;  2LIW A;  1QVG O;  1YI2 P;  2KOO A;  3NY7 B;  4WYM A;  2KGA A;  2KOP A;  1S72 P;  2GZE A;  3GZL A;  2KR5 A;  2AVA A;  2N98 A;  2DNW A;  2XZ1 C;  2MVU A;  1Q82 Q;  1T8K A;  3CC7 P;  2PEM A;  3Q20 A;  3LRY A;  2BUO A;  1GXG A;  2ERH A;  4U0B A;  4XRO A;  1W2B O;  3CE7 A;  2FQ0 A;  2MF4 A;  1YIJ P;  3EJE A;  2FQ1 A;  3NTE A;  2GYK A;  1N8R Q;  1Q7Y Q;  4BPH A;  2K0Y A;  2M8P A;  2KG6 A;  2BHV A;  1VQP P;  4HKG A;  1ACP A;  2VSQ A;  3H47 A;  4F37 A;  3EJB A;  2EFJ A;  3HZQ A;  2KOS A;  4QKO A;  5HGN A;  5EW5 E;  3CCR P;  4XFX A;  5HV8 A;  1YJW P;  2E1M A;  1VQM P;  1NQ4 A;  1K73 Q;  1MZ8 A;  3DS4 A;  4IZ6 A;  2CGQ A;  2GDW A;  2N5H A;  3LMO A;  4BPG A;  4U0A A;  1X3O A;  2FVF A;  1BXI A;  3GJN A;  3DS5 A;  1VQL P;  2QEX P;  2DGY A;  1Z6M A;  2OAR A;  4U0D A;  1VKU A;  1DNY A;  2K93 A;  2Z44 A;  5F2O A;  3M1M A;  2OTL P;  2PNG A;  3GKL C;  2AFD A;  2LKI A;  4XFZ A;  1D1D A;  3CCS P;  2KWL A;  5HVC A;  4GR6 A;  1EIA A;  2JU1 A;  3G1I A;  4U0F A;  2MR8 A;  1Q81 Q;  2KOR A;  3CCM P;  4U0C A;  1VQ6 P;  2MVV A;  3CCL P;  2PEJ A;  2ONT A;  3H4E A;  1AF8 A;  2XV6 A;  2PEI A;  2JQ4 A;  3CC2 P;  1YHQ P;  4NEO A;  4R0M A;  2K5X A;  5KP8 B;  1L0I A;  2JYG A;  4PH1 A;  3CD6 P;  2KGC A;  1KC8 Q;  2FQ2 A;  2KG8 A;  2MR7 A;  3CMA P;  2FVA A;  1HY8 A;  2K2Q A;  5F2N A;  2FAC A;  3G6E P;  2JGP A;  3DPH A;  1L0H A;  3DS3 A;  2FVE A;  3G28 A;  2LOL A;  3P05 A;  3CCE P;  2L9F A;  4COP A;  2JB0 A;  1E0H A;  2P9X A;  1VQ8 P;  2LL8 A;  1RO2 A;  2PEK A;  1K8A Q;  4GR2 A;  3DS0 A;  2JU2 A;  3HYB A;  3G1G A;  1EOQ A;  2JO0 A;  2PY8 A;  3CPW O;  2GDY A;  3CCJ P;  1M74 A;  3EJD A;  1NJI Q;  2QA4 P;  2K92 A;  2FAE A;  4QNB A;  2M8N A;  1F80 D;  2ROQ A;  2XXM A;  3B5I A;  3WBH A;  2M5R A;  5HGO A;  1A8O A;  4PXH B;  3G29 A;  3GZM A;  1QVF O;  2N5I A;  5EJD A;  4UHP B;  1UNK A;  4PH0 A;  4MRT C;  2GZJ A;  2EG5 A;  1IUQ A;  5I4T G;  2K0D X;  2PEQ A;  1UJZ A;  2Z46 A;  5KP7 B;  3CCV P;  1E6J P;  3G21 A;  1YJN P;  2CNR A;  1IMQ A;  3OW2 O;  1AYI A;  3CXC O;  5HGM A;  1RO0 A;  2KGD A;  2VLN A;  1YJ9 P;  3DS2 A;  2M8L A;  2XZ0 D;  3DTJ A;  2N6Z A;  3G4S P;  2N6Y A;  1VQN P;  5BS1 A;  2LIU A;  1FR2 A;  3CME P;  3G0V A;  1RNI A;  3E2D A;  5DCK A;  2MD9 A;  1M6N A;  2X2B A;  4PWV B;  4BPF A;  1K30 A;  2L6E A;  