2N5IA

Pltl-pyrrolyl
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
90
structure length
90
Chain Sequence
MDGEEVKEKIRRYIMEDLIGPSAKEDELDDQTPLLEWGILNSMNIVKLMVYIRDEMGVSIPSTHITGKYFKDLNAISRTVEQLKAESALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Substrate Sequestration in the Pyoluteorin Type II Peptidyl Carrier Protein PltL.
pubmed doi rcsb
source organism Pseudomonas protegens pf-5
molecule tags Transport protein
molecule keywords Peptidyl carrier protein PltL
total genus 26
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n5iA00
2K93A 2FVFA 2N6YA 2MY5A 2AFEA 4MRTC 2GDWA 3GZMA 3LMOA 4H2WC 2KOPA 2CGQA 2FQ1A 1X3OA 1ACPA 2K0XA 4DG9A 2KG9A 2N5HA 2MD9A 5CZDB 2KGAA 4H2YC 5KP8B 2GDXA 4CA3A 1T8KA 2EHSA 2K0YA 4NEOA 5HV8A 2AF8A 2KORA 2JU1A 1L0IA 2CNRA 3GZLA 4PXHB 1VKUA 2M5RA 1DNYA 2KGEA 2GDYA 4BPGA 5HVCA 2LOLA 1F80D 3RG2A 2AVAA 1HY8A 2X2BA 2LIWA 1NQ4A 5KP6B 2EHTA 2AFDA 2XZ0D 2KG8A 2N6ZA 2K94A 2L0QA 1HQBA 4HKGA 4BPHA 2KOOA 2KGDA 2JGPA 2JU2A 2XZ1C 2FACA 1AF8A 2KOSA 2FADA 2CQ8A 1KLPA 2L22A 2MR8A 2LTEA 2LKIA 4H2XC 2JQ4A 2FQ0A 5KP7B 2L9FA 2MF4A 2FVEA 2N98A 2VSQA 2K2QA 2KOQA 2KG6A 2FAEA 2KWLA 2LPKA 4BPFA 2KGCA 3EJBA 2ROQA 2L4BA 2LL8A 2FVAA 2LMLA 1DV5A 2FHSC 3CE7A 2QNWA 4PWVB 2MVVA 2MVUA 2N5IA 3EJEA 2DNWA 2K92A 4R0MA 2MR7A 2KW2A 2PNGA 2FQ2A 2KR5A 3EJDA 1OR5A 3NY7B 2CG5B 4IZ6A 2LIUA 5EJDA 1L0HA 2N50A
chains in the Genus database with same CATH superfamily
1K9MQ 1A43A 2N6YA 2MY5A 2NO8A 5HGMA 2PENA 1VQ6P 3G4SP 4WYMA 4U0BA 2E1MA 1GXGA 4U0AA 1ACPA 2K0XA 3LRYA 1VQ8P 3DS0A 2KG9A 2N5HA 2MD9A 4XRQA 5HV8A 2GZGA 2PEKA 1L0IA 2CNRA 4PH1A 3GZLA 2ERHA 2M8LA 1VQOP 2GDYA 5HVCA 2LOLA 2BUOA 2KODA 2AVAA 2X2BA 2ONTA 3RG6C 1KC8Q 1K73Q 1VQ4P 3Q20A 2KG8A 2GZEA 1RO0A 2JU2A 1AF8A 1UNKA 4F37A 5HGOA 1W2BO 1JJ2O 1BAJA 1IUQA 5JPAA 4H2XC 3GJNA 2FQ0A 1CEIA 2PEQA 2K2QA 5BS1A 4M0IA 3G21A 2KWLA 2LMLA 1Z6MA 2PEOA 1VQ7P 1YJNP 3CE7A 3G26A 2PEMA 1VQPP 3DS5A 3G6EP 2OTLP 2PNGA 2KR5A 4IZ6A 3CCLP 1M6EX 3CMEP 4QNBA 2LKIA 2K93A 2GDWA 3G28A 4H2WC 2CGQA 4IPYA 1VQKP 3DS3A 1IMQA 3E2DA 4DG9A 3GKLC 4CA3A 1T8KA 1EMVA 