2JU1A

Solution structure of acyl carrier protein domain from module 2 of 6-deoxyerythronolide b synthase (debs)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
GSHMLRDRLAGLPRAERTAELVRLVRTSTATVLGHDDPKAVRATTPFKELGFDSLAAVRLRNLLNAATGLRLPSTLVFDHPNASAVAGFLDAELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and proposed domain domain recognition interface of an acyl carrier protein domain from a modular polyketide synthase.
pubmed doi rcsb
source organism Saccharopolyspora erythraea
molecule tags Transferase
molecule keywords Erythronolide synthase
total genus 22
structure length 95
sequence length 95
ec nomenclature ec 2.3.1.94: 6-deoxyerythronolide-B synthase.
pdb deposition date 2007-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ju1A00
4H2YC 4CA3A 2L4BA 2FQ2A 2N98A 3GZMA 2FADA 2LKIA 4BPFA 2AFDA 2AVAA 2LIWA 5KP8B 1AF8A 1HY8A 2KWLA 2FQ1A 2FVAA 2LPKA 2MR8A 2X2BA 2N6YA 3NY7B 1VKUA 2KG6A 3EJBA 2K92A 2GDYA 2LMLA 1KLPA 2LTEA 3RG2A 3GZLA 2CG5B 2JU2A 4H2XC 2KOPA 5CZDB 1X3OA 4NEOA 2GDWA 1ACPA 1DNYA 2JGPA 3EJDA 2KG8A 1OR5A 4BPHA 2KGCA 2K0YA 2JQ4A 2KOSA 2KGDA 4PXHB 2K0XA 2N5HA 2MVVA 4DG9A 2LL8A 2EHSA 2VSQA 2FVEA 1L0HA 2FHSC 2KORA 2MF4A 2FACA 2K93A 4PWVB 2PNGA 1HQBA 2KOOA 1NQ4A 4H2WC 2LOLA 2AF8A 2CNRA 2CQ8A 2KR5A 2MY5A 2MVUA 2KOQA 1F80D 2N6ZA 3EJEA 2N5IA 2KW2A 2M5RA 2CGQA 2FQ0A 1DV5A 5HVCA 2MD9A 2XZ1C 2GDXA 3CE7A 2FAEA 2LIUA 4HKGA 1L0IA 2AFEA 2L9FA 2K94A 2XZ0D 2JU1A 5KP6B 5KP7B 4IZ6A 4MRTC 2KGAA 2QNWA 2EHTA 2FVFA 2N50A 4BPGA 5HV8A 2MR7A 3LMOA 2DNWA 2K2QA 2KGEA 4R0MA 2ROQA 2L22A 2L0QA 5EJDA 1T8KA 2KG9A
chains in the Genus database with same CATH superfamily
1M6NA 2PEOA 4XROA 3CCMP 2FQ2A 3NTEA 3GZMA 2LKIA 2AFDA 2AVAA 3U43A 1E0HA 1AF8A 3G28A 2LPKA 2MR8A 2GZJA 3EJBA 2K92A 2VLQA 3CC7P 1UNKA 5F2OA 2BHVA 1EOQA 3G21A 1YITP 3DS4A 2PENA 2JGPA 2PEQA 2OTJP 1KC8Q 2KG8A 4XFYA 3RG6C 2KGCA 5F2NA 1YIJP 2N5HA 2EHSA 2GZGA 5HGNA 5F2KA 4WYMA 4PH0A 2Z44A 3G0VA 3CD6P 1AYIA 2PNGA 3CMEP 2KOOA 2JBGA 2LOLA 1EMVA 7CEIA 1M74A 2MY5A 3G4SP 2JO0A 3EJEA 2N5IA 4U0AA 1Q86Q 2GDXA 3CE7A 4COCA 2LIUA 4HKGA 1L0IA 4XFXA 2K94A 2XZ0D 2VLPA 2JU1A 