2JU1A

Solution structure of acyl carrier protein domain from module 2 of 6-deoxyerythronolide b synthase (debs)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
b'GSHMLRDRLAGLPRAERTAELVRLVRTSTATVLGHDDPKAVRATTPFKELGFDSLAAVRLRNLLNAATGLRLPSTLVFDHPNASAVAGFLDAELG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Erythronolide synthase
publication title Solution structure and proposed domain domain recognition interface of an acyl carrier protein domain from a modular polyketide synthase.
pubmed doi rcsb
source organism Saccharopolyspora erythraea
molecule tags Transferase
total genus 22
structure length 95
sequence length 95
ec nomenclature ec 2.3.1.94: 6-deoxyerythronolide-B synthase.
pdb deposition date 2007-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ju1A00
2MVVA 3LMOA 1L0HA 2MR7A 2N6YA 2N6ZA 2FQ1A 2QNWA 2GDWA 4CA3A 4BPFA 2KGDA 2AFEA 5EJDA 1VKUA 2GDXA 3CE7A 2KGCA 2FADA 1OR5A 2MR8A 2CNRA 2N50A 5HV8A 2KOPA 3RG2A 2KG8A 5KP8B 2AF8A 4PXHB 4MRTC 4R0MA 2LOLA 2M5RA 2L22A 2KGAA 2LL8A 2KG9A 5KP6B 2FAEA 1L0IA 2FQ2A 4PWVB 2PNGA 2LKIA 1AF8A 2CQ8A 1F80D 2JU2A 2FACA 3EJDA 4BPHA 1HY8A 2FVFA 2K92A 2N5IA 2LTEA 2N98A 2L9FA 1HQBA 2FVEA 1NQ4A 2K0XA 2K2QA 2K0YA 5CZDB 3GZMA 2JU1A 3NY7B 2MVUA 2KGEA 2MY5A 3EJEA 2N5HA 1DV5A 4NEOA 2KG6A 2XZ0D 2GDYA 2FQ0A 1T8KA 2AVAA 4DG9A 2DNWA 2FHSC 4BPGA 2EHTA 2VSQA 5HVCA 2LIWA 2MF4A 2KR5A 2CGQA 2MD9A 2KORA 2KW2A 2X2BA 4H2XC 2KOQA 1DNYA 1X3OA 2ROQA 2KOSA 2AFDA 1ACPA 2CG5B 2FVAA 2L0QA 4H2WC 1KLPA 5KP7B 2JQ4A 3EJBA 2XZ1C 2EHSA 2LMLA 2JGPA 4HKGA 2K93A 2LIUA 3GZLA 2KOOA 2L4BA 4IZ6A 2KWLA 2LPKA 4H2YC 2K94A
chains in the Genus database with same CATH superfamily
2QEXP 2EG5A 1K30A 3CMAP 3DPHA 1IMPA 1M90Q 1YIJP 3CE7A 1AUMA 1EOQA 7CEIA 2KGCA 4COCA 3CCLP 3OW2O 5F2OA 3RG2A 5I4TG 4UHPB 5JPAA 1YJWP 2LOLA 3G4SP 1K8AQ 2E1MA 5HGLA 2KGAA 2VLOA 1RO2A 2PNGA 1F80D 2JU2A 4XFYA 3EJDA 2FVFA 2EFJA 3DS5A 1UJZA 1K9MQ 4U0AA 3M1MA 2LTEA 3DS2A 3E2DA 3GJNA 4QKOA 2Z44A 5CZDB 3NY7B 4WYMA 2KGEA 2Z45A 2JYLA 2KG6A 2XZ0D 4DG9A 1RNIA 2PEKA 1VQOP 5EW5E 5BS2A 2PEMA 2KORA 2OTLP 2P9XA 2JO0A 2X2BA 2M8PA 1VQKP 1FR2A 4PH0A 2JBGA 1YJ9P 