2XXMA 7CEIA 1YJWP 1BXIA 1DNYA 3CCVP 3G1IA 2OTJP 4U0DA 3CCJP 3RG2A 1E0HA 1NQ4A 1FR2A 5KP6B 2AFDA 1A8OA 1QRJA 2XZ0D 2L0QA 3HYBA 2GZJA 3WBHA 1S72P 1AUMA 5I4TG 2KOOA 2JO0A 2XV6A 4U0EA 3MGEA 1VQ9P 2FADA 1KLPA 2Z45A 3B5IA 1YITP 2JQ4A 1E6JP 1YI2P 2MF4A 1VQ5P 2FVEA 3CCRP 1ZNVA 2KG6A 5HGNA 1K8AQ 2FAEA 2KGCA 5DCKA 4COPA 4XFZA 2LL8A 3CCSP 4PWVB 1M90Q 2MVVA 1VQMP 3EJEA 4GR6A 5F2NA 5F2OA 2K0DX 3EJDA 3CCUP 1IMPA 3NY7B 1Q81Q 2LIUA 5EJDA 1VQLP 2EIAA 4MRTC 3LMOA 1ZMBA 1MZ8A 2GZFA 2L6EA 4COCA 1X3OA 3DS4A 4GR2A 2GYKA 5CZDB 2Z46A 4H2YC 4NEOA 2EHSA 2K0YA 3P05A 2AF8A 2KORA 2P9XA 4UHPB 2JAZA 3CCQP 4PXHB 1VKUA 3CCEP 4BPGA 3DTJA 1HY8A 3DPHA 1KQSO 3G0VA 2M8PA 2DGYA 1EIAA 1VQNP 2EHTA 3DS2A 2K94A 3CXCO 1HQBA 1YHQP 2EFJA 4XFYA 3HZQA 4XFXA 1NJIQ 2QA4P 2JGPA 2XZ1C 2VLNA 2KOSA 1Q86Q 2JBGA 3CC2P 5BS2A 1KD1Q 1YIJP 3CC7P 1RO2A 5KP7B 4QKOA 1M74A 1QVFO 2N98A 1GXHA 2VSQA 2CWOA 1RNIA 2BHVA 2PEJA 2JB0A 5F2KA 1Q7YQ 2LPKA 4BPFA 1GPJA 2L4BA 2FVAA 1AYIA 3M1MA 3NTEA 4XROA 1QVGO 3DS1A 4PH0A 2K92A 4U0CA 1YJ9P 4R0MA 2MR7A 1OR5A 2VLOA 3H4EA 3G1GA 2GZIA 1L0HA 3OW2O 1EOQA 2FVFA 2AFEA 3GZMA 2OARA 2KOPA 5HGLA 3I55P 2FQ1A 3CD6P 3G29A 2VLPA 2JYLA 1M6NA 1Q82Q 2KGAA 5KP8B 2GDXA 3VRLC 2JU1A 2JYGA 3G71P 2M5RA 2KGEA 1F80D 2LIWA 2WPTA 2EG5A 2N6ZA 3CMAP 2VLQA 3H47A 4HKGA 4BPHA 2KGDA 2QEXP 2FACA 1N8RQ 2CQ8A 2L22A 2MR8A 2LTEA 1M1KQ 2XT1A 3CPWO 3I56P 3B4QA 2L9FA 1VHNA 2LF4A 4U0FA 2KOQA 2PY8A 3CCMP 3EJBA 3U43A 3H0DA 2ROQA 1DV5A 2FHSC 1D1DA 2Z44A 2K5XA 5EW5E 2QNWA 2MVUA 2N5IA 2M8NA 2DNWA 2KW2A 2FQ2A 2PEIA 2CG5B 1K30A 1UJZA 3CC4P 2N50A
chains in the Genus database with same CATH topology
2K93A 2FVFA 2N6YA 2MY5A 2AFEA 4MRTC 2GDWA 3GZMA 3LMOA 4H2WC 2KOPA 2CGQA 2FQ1A 1X3OA 1ACPA 2K0XA 4DG9A 2KG9A 2N5HA 2MD9A 5CZDB 2KGAA 4H2YC 5KP8B 2GDXA 4CA3A 1T8KA 2EHSA 2K0YA 4NEOA 5HV8A 2AF8A 2KORA 2JU1A 1L0IA 2CNRA 3GZLA 4PXHB 1VKUA 2M5RA 1DNYA 2KGEA 2GDYA 4BPGA 5HVCA 2LOLA 1F80D 3RG2A 2AVAA 1HY8A 2X2BA 2LIWA 1NQ4A 5KP6B 2EHTA 2AFDA 2XZ0D 2KG8A 2N6ZA 2K94A 2L0QA 1HQBA 4HKGA 4BPHA 2KOOA 2KGDA 2JGPA 2JU2A 2XZ1C 2FACA 1AF8A 2KOSA 2FADA 2CQ8A 1KLPA 2L22A 