2N5IA

Pltl-pyrrolyl
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
90
structure length
90
Chain Sequence
b'MDGEEVKEKIRRYIMEDLIGPSAKEDELDDQTPLLEWGILNSMNIVKLMVYIRDEMGVSIPSTHITGKYFKDLNAISRTVEQLKAESALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl carrier protein PltL
publication title Structure and Substrate Sequestration in the Pyoluteorin Type II Peptidyl Carrier Protein PltL.
pubmed doi rcsb
source organism Pseudomonas protegens pf-5
molecule tags Transport protein
total genus 26
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n5iA00
5KP6B 2GDYA 2FVAA 2LTEA 2N6YA 3EJDA 1HY8A 3EJEA 2ROQA 1X3OA 2JQ4A 2KG9A 1DV5A 2KG6A 4NEOA 5HVCA 2KR5A 1L0IA 2PNGA 2N50A 2AFDA 1NQ4A 2JGPA 2CQ8A 2L0QA 2AFEA 2EHSA 2K93A 4IZ6A 4H2YC 4BPGA 3GZMA 2KORA 1F80D 1HQBA 2KGEA 2KOSA 2N5IA 2MVUA 4HKGA 5KP8B 2FQ0A 2K92A 2KGDA 2QNWA 2MR7A 2MF4A 2FACA 2FQ1A 2K94A 2CGQA 2KOOA 2N98A 5CZDB 2MVVA 2GDWA 3LMOA 2KWLA 2L9FA 2CNRA 2N5HA 2LIWA 2K0YA 2AF8A 2JU1A 4MRTC 2MD9A 4CA3A 1AF8A 2KW2A 4H2WC 1T8KA 2LOLA 4PXHB 4H2XC 2LMLA 2FHSC 2JU2A 2L22A 3CE7A 1VKUA 2X2BA 2EHTA 1DNYA 2LL8A 3GZLA 2CG5B 2KOQA 2LKIA 2AVAA 3NY7B 3EJBA 2KGAA 2KOPA 2DNWA 2FADA 2XZ0D 2FVFA 2LPKA 1L0HA 5EJDA 2N6ZA 2FVEA 4DG9A 2FAEA 2KGCA 3RG2A 2XZ1C 1OR5A 5KP7B 2K0XA 1KLPA 2FQ2A 2MY5A 4PWVB 2M5RA 4R0MA 1ACPA 4BPHA 2VSQA 5HV8A 4BPFA 2LIUA 2K2QA 2GDXA 2KG8A 2MR8A 2L4BA
chains in the Genus database with same CATH superfamily
1ZNVA 1VQ5P 3G28A 3EJDA 4XFZA 1HY8A 2VLNA 3I55P 3I56P 3CD6P 3G21A 3G0VA 2KG6A 3CCMP 2GZEA 2M8NA 2PNGA 1NQ4A 2JGPA 1VQ7P 1RO0A 2PEKA 1YJWP 3GZMA 2KORA 1MZ8A 3H47A 3DS0A 2FQ0A 2K92A 1VQ6P 2GYKA 5I4TG 2MR7A 2KOOA 5CZDB 2JB0A 1RNIA 2CNRA 2N5HA 1YIJP 2XT1A 2BHVA 2LIWA 1YHQP 2AF8A 1AF8A 2MD9A 4H2WC 3DS1A 2FHSC 1Q82Q 2LL8A 2KOQA 3P05A 3CCVP 2OARA 1K30A 3EJBA 2KOPA 2DNWA 4QKOA 5EW5E 2EIAA 2JAZA 3MGEA 3H4EA 3RG2A 2XZ1C 2K0XA 2M8LA 2GZGA 3DTJA 1IUQA 2CWOA 2L6EA 3CCJP 4XFYA 1QVFO 1K73Q 2VSQA 3HYBA 4UHPB 5HV8A 1VQ4P 3DS5A 3VRLC 2PEJA 4XRQA 5F2KA 3M1MA 1YI2P 1X3OA 3B5IA 1E0HA 3G29A 3GKLC 1FR2A 1M6NA 5F2NA 4IPYA 1L0IA 5JPAA 