1KLPA 1IMQA 2XV6A 2GZIA 4QNBA 2K93A 4IZ6A 2M8LA 1IUQA 1D1DA 3LMOA 1VQ5P 2QNWA 4CA3A 3Q20A 4BPFA 2OTJP 1VKUA 2WPTA 4U0EA 2MR8A 2K0DX 4F37A 2AF8A 3DS4A 4MRTC 2L22A 2LL8A 1GXHA 1YJNP 5BS1A 4COPA 3RG6C 1Q86Q 2FQ2A 4PWVB 1AF8A 2CQ8A 3G21A 3CCRP 3G71P 3U43A 1M6NA 1YHQP 1VQPP 1GPJA 2K5XA 2GZGA 2BHVA 2K2QA 1VQLP 1KD1Q 3CC7P 2MY5A 5F2NA 2N5HA 1DV5A 1S72P 2CWOA 1E6JP 3CCQP 3G1GA 2FQ0A 2AVAA 2DNWA 2FHSC 3HZQA 2EHTA 2VSQA 4M0IA 2CGQA 1VQ6P 2MD9A 4XROA 2XXMA 2KOQA 1DNYA 3CCVP 1X3OA 2PEIA 2ROQA 1A43A 1CEIA 2KOSA 3I55P 3CMEP 1QVFO 2DGYA 2CG5B 2L0QA 4H2WC 2BUOA 3WBHA 1ZMBA 1RO0A 5KP7B 1W2BO 2LIUA 1BAJA 2KOOA 2L4BA 2MVUA 2K94A 2MVVA 3NTEA 1N8RQ 2MR7A 1Q82Q 2N6YA 1NJIQ 1VQNP 4XFXA 1JJ2O 2GDWA 4U0BA 2AFEA 5EJDA 1M6EX 5F2KA 2CNRA 5HGOA 2KOPA 2NO8A 1QVGO 5KP8B 4R0MA 3B5IA 1VQ9P 2KG9A 1M74A 1L0IA 2KODA 3GKLC 2LKIA 2FACA 3VRLC 1HY8A 1E0HA 2GZEA 1EMVA 2N98A 3CCEP 2JYGA 2FVEA 2K0XA 3MGEA 1MZ8A 1K73Q 1KC8Q 1ZNVA 1VHNA 4NEOA 2Z46A 1VQ7P 2ERHA 4U0CA 2M8NA 3G6EP 2GDYA 3LRYA 1T8KA 2JAZA 1VQ8P 2VLQA 5HVCA 2LIWA 3CCUP 2KR5A 2KW2A 3DS1A 3P05A 4H2XC 3H47A 4U0FA 4XRQA 2OARA 2AFDA 2ONTA 3CC2P 1KQSO 2LF4A 3CCJP 5HGNA 3GZLA 2XT1A 3CC4P 2KWLA 4H2YC 4U0DA 2LMLA 2JGPA 3G1IA 1L0HA 2PEJA 3CCMP 2GYKA 2N6ZA 1YITP 4PH1A 1Z6MA 2GZFA 3H0DA 1VQMP 2FQ1A 3H4EA 2KGDA 4XFZA 2GDXA 1A8OA 2FADA 1OR5A 2N50A 3B4QA 3DS3A 3HYBA 5HV8A 2PY8A 2KG8A 4PXHB 5HGMA 2M5RA 2PENA 2JB0A 4GR6A 5KP6B 2FAEA 1Q7YQ 1YI2P 1M1KQ 1UNKA 2EIAA 4BPHA 3G28A 2K92A 2N5IA 3CD6P 2L9FA 1HQBA 2PEOA 3I56P 1NQ4A 3G29A 2K0YA 3GZMA 2JU1A 1EIAA 2L6EA 1BXIA 3EJEA 4IPYA 2VLNA 4GR2A 1QRJA 3CXCO 3G0VA 3CCSP 1GXGA 4BPGA 5DCKA 2GZJA 2MF4A 3DTJA 2QA4P 3CPWO 1VQ4P 3DS0A 1ACPA 2PEQA 2FVAA 2JQ4A 1AYIA 2XZ1C 3EJBA 2EHSA 1Q81Q 4HKGA 2VLPA 3G26A 2LPKA
chains in the Genus database with same CATH topology
2MVVA 3LMOA 1L0HA 2MR7A 2N6YA 2N6ZA 2FQ1A 2QNWA 2GDWA 4CA3A 4BPFA 2KGDA 2AFEA 5EJDA 1VKUA 2GDXA 3CE7A 2KGCA 2FADA 1OR5A 2MR8A 2CNRA 2N50A 5HV8A 2KOPA 3RG2A 2KG8A 5KP8B 2AF8A 4PXHB 4MRTC 4R0MA 2LOLA 2M5RA 2L22A 2KGAA 2LL8A 2KG9A 5KP6B 2FAEA 1L0IA 2FQ2A 4PWVB 2PNGA 2LKIA 1AF8A 2CQ8A 1F80D 2JU2A 2FACA 3EJDA 4BPHA 1HY8A 