2MR8A 2LTEA 2LKIA 4H2XC 2JQ4A 2FQ0A 5KP7B 2L9FA 2MF4A 2FVEA 2N98A 2VSQA 2K2QA 2KOQA 2KG6A 2FAEA 2KWLA 2LPKA 4BPFA 2KGCA 3EJBA 2ROQA 2L4BA 2LL8A 2FVAA 2LMLA 1DV5A 2FHSC 3CE7A 2QNWA 4PWVB 2MVVA 2MVUA 2N5IA 3EJEA 2DNWA 2K92A 4R0MA 2MR7A 2KW2A 2PNGA 2FQ2A 2KR5A 3EJDA 1OR5A 3NY7B 2CG5B 4IZ6A 2LIUA 5EJDA 1L0HA 2N50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K93 A;  2FVF A;  2N6Y A;  2MY5 A;  2AFE A;  4MRT C;  2GDW A;  3GZM A;  3LMO A;  4H2W C;  2KOP A;  2CGQ A;  2FQ1 A;  1X3O A;  1ACP A;  2K0X A;  4DG9 A;  2KG9 A;  2N5H A;  2MD9 A;  5CZD B;  2KGA A;  4H2Y C;  5KP8 B;  2GDX A;  4CA3 A;  1T8K A;  2EHS A;  2K0Y A;  4NEO A;  5HV8 A;  2AF8 A;  2KOR A;  2JU1 A;  1L0I A;  2CNR A;  3GZL A;  4PXH B;  1VKU A;  2M5R A;  1DNY A;  2KGE A;  2GDY A;  4BPG A;  5HVC A;  2LOL A;  1F80 D;  3RG2 A;  2AVA A;  1HY8 A;  2X2B A;  2LIW A;  1NQ4 A;  5KP6 B;  2EHT A;  2AFD A;  2XZ0 D;  2KG8 A;  2N6Z A;  2K94 A;  2L0Q A;  1HQB A;  4HKG A;  4BPH A;  2KOO A;  2KGD A;  2JGP A;  2JU2 A;  2XZ1 C;  2FAC A;  1AF8 A;  2KOS A;  2FAD A;  2CQ8 A;  1KLP A;  2L22 A;  2MR8 A;  2LTE A;  2LKI A;  4H2X C;  2JQ4 A;  2FQ0 A;  5KP7 B;  2L9F A;  2MF4 A;  2FVE A;  2N98 A;  2VSQ A;  2K2Q A;  2KOQ A;  2KG6 A;  2FAE A;  2KWL A;  2LPK A;  4BPF A;  2KGC A;  3EJB A;  2ROQ A;  2L4B A;  2LL8 A;  2FVA A;  2LML A;  1DV5 A;  2FHS C;  3CE7 A;  2QNW A;  4PWV B;  2MVV A;  2MVU A;  2N5I A;  3EJE A;  2DNW A;  2K92 A;  4R0M A;  2MR7 A;  2KW2 A;  2PNG A;  2FQ2 A;  2KR5 A;  3EJD A;  1OR5 A;  3NY7 B;  2CG5 B;  4IZ6 A;  2LIU A;  5EJD A;  1L0H A;  2N50 A; 
#chains in the Genus database with same CATH topology
 1K9M Q;  1A43 A;  2N6Y A;  2MY5 A;  2NO8 A;  5HGM A;  2PEN A;  1VQ6 P;  3G4S P;  4WYM A;  4U0B A;  2E1M A;  1GXG A;  4U0A A;  1ACP A;  2K0X A;  3LRY A;  1VQ8 P;  3DS0 A;  2KG9 A;  2N5H A;  2MD9 A;  4XRQ A;  5HV8 A;  2GZG A;  2PEK A;  1L0I A;  2CNR A;  4PH1 A;  3GZL A;  2ERH A;  2M8L A;  1VQO P;  2GDY A;  5HVC A;  2LOL A;  2BUO A;  2KOD A;  2AVA A;  2X2B A;  2ONT A;  3RG6 C;  1KC8 Q;  1K73 Q;  1VQ4 P;  3Q20 A;  2KG8 A;  2GZE A;  