2NO8A 5HGMA 1A8OA 4IZ6A 2KGAA 2XV6A 4GR2A 2OARA 2VLOA 1YJWP 1VQ8P 2KGEA 2L22A 2K0DX 5EJDA 1T8KA 2KG9A 3H0DA 2GZEA 4H2YC 4IPYA 5DCKA 5JPAA 2N98A 2JAZA 1HY8A 2FQ1A 2X2BA 4QNBA 1VQ6P 4QKOA 5EW5E 2Z45A 2L6EA 2JYGA 2EFJA 1K73Q 2LF4A 1EIAA 1MZ8A 2E1MA 1GXHA 2KOPA 2GDWA 3DS5A 5BS2A 3EJDA 4U0EA 1VQ9P 1BAJA 2K0YA 2KGDA 2M8PA 2LL8A 4DG9A 2VSQA 1ZNVA 2M8LA 5HGLA 1YJ9P 1L0HA 2FACA 4PWVB 3CMAP 1VQNP 2EG5A 5I4TG 1NQ4A 4H2WC 1YI2P 3CCVP 1M90Q 2CNRA 3HZQA 2MVUA 2Z46A 1F80D 2XT1A 2FQ0A 1DV5A 2K5XA 3CCRP 3E2DA 2AFEA 2L9FA 1YJNP 1VQOP 4MRTC 3DTJA 2N50A 1VQ7P 3CC4P 3H47A 5HV8A 4COPA 3LMOA 2DNWA 2K2QA 1QRJA 1CEIA 1UJZA 2GYKA 3HYBA 2VLNA 2FADA 3H4EA 3B5IA 2BUOA 5KP8B 2KWLA 2FVAA 4U0BA 2N6YA 3NY7B 3CCUP 2GZIA 3CCQP 2GDYA 3CCLP 1S72P 2LMLA 1M6EX 3RG2A 2PY8A 3GZLA 2CG5B 4H2XC 3DS0A 3G29A 4NEOA 1DNYA 1ACPA 1K8AQ 2XXMA 1OR5A 4BPHA 3VRLC 2JQ4A 2KOSA 4PXHB 4U0FA 1D1DA 1N8RQ 2OTLP 1Q7YQ 2FVEA 2FHSC 2QA4P 2MF4A 1E6JP 1QVGO 1KQSO 4U0DA 3M1MA 3OW2O 2KR5A 1IMPA 2JYLA 2KOQA 2KW2A 2M5RA 2CGQA 4UHPB 1BXIA 2MD9A 3LRYA 1VHNA 1M1KQ 3CCEP 1FR2A 2FAEA 3I55P 3G6EP 4XRQA 2EIAA 1VQMP 1K9MQ 3DS3A 3DS2A 2QNWA 1IMQA 2EHTA 2FVFA 2MR7A 1VQ4P 1A43A 2ERHA 2PEIA 1IUQA 4CA3A 2L4BA 2JB0A 3WBHA 4XFZA 4BPFA 3CXCO 3G71P 2LIWA 1GPJA 1K30A 1Z6MA 3G1IA 5HGOA 4U0CA 3P05A 2DGYA 2M8NA 3GJNA 1VQ5P 1VKUA 2KG6A 3CCSP 3I56P 3DPHA 3GKLC 1KLPA 2LTEA 1YHQP 2JU2A 1RNIA 2CWOA 5CZDB 1RO0A 1X3OA 1KD1Q 2ONTA 3CPWO 4M0IA 3DS1A 3MGEA 2K0XA 2WPTA 2MVVA 4PH1A 1W2BO 1VQKP 1NJIQ 2GZFA 1Q82Q 2KORA 1VQPP 2K93A 1HQBA 5BS1A 3G26A 2KODA 3B4QA 1Q81Q 3G1GA 1RO2A 2AF8A 2CQ8A 4F37A 2QEXP 2N6ZA 3CC2P 5HVCA 2XZ1C 1QVFO 3CCJP 1GXGA 5KP6B 2PEMA 3Q20A 5KP7B 2P9XA 2PEKA 4BPGA 4GR6A 1AUMA 1ZMBA 1JJ2O 4R0MA 2ROQA 2L0QA 1VQLP 2PEJA
chains in the Genus database with same CATH topology
4H2YC 4CA3A 2L4BA 2FQ2A 2N98A 3GZMA 2FADA 2LKIA 4BPFA 2AFDA 2AVAA 2LIWA 5KP8B 1AF8A 1HY8A 2KWLA 2FQ1A 2FVAA 2LPKA 2MR8A 2X2BA 2N6YA 3NY7B 1VKUA 2KG6A 3EJBA 2K92A 2GDYA 2LMLA 1KLPA 2LTEA 3RG2A 3GZLA 2CG5B 2JU2A 4H2XC 2KOPA 5CZDB 1X3OA 4NEOA 2GDWA 1ACPA 1DNYA 2JGPA 3EJDA 2KG8A 1OR5A 4BPHA 2KGCA 2K0YA 2JQ4A 2KOSA 2KGDA 4PXHB 2K0XA 