2FVFA 2K92A 2N5IA 2LTEA 2N98A 2L9FA 1HQBA 2FVEA 1NQ4A 2K0XA 2K2QA 2K0YA 5CZDB 3GZMA 2JU1A 3NY7B 2MVUA 2KGEA 2MY5A 3EJEA 2N5HA 1DV5A 4NEOA 2KG6A 2XZ0D 2GDYA 2FQ0A 1T8KA 2AVAA 4DG9A 2DNWA 2FHSC 4BPGA 2EHTA 2VSQA 5HVCA 2LIWA 2MF4A 2KR5A 2CGQA 2MD9A 2KORA 2KW2A 2X2BA 4H2XC 2KOQA 1DNYA 1X3OA 2ROQA 2KOSA 2AFDA 1ACPA 2CG5B 2FVAA 2L0QA 4H2WC 1KLPA 5KP7B 2JQ4A 3EJBA 2XZ1C 2EHSA 2LMLA 2JGPA 4HKGA 2K93A 2LIUA 3GZLA 2KOOA 2L4BA 4IZ6A 2KWLA 2LPKA 4H2YC 2K94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MVV A;  3LMO A;  1L0H A;  2MR7 A;  2N6Y A;  2N6Z A;  2FQ1 A;  2QNW A;  2GDW A;  4CA3 A;  4BPF A;  2KGD A;  2AFE A;  5EJD A;  1VKU A;  2GDX A;  3CE7 A;  2KGC A;  2FAD A;  1OR5 A;  2MR8 A;  2CNR A;  2N50 A;  5HV8 A;  2KOP A;  3RG2 A;  2KG8 A;  5KP8 B;  2AF8 A;  4PXH B;  4MRT C;  4R0M A;  2LOL A;  2M5R A;  2L22 A;  2KGA A;  2LL8 A;  2KG9 A;  5KP6 B;  2FAE A;  1L0I A;  2FQ2 A;  4PWV B;  2PNG A;  2LKI A;  1AF8 A;  2CQ8 A;  1F80 D;  2JU2 A;  2FAC A;  3EJD A;  4BPH A;  1HY8 A;  2FVF A;  2K92 A;  2N5I A;  2LTE A;  2N98 A;  2L9F A;  1HQB A;  2FVE A;  1NQ4 A;  2K0X A;  2K2Q A;  2K0Y A;  5CZD B;  3GZM A;  2JU1 A;  3NY7 B;  2MVU A;  2KGE A;  2MY5 A;  3EJE A;  2N5H A;  1DV5 A;  4NEO A;  2KG6 A;  2XZ0 D;  2GDY A;  2FQ0 A;  1T8K A;  2AVA A;  4DG9 A;  2DNW A;  2FHS C;  4BPG A;  2EHT A;  2VSQ A;  5HVC A;  2LIW A;  2MF4 A;  2KR5 A;  2CGQ A;  2MD9 A;  2KOR A;  2KW2 A;  2X2B A;  4H2X C;  2KOQ A;  1DNY A;  1X3O A;  2ROQ A;  2KOS A;  2AFD A;  1ACP A;  2CG5 B;  2FVA A;  2L0Q A;  4H2W C;  1KLP A;  5KP7 B;  2JQ4 A;  3EJB A;  2XZ1 C;  2EHS A;  2LML A;  2JGP A;  4HKG A;  2K93 A;  2LIU A;  3GZL A;  2KOO A;  2L4B A;  4IZ6 A;  2KWL A;  2LPK A;  4H2Y C;  2K94 A; 
#chains in the Genus database with same CATH topology
 2QEX P;  2EG5 A;  1K30 A;  3CMA P;  3DPH A;  1IMP A;  1M90 Q;  1YIJ P;  3CE7 A;  1AUM A;  1EOQ A;  7CEI A;  2KGC A;  4COC A;  3CCL P;  3OW2 O;  5F2O A;  3RG2 A;  5I4T G;  4UHP B;  5JPA A;  1YJW P;  2LOL A;  3G4S P;  1K8A Q;  2E1M A;  5HGL A;  2KGA A;  2VLO A;  1RO2 A;  2PNG A;  1F80 D;  2JU2 A;  4XFY A;  3EJD A;  2FVF A;  2EFJ A;  3DS5 A;  