1RO0 A;  2JU2 A;  1AF8 A;  1UNK A;  4F37 A;  5HGO A;  1W2B O;  1JJ2 O;  1BAJ A;  1IUQ A;  5JPA A;  4H2X C;  3GJN A;  2FQ0 A;  1CEI A;  2PEQ A;  2K2Q A;  5BS1 A;  4M0I A;  3G21 A;  2KWL A;  2LML A;  1Z6M A;  2PEO A;  1VQ7 P;  1YJN P;  3CE7 A;  3G26 A;  2PEM A;  1VQP P;  3DS5 A;  3G6E P;  2OTL P;  2PNG A;  2KR5 A;  4IZ6 A;  3CCL P;  1M6E X;  3CME P;  4QNB A;  2LKI A;  2K93 A;  2GDW A;  3G28 A;  4H2W C;  2CGQ A;  4IPY A;  1VQK P;  3DS3 A;  1IMQ A;  3E2D A;  4DG9 A;  3GKL C;  4CA3 A;  1T8K A;  1EMV A;  2XXM A;  7CEI A;  1YJW P;  1BXI A;  1DNY A;  3CCV P;  3G1I A;  2OTJ P;  4U0D A;  3CCJ P;  3RG2 A;  1E0H A;  1NQ4 A;  1FR2 A;  5KP6 B;  2AFD A;  1A8O A;  1QRJ A;  2XZ0 D;  2L0Q A;  3HYB A;  2GZJ A;  3WBH A;  1S72 P;  1AUM A;  5I4T G;  2KOO A;  2JO0 A;  2XV6 A;  4U0E A;  3MGE A;  1VQ9 P;  2FAD A;  1KLP A;  2Z45 A;  3B5I A;  1YIT P;  2JQ4 A;  1E6J P;  1YI2 P;  2MF4 A;  1VQ5 P;  2FVE A;  3CCR P;  1ZNV A;  2KG6 A;  5HGN A;  1K8A Q;  2FAE A;  2KGC A;  5DCK A;  4COP A;  4XFZ A;  2LL8 A;  3CCS P;  4PWV B;  1M90 Q;  2MVV A;  1VQM P;  3EJE A;  4GR6 A;  5F2N A;  5F2O A;  2K0D X;  3EJD A;  3CCU P;  1IMP A;  3NY7 B;  1Q81 Q;  2LIU A;  5EJD A;  1VQL P;  2EIA A;  4MRT C;  3LMO A;  1ZMB A;  1MZ8 A;  2GZF A;  2L6E A;  4COC A;  1X3O A;  3DS4 A;  4GR2 A;  2GYK A;  5CZD B;  2Z46 A;  4H2Y C;  4NEO A;  2EHS A;  2K0Y A;  3P05 A;  2AF8 A;  2KOR A;  2P9X A;  4UHP B;  2JAZ A;  3CCQ P;  4PXH B;  1VKU A;  3CCE P;  4BPG A;  3DTJ A;  1HY8 A;  3DPH A;  1KQS O;  3G0V A;  2M8P A;  2DGY A;  1EIA A;  1VQN P;  2EHT A;  3DS2 A;  2K94 A;  3CXC O;  1HQB A;  1YHQ P;  2EFJ A;  4XFY A;  3HZQ A;  4XFX A;  1NJI Q;  2QA4 P;  2JGP A;  2XZ1 C;  2VLN A;  2KOS A;  1Q86 Q;  2JBG A;  3CC2 P;  5BS2 A;  1KD1 Q;  1YIJ P;  3CC7 P;  1RO2 A;  5KP7 B;  4QKO A;  1M74 A;  1QVF O;  2N98 A;  1GXH A;  2VSQ A;  2CWO A;  1RNI A;  2BHV A;  2PEJ A;  2JB0 A;  5F2K A;  1Q7Y Q;  2LPK A;  4BPF A;  1GPJ A;  2L4B A;  2FVA A;  1AYI A;  3M1M A;  3NTE A;  4XRO A;  1QVG O;  3DS1 A;  4PH0 A;  2K92 A;  4U0C A;  1YJ9 P;  4R0M A;  2MR7 A;  1OR5 A;  2VLO