2PENA 2PY8A 1YJNP 2E1MA 2AFEA 4H2YC 1VQKP 4BPGA 1BAJA 1HQBA 2K0DX 5KP8B 3CCRP 2QNWA 2CGQA 1VHNA 2QA4P 1K9MQ 2L9FA 1UNKA 4GR6A 2Z46A 4MRTC 1AUMA 2KW2A 2XV6A 1NJIQ 4PH1A 3CE7A 1VKUA 2X2BA 3CMEP 2EHTA 3GZLA 4U0FA 1K8AQ 2LKIA 2AVAA 1S72P 2PEMA 2FADA 2PEQA 1EOQA 5EJDA 2N6ZA 2FVEA 3CCQP 2P9XA 3WBHA 3U43A 1M6EX 4U0CA 1M1KQ 1Q7YQ 1A43A 5DCKA 5HGOA 1W2BO 1ACPA 1VQMP 2Z44A 4PH0A 1EMVA 2VLPA 2LIUA 2MR8A 2L4BA 2KR5A 3G1GA 5KP6B 2GDYA 2JBGA 1QRJA 3CPWO 2ROQA 1VQPP 2KG9A 1DV5A 5HVCA 4COCA 3NTEA 2GZIA 2VLQA 2N50A 2AFDA 3Q20A 1UJZA 2L0QA 2EHSA 1Z6MA 1IMPA 4IZ6A 2VLOA 1F80D 2KGEA 3E2DA 1CEIA 2KOSA 2N5IA 2MVUA 4HKGA 1Q81Q 2KGDA 1KQSO 2FACA 1RO2A 2OTLP 2FQ1A 3OW2O 1M74A 5BS1A 4U0DA 3CXCO 2MVVA 3DS3A 3H0DA 3CC4P 1ZMBA 2KWLA 1JJ2O 1VQNP 2JO0A 1VQ8P 2QEXP 4CA3A 4PXHB 1T8KA 4H2XC 2LMLA 2M8PA 1VQLP 4U0BA 3DS4A 3G1IA 1Q86Q 1DNYA 3NY7B 4WYMA 2KGAA 2BUOA 1VQOP 1KC8Q 4U0EA 2OTJP 2XZ0D 5HGMA 1EIAA 2FVFA 2PEOA 4DG9A 2KGCA 5KP7B 1KLPA 1YITP 2FQ2A 1AYIA 4M0IA 2MY5A 2EG5A 2XXMA 5BS2A 1KD1Q 2K5XA 4BPFA 2GDXA 4XROA 4U0AA 2FVAA 3DPHA 2LTEA 2N6YA 3B4QA 3EJEA 1IMQA 1VQ9P 3G6EP 2ONTA 2JQ4A 3CC7P 3GJNA 3HZQA 4NEOA 3CCSP 2GZFA 2JYLA 2KODA 1GXGA 2CQ8A 1GXHA 2PEIA 2K93A 1E6JP 2DGYA 1M90Q 3G71P 3CCUP 3CMAP 1A8OA 2MF4A 2K94A 3G4SP 2ERHA 2N98A 2WPTA 7CEIA 2JYGA 1N8RQ 2GDWA 5F2OA 1QVGO 1D1DA 3LMOA 2K0YA 3LRYA 4F37A 2JU1A 2EFJA 2Z45A 2LOLA 1GPJA 2JU2A 2L22A 3CC2P 3CCEP 3CCLP 2CG5B 2LF4A 4COPA 1BXIA 3G26A 4GR2A 2LPKA 4XFXA 1L0HA 5HGLA 2FAEA 3DS2A 1OR5A 4QNBA 5HGNA 3RG6C 4PWVB 2GZJA 1YJ9P 2M5RA 2NO8A 4R0MA 4BPHA 2K2QA 2KG8A
chains in the Genus database with same CATH topology
5KP6B 2GDYA 2FVAA 2LTEA 2N6YA 3EJDA 1HY8A 3EJEA 2ROQA 1X3OA 2JQ4A 2KG9A 1DV5A 2KG6A 4NEOA 5HVCA 2KR5A 1L0IA 2PNGA 2N50A 2AFDA 1NQ4A 2JGPA 2CQ8A 2L0QA 2AFEA 2EHSA 2K93A 4IZ6A 4H2YC 4BPGA 3GZMA 2KORA 1F80D 1HQBA 2KGEA 2KOSA 2N5IA 2MVUA 4HKGA 5KP8B 2FQ0A 2K92A 2KGDA 2QNWA 2MR7A 2MF4A 2FACA 2FQ1A 2K94A 2CGQA 2KOOA 2N98A 5CZDB 2MVVA 2GDWA 3LMOA 2KWLA 2L9FA 2CNRA 2N5HA 2LIWA 2K0YA 2AF8A 2JU1A 4MRTC 2MD9A 4CA3A 1AF8A 2KW2A 4H2WC 1T8KA 2LOLA 4PXHB 4H2XC 