2KGE A;  1VQ9 P;  2L22 A;  1KLP A;  2CG5 B;  5CZD B;  2PEO A;  2KOD A;  3RG6 C;  1AUM A;  2L4B A;  2CQ8 A;  1KQS O;  2VLP A;  1VQO P;  3RG2 A;  4IPY A;  3B4Q A;  4XRQ A;  1DV5 A;  1ZNV A;  1IMP A;  1QRJ A;  2XT1 A;  1KD1 Q;  1BAJ A;  2VLQ A;  1Q86 Q;  4COC A;  1CEI A;  2FAD A;  1K9M Q;  3MGE A;  1VQ7 P;  1VQ5 P;  2KOQ A;  2QNW A;  4DG9 A;  4M0I A;  4U0E A;  2L0Q A;  3CCU P;  2Z45 A;  2OTJ P;  3I56 P;  5HGL A;  2GZG A;  1HQB A;  7CEI A;  1M1K Q;  5BS2 A;  2EHS A;  3DS1 A;  3U43 A;  2LTE A;  2FHS C;  3CCQ P;  2KW2 A;  3VRL C;  1YIT P;  3H0D A;  2AF8 A;  2NO8 A;  1GPJ A;  4CA3 A;  1GXH A;  1VHN A;  4H2Y C;  2EIA A;  2K94 A;  5KP6 B;  1OR5 A;  2LML A;  2LF4 A;  4H2W C;  2EHT A;  1VQ4 P;  1VQK P;  4H2X C;  3G26 A;  2JBG A;  1M90 Q;  2PEN A;  1ZMB A;  2MY5 A;  2K0X A;  1A43 A;  3G71 P;  2WPT A;  1M6E X;  5F2K A;  2GDX A;  1EMV A;  5JPA A;  3I55 P;  2VLO A;  2N50 A;  2GZI A;  2AFE A;  2GZF A;  3CC4 P;  2JYL A;  2KG9 A;  4XFY A;  2JAZ A;  2CWO A; 
#chains in the Genus database with same CATH homology
 2LPK A;  1F80 D;  2ROQ A;  2PNG A;  2LIW A;  2AFD A;  2M5R A;  2KOO A;  3NY7 B;  2LKI A;  2KGA A;  2KOP A;  2FAD A;  3GZL A;  4PXH B;  2KR5 A;  2KWL A;  2AVA A;  2N98 A;  5HVC A;  2KOQ A;  2DNW A;  2QNW A;  3GZM A;  2XZ1 C;  2JU1 A;  2MVU A;  2N5I A;  2MR8 A;  4DG9 A;  5EJD A;  2KOR A;  2L0Q A;  2MVV A;  1T8K A;  1HQB A;  4MRT C;  1AF8 A;  2EHS A;  2LTE A;  2FHS C;  2KW2 A;  2JQ4 A;  4NEO A;  4R0M A;  2AF8 A;  5KP7 B;  4CA3 A;  5KP8 B;  1L0I A;  3CE7 A;  2KGC A;  2CNR A;  2FQ2 A;  2KG8 A;  2MR7 A;  2FVA A;  2FQ0 A;  1HY8 A;  2K2Q A;  2MF4 A;  4H2Y C;  3EJE A;  2K94 A;  5KP6 B;  2KGD A;  2FAC A;  2FQ1 A;  2JGP A;  2XZ0 D;  1L0H A;  2FVE A;  1OR5 A;  2N6Z A;  4BPH A;  2K0Y A;  2LOL A;  2LML A;  2KG6 A;  2N6Y A;  4H2W C;  2EHT A;  2LIU A;  4HKG A;  2L9F A;  1ACP A;  2VSQ A;  3EJB A;  2MD9 A;  2X2B A;  4PWV B;  4BPF A;  2LL8 A;  4H2X C;  2KOS A;  2KGE A;  2L22 A;  5HV8 A;  1KLP A;  2MY5 A;  2CG5 B;  2K0X A;  2JU2 A;  1NQ4 A;  5CZD B;  4IZ6 A;  2CGQ A;  2GDW A;  2N5H A;  3LMO A;  2L4B A;  4BPG A;  1X3O A;  2CQ8 A;  2FVF A;  2GDX A;  3RG2 A;  2GDY A;  3EJD A;  2N50 A;  1DV5 A;  2AFE A;  2KG9 A;  2K92 A;  2FAE A;  1VKU A;  1DNY A;  2K93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...