A;  3H4E A;  3G1G A;  2GZI A;  1L0H A;  3OW2 O;  1EOQ A;  2FVF A;  2AFE A;  3GZM A;  2OAR A;  2KOP A;  5HGL A;  3I55 P;  2FQ1 A;  3CD6 P;  3G29 A;  2VLP A;  2JYL A;  1M6N A;  1Q82 Q;  2KGA A;  5KP8 B;  2GDX A;  3VRL C;  2JU1 A;  2JYG A;  3G71 P;  2M5R A;  2KGE A;  1F80 D;  2LIW A;  2WPT A;  2EG5 A;  2N6Z A;  3CMA P;  2VLQ A;  3H47 A;  4HKG A;  4BPH A;  2KGD A;  2QEX P;  2FAC A;  1N8R Q;  2CQ8 A;  2L22 A;  2MR8 A;  2LTE A;  1M1K Q;  2XT1 A;  3CPW O;  3I56 P;  3B4Q A;  2L9F A;  1VHN A;  2LF4 A;  4U0F A;  2KOQ A;  2PY8 A;  3CCM P;  3EJB A;  3U43 A;  3H0D A;  2ROQ A;  1DV5 A;  2FHS C;  1D1D A;  2Z44 A;  2K5X A;  5EW5 E;  2QNW A;  2MVU A;  2N5I A;  2M8N A;  2DNW A;  2KW2 A;  2FQ2 A;  2PEI A;  2CG5 B;  1K30 A;  1UJZ A;  3CC4 P;  2N50 A; 
#chains in the Genus database with same CATH homology
 2K93 A;  2FVF A;  2N6Y A;  2MY5 A;  2AFE A;  4MRT C;  2GDW A;  3GZM A;  3LMO A;  4H2W C;  2KOP A;  2CGQ A;  2FQ1 A;  1X3O A;  1ACP A;  2K0X A;  4DG9 A;  2KG9 A;  2N5H A;  2MD9 A;  5CZD B;  2KGA A;  4H2Y C;  5KP8 B;  2GDX A;  4CA3 A;  1T8K A;  2EHS A;  2K0Y A;  4NEO A;  5HV8 A;  2AF8 A;  2KOR A;  2JU1 A;  1L0I A;  2CNR A;  3GZL A;  4PXH B;  1VKU A;  2M5R A;  1DNY A;  2KGE A;  2GDY A;  4BPG A;  5HVC A;  2LOL A;  1F80 D;  3RG2 A;  2AVA A;  1HY8 A;  2X2B A;  2LIW A;  1NQ4 A;  5KP6 B;  2EHT A;  2AFD A;  2XZ0 D;  2KG8 A;  2N6Z A;  2K94 A;  2L0Q A;  1HQB A;  4HKG A;  4BPH A;  2KOO A;  2KGD A;  2JGP A;  2JU2 A;  2XZ1 C;  2FAC A;  1AF8 A;  2KOS A;  2FAD A;  2CQ8 A;  1KLP A;  2L22 A;  2MR8 A;  2LTE A;  2LKI A;  4H2X C;  2JQ4 A;  2FQ0 A;  5KP7 B;  2L9F A;  2MF4 A;  2FVE A;  2N98 A;  2VSQ A;  2K2Q A;  2KOQ A;  2KG6 A;  2FAE A;  2KWL A;  2LPK A;  4BPF A;  2KGC A;  3EJB A;  2ROQ A;  2L4B A;  2LL8 A;  2FVA A;  2LML A;  1DV5 A;  2FHS C;  3CE7 A;  2QNW A;  4PWV B;  2MVV A;  2MVU A;  2N5I A;  3EJE A;  2DNW A;  2K92 A;  4R0M A;  2MR7 A;  2KW2 A;  2PNG A;  2FQ2 A;  2KR5 A;  3EJD A;  1OR5 A;  3NY7 B;  2CG5 B;  4IZ6 A;  2LIU A;  5EJD A;  1L0H A;  2N50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...