1UJZ A;  1K9M Q;  4U0A A;  3M1M A;  2LTE A;  3DS2 A;  3E2D A;  3GJN A;  4QKO A;  2Z44 A;  5CZD B;  3NY7 B;  4WYM A;  2KGE A;  2Z45 A;  2JYL A;  2KG6 A;  2XZ0 D;  4DG9 A;  1RNI A;  2PEK A;  1VQO P;  5EW5 E;  5BS2 A;  2PEM A;  2KOR A;  2OTL P;  2P9X A;  2JO0 A;  2X2B A;  2M8P A;  1VQK P;  1FR2 A;  4PH0 A;  2JBG A;  1YJ9 P;  1KLP A;  1IMQ A;  2XV6 A;  2GZI A;  4QNB A;  2K93 A;  4IZ6 A;  2M8L A;  1IUQ A;  1D1D A;  3LMO A;  1VQ5 P;  2QNW A;  4CA3 A;  3Q20 A;  4BPF A;  2OTJ P;  1VKU A;  2WPT A;  4U0E A;  2MR8 A;  2K0D X;  4F37 A;  2AF8 A;  3DS4 A;  4MRT C;  2L22 A;  2LL8 A;  1GXH A;  1YJN P;  5BS1 A;  4COP A;  3RG6 C;  1Q86 Q;  2FQ2 A;  4PWV B;  1AF8 A;  2CQ8 A;  3G21 A;  3CCR P;  3G71 P;  3U43 A;  1M6N A;  1YHQ P;  1VQP P;  1GPJ A;  2K5X A;  2GZG A;  2BHV A;  2K2Q A;  1VQL P;  1KD1 Q;  3CC7 P;  2MY5 A;  5F2N A;  2N5H A;  1DV5 A;  1S72 P;  2CWO A;  1E6J P;  3CCQ P;  3G1G A;  2FQ0 A;  2AVA A;  2DNW A;  2FHS C;  3HZQ A;  2EHT A;  2VSQ A;  4M0I A;  2CGQ A;  1VQ6 P;  2MD9 A;  4XRO A;  2XXM A;  2KOQ A;  1DNY A;  3CCV P;  1X3O A;  2PEI A;  2ROQ A;  1A43 A;  1CEI A;  2KOS A;  3I55 P;  3CME P;  1QVF O;  2DGY A;  2CG5 B;  2L0Q A;  4H2W C;  2BUO A;  3WBH A;  1ZMB A;  1RO0 A;  5KP7 B;  1W2B O;  2LIU A;  1BAJ A;  2KOO A;  2L4B A;  2MVU A;  2K94 A;  2MVV A;  3NTE A;  1N8R Q;  2MR7 A;  1Q82 Q;  2N6Y A;  1NJI Q;  1VQN P;  4XFX A;  1JJ2 O;  2GDW A;  4U0B A;  2AFE A;  5EJD A;  1M6E X;  5F2K A;  2CNR A;  5HGO A;  2KOP A;  2NO8 A;  1QVG O;  5KP8 B;  4R0M A;  3B5I A;  1VQ9 P;  2KG9 A;  1M74 A;  1L0I A;  2KOD A;  3GKL C;  2LKI A;  2FAC A;  3VRL C;  1HY8 A;  1E0H A;  2GZE A;  1EMV A;  2N98 A;  3CCE P;  2JYG A;  2FVE A;  2K0X A;  3MGE A;  1MZ8 A;  1K73 Q;  1KC8 Q;  1ZNV A;  1VHN A;  4NEO A;  2Z46 A;  1VQ7 P;  2ERH A;  4U0C A;  2M8N A;  3G6E P;  2GDY A;  3LRY A;  1T8K A;  2JAZ A;  1VQ8 P;  2VLQ A;  5HVC A;  2LIW A;  3CCU P;  2KR5 A;  2KW2 A;  3DS1 A;  3P05 A;  4H2X C;  3H47 A;  4U0F A;  4XRQ A;  2OAR A;  2AFD A;  2ONT A;  3CC2 P;  1KQS O;  2LF4 A;  3CCJ P;  5HGN A;  3GZL A;  2XT1 A;  3CC4 P;  2KWL A;  4H2Y C;  4U0D A;  2LML A;  2JGP A;  3G1I