2LMLA 2FHSC 2JU2A 2L22A 3CE7A 1VKUA 2X2BA 2EHTA 1DNYA 2LL8A 3GZLA 2CG5B 2KOQA 2LKIA 2AVAA 3NY7B 3EJBA 2KGAA 2KOPA 2DNWA 2FADA 2XZ0D 2FVFA 2LPKA 1L0HA 5EJDA 2N6ZA 2FVEA 4DG9A 2FAEA 2KGCA 3RG2A 2XZ1C 1OR5A 5KP7B 2K0XA 1KLPA 2FQ2A 2MY5A 4PWVB 2M5RA 4R0MA 1ACPA 4BPHA 2VSQA 5HV8A 4BPFA 2LIUA 2K2QA 2GDXA 2KG8A 2MR8A 2L4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KP6 B;  2GDY A;  2FVA A;  2LTE A;  2N6Y A;  3EJD A;  1HY8 A;  3EJE A;  2ROQ A;  1X3O A;  2JQ4 A;  2KG9 A;  1DV5 A;  2KG6 A;  4NEO A;  5HVC A;  2KR5 A;  1L0I A;  2PNG A;  2N50 A;  2AFD A;  1NQ4 A;  2JGP A;  2CQ8 A;  2L0Q A;  2AFE A;  2EHS A;  2K93 A;  4IZ6 A;  4H2Y C;  4BPG A;  3GZM A;  2KOR A;  1F80 D;  1HQB A;  2KGE A;  2KOS A;  2N5I A;  2MVU A;  4HKG A;  5KP8 B;  2FQ0 A;  2K92 A;  2KGD A;  2QNW A;  2MR7 A;  2MF4 A;  2FAC A;  2FQ1 A;  2K94 A;  2CGQ A;  2KOO A;  2N98 A;  5CZD B;  2MVV A;  2GDW A;  3LMO A;  2KWL A;  2L9F A;  2CNR A;  2N5H A;  2LIW A;  2K0Y A;  2AF8 A;  2JU1 A;  4MRT C;  2MD9 A;  4CA3 A;  1AF8 A;  2KW2 A;  4H2W C;  1T8K A;  2LOL A;  4PXH B;  4H2X C;  2LML A;  2FHS C;  2JU2 A;  2L22 A;  3CE7 A;  1VKU A;  2X2B A;  2EHT A;  1DNY A;  2LL8 A;  3GZL A;  2CG5 B;  2KOQ A;  2LKI A;  2AVA A;  3NY7 B;  3EJB A;  2KGA A;  2KOP A;  2DNW A;  2FAD A;  2XZ0 D;  2FVF A;  2LPK A;  1L0H A;  5EJD A;  2N6Z A;  2FVE A;  4DG9 A;  2FAE A;  2KGC A;  3RG2 A;  2XZ1 C;  1OR5 A;  5KP7 B;  2K0X A;  1KLP A;  2FQ2 A;  2MY5 A;  4PWV B;  2M5R A;  4R0M A;  1ACP A;  4BPH A;  2VSQ A;  5HV8 A;  4BPF A;  2LIU A;  2K2Q A;  2GDX A;  2KG8 A;  2MR8 A;  2L4B A; 
#chains in the Genus database with same CATH topology
 1ZNV A;  1VQ5 P;  3G28 A;  3EJD A;  4XFZ A;  1HY8 A;  2VLN A;  3I55 P;  3I56 P;  3CD6 P;  3G21 A;  3G0V A;  2KG6 A;  3CCM P;  2GZE A;  2M8N A;  2PNG A;  1NQ4 A;  2JGP A;  1VQ7 P;  1RO0 A;  2PEK A;  1YJW P;  3GZM A;  2KOR A;  1MZ8 A;  3H47 A;  3DS0 A;  2FQ0 A;  2K92 A;  1VQ6 P;  2GYK A;  5I4T G;  2MR7 A;  2KOO A;  5CZD B;  2JB0 A;  1RNI A;  2CNR A;  2N5H A;  1YIJ P;  2XT1 A;  2BHV A;  2LIW A;  1YHQ P;  2AF8 A;  1AF8 A;  2MD9 