2N5HA 2MVVA 4DG9A 2LL8A 2EHSA 2VSQA 2FVEA 1L0HA 2FHSC 2KORA 2MF4A 2FACA 2K93A 4PWVB 2PNGA 1HQBA 2KOOA 1NQ4A 4H2WC 2LOLA 2AF8A 2CNRA 2CQ8A 2KR5A 2MY5A 2MVUA 2KOQA 1F80D 2N6ZA 3EJEA 2N5IA 2KW2A 2M5RA 2CGQA 2FQ0A 1DV5A 5HVCA 2MD9A 2XZ1C 2GDXA 3CE7A 2FAEA 2LIUA 4HKGA 1L0IA 2AFEA 2L9FA 2K94A 2XZ0D 2JU1A 5KP6B 5KP7B 4IZ6A 4MRTC 2KGAA 2QNWA 2EHTA 2FVFA 2N50A 4BPGA 5HV8A 2MR7A 3LMOA 2DNWA 2K2QA 2KGEA 4R0MA 2ROQA 2L22A 2L0QA 5EJDA 1T8KA 2KG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2Y C;  4CA3 A;  2L4B A;  2FQ2 A;  2N98 A;  3GZM A;  2FAD A;  2LKI A;  4BPF A;  2AFD A;  2AVA A;  2LIW A;  5KP8 B;  1AF8 A;  1HY8 A;  2KWL A;  2FQ1 A;  2FVA A;  2LPK A;  2MR8 A;  2X2B A;  2N6Y A;  3NY7 B;  1VKU A;  2KG6 A;  3EJB A;  2K92 A;  2GDY A;  2LML A;  1KLP A;  2LTE A;  3RG2 A;  3GZL A;  2CG5 B;  2JU2 A;  4H2X C;  2KOP A;  5CZD B;  1X3O A;  4NEO A;  2GDW A;  1ACP A;  1DNY A;  2JGP A;  3EJD A;  2KG8 A;  1OR5 A;  4BPH A;  2KGC A;  2K0Y A;  2JQ4 A;  2KOS A;  2KGD A;  4PXH B;  2K0X A;  2N5H A;  2MVV A;  4DG9 A;  2LL8 A;  2EHS A;  2VSQ A;  2FVE A;  1L0H A;  2FHS C;  2KOR A;  2MF4 A;  2FAC A;  2K93 A;  4PWV B;  2PNG A;  1HQB A;  2KOO A;  1NQ4 A;  4H2W C;  2LOL A;  2AF8 A;  2CNR A;  2CQ8 A;  2KR5 A;  2MY5 A;  2MVU A;  2KOQ A;  1F80 D;  2N6Z A;  3EJE A;  2N5I A;  2KW2 A;  2M5R A;  2CGQ A;  2FQ0 A;  1DV5 A;  5HVC A;  2MD9 A;  2XZ1 C;  2GDX A;  3CE7 A;  2FAE A;  2LIU A;  4HKG A;  1L0I A;  2AFE A;  2L9F A;  2K94 A;  2XZ0 D;  2JU1 A;  5KP6 B;  5KP7 B;  4IZ6 A;  4MRT C;  2KGA A;  2QNW A;  2EHT A;  2FVF A;  2N50 A;  4BPG A;  5HV8 A;  2MR7 A;  3LMO A;  2DNW A;  2K2Q A;  2KGE A;  4R0M A;  2ROQ A;  2L22 A;  2L0Q A;  5EJD A;  1T8K A;  2KG9 A; 
#chains in the Genus database with same CATH topology
 1M6N A;  2PEO A;  4XRO A;  3CCM P;  2FQ2 A;  3NTE A;  3GZM A;  2LKI A;  2AFD A;  2AVA A;  3U43 A;  1E0H A;  1AF8 A;  3G28 A;  2LPK A;  2MR8 A;  2GZJ A;  3EJB A;  2K92 A;  2VLQ A;  3CC7 P;  1UNK A;  5F2O A;  2BHV A;  1EOQ A;  3G21 A;  1YIT P;  3DS4 A;  2PEN A;  2JGP A;  2PEQ A;  2OTJ P;  1KC8 Q;  2KG8 A;  4XFY A;  3RG6 C;  2KGC A;  5F2N A;  1YIJ P;  