A;  1L0H A;  2PEJ A;  3CCM P;  2GYK A;  2N6Z A;  1YIT P;  4PH1 A;  1Z6M A;  2GZF A;  3H0D A;  1VQM P;  2FQ1 A;  3H4E A;  2KGD A;  4XFZ A;  2GDX A;  1A8O A;  2FAD A;  1OR5 A;  2N50 A;  3B4Q A;  3DS3 A;  3HYB A;  5HV8 A;  2PY8 A;  2KG8 A;  4PXH B;  5HGM A;  2M5R A;  2PEN A;  2JB0 A;  4GR6 A;  5KP6 B;  2FAE A;  1Q7Y Q;  1YI2 P;  1M1K Q;  1UNK A;  2EIA A;  4BPH A;  3G28 A;  2K92 A;  2N5I A;  3CD6 P;  2L9F A;  1HQB A;  2PEO A;  3I56 P;  1NQ4 A;  3G29 A;  2K0Y A;  3GZM A;  2JU1 A;  1EIA A;  2L6E A;  1BXI A;  3EJE A;  4IPY A;  2VLN A;  4GR2 A;  1QRJ A;  3CXC O;  3G0V A;  3CCS P;  1GXG A;  4BPG A;  5DCK A;  2GZJ A;  2MF4 A;  3DTJ A;  2QA4 P;  3CPW O;  1VQ4 P;  3DS0 A;  1ACP A;  2PEQ A;  2FVA A;  2JQ4 A;  1AYI A;  2XZ1 C;  3EJB A;  2EHS A;  1Q81 Q;  4HKG A;  2VLP A;  3G26 A;  2LPK A; 
#chains in the Genus database with same CATH homology
 2MVV A;  3LMO A;  1L0H A;  2MR7 A;  2N6Y A;  2N6Z A;  2FQ1 A;  2QNW A;  2GDW A;  4CA3 A;  4BPF A;  2KGD A;  2AFE A;  5EJD A;  1VKU A;  2GDX A;  3CE7 A;  2KGC A;  2FAD A;  1OR5 A;  2MR8 A;  2CNR A;  2N50 A;  5HV8 A;  2KOP A;  3RG2 A;  2KG8 A;  5KP8 B;  2AF8 A;  4PXH B;  4MRT C;  4R0M A;  2LOL A;  2M5R A;  2L22 A;  2KGA A;  2LL8 A;  2KG9 A;  5KP6 B;  2FAE A;  1L0I A;  2FQ2 A;  4PWV B;  2PNG A;  2LKI A;  1AF8 A;  2CQ8 A;  1F80 D;  2JU2 A;  2FAC A;  3EJD A;  4BPH A;  1HY8 A;  2FVF A;  2K92 A;  2N5I A;  2LTE A;  2N98 A;  2L9F A;  1HQB A;  2FVE A;  1NQ4 A;  2K0X A;  2K2Q A;  2K0Y A;  5CZD B;  3GZM A;  2JU1 A;  3NY7 B;  2MVU A;  2KGE A;  2MY5 A;  3EJE A;  2N5H A;  1DV5 A;  4NEO A;  2KG6 A;  2XZ0 D;  2GDY A;  2FQ0 A;  1T8K A;  2AVA A;  4DG9 A;  2DNW A;  2FHS C;  4BPG A;  2EHT A;  2VSQ A;  5HVC A;  2LIW A;  2MF4 A;  2KR5 A;  2CGQ A;  2MD9 A;  2KOR A;  2KW2 A;  2X2B A;  4H2X C;  2KOQ A;  1DNY A;  1X3O A;  2ROQ A;  2KOS A;  2AFD A;  1ACP A;  2CG5 B;  2FVA A;  2L0Q A;  4H2W C;  1KLP A;  5KP7 B;  2JQ4 A;  3EJB A;  2XZ1 C;  2EHS A;  2LML A;  2JGP A;  4HKG A;  2K93 A;  2LIU A;  3GZL A;  2KOO A;  2L4B A;  4IZ6 A;  2KWL A;  2LPK A;  4H2Y C;  2K94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...