A;  4H2W C;  3DS1 A;  2FHS C;  1Q82 Q;  2LL8 A;  2KOQ A;  3P05 A;  3CCV P;  2OAR A;  1K30 A;  3EJB A;  2KOP A;  2DNW A;  4QKO A;  5EW5 E;  2EIA A;  2JAZ A;  3MGE A;  3H4E A;  3RG2 A;  2XZ1 C;  2K0X A;  2M8L A;  2GZG A;  3DTJ A;  1IUQ A;  2CWO A;  2L6E A;  3CCJ P;  4XFY A;  1QVF O;  1K73 Q;  2VSQ A;  3HYB A;  4UHP B;  5HV8 A;  1VQ4 P;  3DS5 A;  3VRL C;  2PEJ A;  4XRQ A;  5F2K A;  3M1M A;  1YI2 P;  1X3O A;  3B5I A;  1E0H A;  3G29 A;  3GKL C;  1FR2 A;  1M6N A;  5F2N A;  4IPY A;  1L0I A;  5JPA A;  2PEN A;  2PY8 A;  1YJN P;  2E1M A;  2AFE A;  4H2Y C;  1VQK P;  4BPG A;  1BAJ A;  1HQB A;  2K0D X;  5KP8 B;  3CCR P;  2QNW A;  2CGQ A;  1VHN A;  2QA4 P;  1K9M Q;  2L9F A;  1UNK A;  4GR6 A;  2Z46 A;  4MRT C;  1AUM A;  2KW2 A;  2XV6 A;  1NJI Q;  4PH1 A;  3CE7 A;  1VKU A;  2X2B A;  3CME P;  2EHT A;  3GZL A;  4U0F A;  1K8A Q;  2LKI A;  2AVA A;  1S72 P;  2PEM A;  2FAD A;  2PEQ A;  1EOQ A;  5EJD A;  2N6Z A;  2FVE A;  3CCQ P;  2P9X A;  3WBH A;  3U43 A;  1M6E X;  4U0C A;  1M1K Q;  1Q7Y Q;  1A43 A;  5DCK A;  5HGO A;  1W2B O;  1ACP A;  1VQM P;  2Z44 A;  4PH0 A;  1EMV A;  2VLP A;  2LIU A;  2MR8 A;  2L4B A;  2KR5 A;  3G1G A;  5KP6 B;  2GDY A;  2JBG A;  1QRJ A;  3CPW O;  2ROQ A;  1VQP P;  2KG9 A;  1DV5 A;  5HVC A;  4COC A;  3NTE A;  2GZI A;  2VLQ A;  2N50 A;  2AFD A;  3Q20 A;  1UJZ A;  2L0Q A;  2EHS A;  1Z6M A;  1IMP A;  4IZ6 A;  2VLO A;  1F80 D;  2KGE A;  3E2D A;  1CEI A;  2KOS A;  2N5I A;  2MVU A;  4HKG A;  1Q81 Q;  2KGD A;  1KQS O;  2FAC A;  1RO2 A;  2OTL P;  2FQ1 A;  3OW2 O;  1M74 A;  5BS1 A;  4U0D A;  3CXC O;  2MVV A;  3DS3 A;  3H0D A;  3CC4 P;  1ZMB A;  2KWL A;  1JJ2 O;  1VQN P;  2JO0 A;  1VQ8 P;  2QEX P;  4CA3 A;  4PXH B;  1T8K A;  4H2X C;  2LML A;  2M8P A;  1VQL P;  4U0B A;  3DS4 A;  3G1I A;  1Q86 Q;  1DNY A;  3NY7 B;  4WYM A;  2KGA A;  2BUO A;  1VQO P;  1KC8 Q;  4U0E A;  2OTJ P;  2XZ0 D;  5HGM A;  1EIA A;  2FVF A;  2PEO A;  4DG9 A;  2KGC A;  5KP7 B;  1KLP A;  1YIT P;  2FQ2 A;  1AYI A;  4M0I A;  2MY5 A;  2EG5 A;  2XXM A;  5BS2 A;  1KD1 Q;  2K5X A;  4BPF A;  2GDX A;  4XRO A;  4U0A A;  