2N5H A;  2EHS A;  2GZG A;  5HGN A;  5F2K A;  4WYM A;  4PH0 A;  2Z44 A;  3G0V A;  3CD6 P;  1AYI A;  2PNG A;  3CME P;  2KOO A;  2JBG A;  2LOL A;  1EMV A;  7CEI A;  1M74 A;  2MY5 A;  3G4S P;  2JO0 A;  3EJE A;  2N5I A;  4U0A A;  1Q86 Q;  2GDX A;  3CE7 A;  4COC A;  2LIU A;  4HKG A;  1L0I A;  4XFX A;  2K94 A;  2XZ0 D;  2VLP A;  2JU1 A;  2NO8 A;  5HGM A;  1A8O A;  4IZ6 A;  2KGA A;  2XV6 A;  4GR2 A;  2OAR A;  2VLO A;  1YJW P;  1VQ8 P;  2KGE A;  2L22 A;  2K0D X;  5EJD A;  1T8K A;  2KG9 A;  3H0D A;  2GZE A;  4H2Y C;  4IPY A;  5DCK A;  5JPA A;  2N98 A;  2JAZ A;  1HY8 A;  2FQ1 A;  2X2B A;  4QNB A;  1VQ6 P;  4QKO A;  5EW5 E;  2Z45 A;  2L6E A;  2JYG A;  2EFJ A;  1K73 Q;  2LF4 A;  1EIA A;  1MZ8 A;  2E1M A;  1GXH A;  2KOP A;  2GDW A;  3DS5 A;  5BS2 A;  3EJD A;  4U0E A;  1VQ9 P;  1BAJ A;  2K0Y A;  2KGD A;  2M8P A;  2LL8 A;  4DG9 A;  2VSQ A;  1ZNV A;  2M8L A;  5HGL A;  1YJ9 P;  1L0H A;  2FAC A;  4PWV B;  3CMA P;  1VQN P;  2EG5 A;  5I4T G;  1NQ4 A;  4H2W C;  1YI2 P;  3CCV P;  1M90 Q;  2CNR A;  3HZQ A;  2MVU A;  2Z46 A;  1F80 D;  2XT1 A;  2FQ0 A;  1DV5 A;  2K5X A;  3CCR P;  3E2D A;  2AFE A;  2L9F A;  1YJN P;  1VQO P;  4MRT C;  3DTJ A;  2N50 A;  1VQ7 P;  3CC4 P;  3H47 A;  5HV8 A;  4COP A;  3LMO A;  2DNW A;  2K2Q A;  1QRJ A;  1CEI A;  1UJZ A;  2GYK A;  3HYB A;  2VLN A;  2FAD A;  3H4E A;  3B5I A;  2BUO A;  5KP8 B;  2KWL A;  2FVA A;  4U0B A;  2N6Y A;  3NY7 B;  3CCU P;  2GZI A;  3CCQ P;  2GDY A;  3CCL P;  1S72 P;  2LML A;  1M6E X;  3RG2 A;  2PY8 A;  3GZL A;  2CG5 B;  4H2X C;  3DS0 A;  3G29 A;  4NEO A;  1DNY A;  1ACP A;  1K8A Q;  2XXM A;  1OR5 A;  4BPH A;  3VRL C;  2JQ4 A;  2KOS A;  4PXH B;  4U0F A;  1D1D A;  1N8R Q;  2OTL P;  1Q7Y Q;  2FVE A;  2FHS C;  2QA4 P;  2MF4 A;  1E6J P;  1QVG O;  1KQS O;  4U0D A;  3M1M A;  3OW2 O;  2KR5 A;  1IMP A;  2JYL A;  2KOQ A;  2KW2 A;  2M5R A;  2CGQ A;  4UHP B;  1BXI A;  2MD9 A;  3LRY A;  1VHN A;  1M1K Q;  3CCE P;  1FR2 A;  2FAE A;  3I55 P;  3G6E P;  4XRQ A;  2EIA A;  1VQM P;  1K9M Q;  3DS3 A;  3DS2 A;  2QNW A;  1IMQ A;  2EHT A;  2FVF A;  2MR7 A;  1VQ4 P;  1A43 A;  2ERH A;  2PEI A;  1IUQ A;  4CA3 