2FVA A;  3DPH A;  2LTE A;  2N6Y A;  3B4Q A;  3EJE A;  1IMQ A;  1VQ9 P;  3G6E P;  2ONT A;  2JQ4 A;  3CC7 P;  3GJN A;  3HZQ A;  4NEO A;  3CCS P;  2GZF A;  2JYL A;  2KOD A;  1GXG A;  2CQ8 A;  1GXH A;  2PEI A;  2K93 A;  1E6J P;  2DGY A;  1M90 Q;  3G71 P;  3CCU P;  3CMA P;  1A8O A;  2MF4 A;  2K94 A;  3G4S P;  2ERH A;  2N98 A;  2WPT A;  7CEI A;  2JYG A;  1N8R Q;  2GDW A;  5F2O A;  1QVG O;  1D1D A;  3LMO A;  2K0Y A;  3LRY A;  4F37 A;  2JU1 A;  2EFJ A;  2Z45 A;  2LOL A;  1GPJ A;  2JU2 A;  2L22 A;  3CC2 P;  3CCE P;  3CCL P;  2CG5 B;  2LF4 A;  4COP A;  1BXI A;  3G26 A;  4GR2 A;  2LPK A;  4XFX A;  1L0H A;  5HGL A;  2FAE A;  3DS2 A;  1OR5 A;  4QNB A;  5HGN A;  3RG6 C;  4PWV B;  2GZJ A;  1YJ9 P;  2M5R A;  2NO8 A;  4R0M A;  4BPH A;  2K2Q A;  2KG8 A; 
#chains in the Genus database with same CATH homology
 5KP6 B;  2GDY A;  2FVA A;  2LTE A;  2N6Y A;  3EJD A;  1HY8 A;  3EJE A;  2ROQ A;  1X3O A;  2JQ4 A;  2KG9 A;  1DV5 A;  2KG6 A;  4NEO A;  5HVC A;  2KR5 A;  1L0I A;  2PNG A;  2N50 A;  2AFD A;  1NQ4 A;  2JGP A;  2CQ8 A;  2L0Q A;  2AFE A;  2EHS A;  2K93 A;  4IZ6 A;  4H2Y C;  4BPG A;  3GZM A;  2KOR A;  1F80 D;  1HQB A;  2KGE A;  2KOS A;  2N5I A;  2MVU A;  4HKG A;  5KP8 B;  2FQ0 A;  2K92 A;  2KGD A;  2QNW A;  2MR7 A;  2MF4 A;  2FAC A;  2FQ1 A;  2K94 A;  2CGQ A;  2KOO A;  2N98 A;  5CZD B;  2MVV A;  2GDW A;  3LMO A;  2KWL A;  2L9F A;  2CNR A;  2N5H A;  2LIW A;  2K0Y A;  2AF8 A;  2JU1 A;  4MRT C;  2MD9 A;  4CA3 A;  1AF8 A;  2KW2 A;  4H2W C;  1T8K A;  2LOL A;  4PXH B;  4H2X C;  2LML A;  2FHS C;  2JU2 A;  2L22 A;  3CE7 A;  1VKU A;  2X2B A;  2EHT A;  1DNY A;  2LL8 A;  3GZL A;  2CG5 B;  2KOQ A;  2LKI A;  2AVA A;  3NY7 B;  3EJB A;  2KGA A;  2KOP A;  2DNW A;  2FAD A;  2XZ0 D;  2FVF A;  2LPK A;  1L0H A;  5EJD A;  2N6Z A;  2FVE A;  4DG9 A;  2FAE A;  2KGC A;  3RG2 A;  2XZ1 C;  1OR5 A;  5KP7 B;  2K0X A;  1KLP A;  2FQ2 A;  2MY5 A;  4PWV B;  2M5R A;  4R0M A;  1ACP A;  4BPH A;  2VSQ A;  5HV8 A;  4BPF A;  2LIU A;  2K2Q A;  2GDX A;  2KG8 A;  2MR8 A;  2L4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...