A;  2L4B A;  2JB0 A;  3WBH A;  4XFZ A;  4BPF A;  3CXC O;  3G71 P;  2LIW A;  1GPJ A;  1K30 A;  1Z6M A;  3G1I A;  5HGO A;  4U0C A;  3P05 A;  2DGY A;  2M8N A;  3GJN A;  1VQ5 P;  1VKU A;  2KG6 A;  3CCS P;  3I56 P;  3DPH A;  3GKL C;  1KLP A;  2LTE A;  1YHQ P;  2JU2 A;  1RNI A;  2CWO A;  5CZD B;  1RO0 A;  1X3O A;  1KD1 Q;  2ONT A;  3CPW O;  4M0I A;  3DS1 A;  3MGE A;  2K0X A;  2WPT A;  2MVV A;  4PH1 A;  1W2B O;  1VQK P;  1NJI Q;  2GZF A;  1Q82 Q;  2KOR A;  1VQP P;  2K93 A;  1HQB A;  5BS1 A;  3G26 A;  2KOD A;  3B4Q A;  1Q81 Q;  3G1G A;  1RO2 A;  2AF8 A;  2CQ8 A;  4F37 A;  2QEX P;  2N6Z A;  3CC2 P;  5HVC A;  2XZ1 C;  1QVF O;  3CCJ P;  1GXG A;  5KP6 B;  2PEM A;  3Q20 A;  5KP7 B;  2P9X A;  2PEK A;  4BPG A;  4GR6 A;  1AUM A;  1ZMB A;  1JJ2 O;  4R0M A;  2ROQ A;  2L0Q A;  1VQL P;  2PEJ A; 
#chains in the Genus database with same CATH homology
 4H2Y C;  4CA3 A;  2L4B A;  2FQ2 A;  2N98 A;  3GZM A;  2FAD A;  2LKI A;  4BPF A;  2AFD A;  2AVA A;  2LIW A;  5KP8 B;  1AF8 A;  1HY8 A;  2KWL A;  2FQ1 A;  2FVA A;  2LPK A;  2MR8 A;  2X2B A;  2N6Y A;  3NY7 B;  1VKU A;  2KG6 A;  3EJB A;  2K92 A;  2GDY A;  2LML A;  1KLP A;  2LTE A;  3RG2 A;  3GZL A;  2CG5 B;  2JU2 A;  4H2X C;  2KOP A;  5CZD B;  1X3O A;  4NEO A;  2GDW A;  1ACP A;  1DNY A;  2JGP A;  3EJD A;  2KG8 A;  1OR5 A;  4BPH A;  2KGC A;  2K0Y A;  2JQ4 A;  2KOS A;  2KGD A;  4PXH B;  2K0X A;  2N5H A;  2MVV A;  4DG9 A;  2LL8 A;  2EHS A;  2VSQ A;  2FVE A;  1L0H A;  2FHS C;  2KOR A;  2MF4 A;  2FAC A;  2K93 A;  4PWV B;  2PNG A;  1HQB A;  2KOO A;  1NQ4 A;  4H2W C;  2LOL A;  2AF8 A;  2CNR A;  2CQ8 A;  2KR5 A;  2MY5 A;  2MVU A;  2KOQ A;  1F80 D;  2N6Z A;  3EJE A;  2N5I A;  2KW2 A;  2M5R A;  2CGQ A;  2FQ0 A;  1DV5 A;  5HVC A;  2MD9 A;  2XZ1 C;  2GDX A;  3CE7 A;  2FAE A;  2LIU A;  4HKG A;  1L0I A;  2AFE A;  2L9F A;  2K94 A;  2XZ0 D;  2JU1 A;  5KP6 B;  5KP7 B;  4IZ6 A;  4MRT C;  2KGA A;  2QNW A;  2EHT A;  2FVF A;  2N50 A;  4BPG A;  5HV8 A;  2MR7 A;  3LMO A;  2DNW A;  2K2Q A;  2KGE A;  4R0M A;  2ROQ A;  2L22 A;  2L0Q A;  5EJD A;  1T8K A;  2KG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...