2JU1A

Solution structure of acyl carrier protein domain from module 2 of 6-deoxyerythronolide b synthase (debs)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
GSHMLRDRLAGLPRAERTAELVRLVRTSTATVLGHDDPKAVRATTPFKELGFDSLAAVRLRNLLNAATGLRLPSTLVFDHPNASAVAGFLDAELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Erythronolide synthase
publication title Solution structure and proposed domain domain recognition interface of an acyl carrier protein domain from a modular polyketide synthase.
pubmed doi rcsb
source organism Saccharopolyspora erythraea
molecule tags Transferase
total genus 22
structure length 95
sequence length 95
ec nomenclature ec 2.3.1.94: 6-deoxyerythronolide-B synthase.
pdb deposition date 2007-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ju1A00
2LL8A 2CQ8A 2KG6A 4BPFA 2AF8A 5KP7B 2MF4A 2JU2A 2CGQA 2LIWA 3LMOA 2L22A 3NY7B 2EHSA 2KORA 2LIUA 2LMLA 2MR8A 2K93A 1VKUA 1L0HA 2ROQA 2CG5B 1DV5A 2PNGA 4CA3A 4MRTC 2MVUA 2AFDA 2KGAA 2M5RA 5KP6B 3EJEA 1X3OA 2LTEA 2GDYA 2VSQA 2FHSC 1ACPA 3EJBA 3RG2A 2K2QA 2FAEA 2KOOA 2AFEA 4H2WC 2KGEA 2KWLA 2FVFA 2KGDA 2MR7A 2FQ2A 4R0MA 1HQBA 4DG9A 2K0YA 2FVAA 2N5IA 2GDXA 1DNYA 2FACA 3GZMA 2LPKA 1F80D 2QNWA 2KOPA 2N50A 4PXHB 2CNRA 4PWVB 2JGPA 2KG8A 2EHTA 2XZ0D 1HY8A 5HVCA 2AVAA 2KR5A 1NQ4A 2N6ZA 2KW2A 4BPHA 1KLPA 2FQ0A 4NEOA 2L4BA 2MVVA 2KOQA 5KP8B 2KOSA 2XZ1C 5CZDB 4BPGA 1L0IA 2LKIA 2N5HA 2L0QA 1T8KA 3EJDA 2FVEA 2K92A 2K94A 2N98A 2KG9A 2FQ1A 2N6YA 2L9FA 2JQ4A 2KGCA 1AF8A 2JU1A 4IZ6A 2GDWA 4H2XC 2MY5A 2X2BA 2MD9A 2DNWA 3GZLA 2LOLA 5EJDA 1OR5A 2K0XA 3CE7A 5HV8A 2FADA 4H2YC 4HKGA
chains in the Genus database with same CATH superfamily
4U0AA 2LL8A 2CQ8A 1E6JP 4BPFA 2BHVA 3CCLP 5KP7B 1BAJA 3WBHA 2CGQA 2LIWA 3CMEP 2L22A 2EHSA 1K8AQ 1GXHA 1VQOP 1VKUA 5HGLA 1GPJA 2JYLA 3CXCO 3CC2P 2EFJA 4IPYA 4PH1A 1YITP 2PNGA 2P9XA 4MRTC 1MZ8A 1RO2A 2JB0A 1Q7YQ 1X3OA 2LTEA 1UJZA 1YHQP 3Q20A 2KODA 3NTEA 3H47A 2FAEA 2KGEA 3DS4A 2KGDA 1A8OA 2MR7A 2FQ2A 3LRYA 3CCMP 1KC8Q 4U0EA 2KOPA 3G6EP 4PXHB 3VRLC 1VHNA 5HGOA 2KR5A 2VLPA 2XZ1C 5CZDB 4M0IA 1IUQA 3CCEP 1K30A 1QRJA 2K5XA 2QA4P 4GR2A 1EOQA 2JAZA 2FQ1A 2N6YA 2L9FA 2JQ4A 1VQ5P 1AF8A 1M74A 1M1KQ 1VQ8P 2E1MA 2MD9A 4XRQA 2OTJP 7CEIA 2Z44A 2ERHA 2AF8A 1JJ2O 2JU2A 2XXMA 1AUMA 3DS3A 5JPAA 4GR6A 1AYIA 3CCVP 2LIUA 2LMLA 3U43A 2BUOA 5BS1A 4UHPB 3CCJP 4CA3A 1BXIA 2GDYA 4XFYA 2JO0A 3G28A 3RG2A 2K2QA 1VQ6P 3CD6P 2KOOA 2AFEA 4WYMA 2FVFA 4R0MA 2Z45A 2K0YA 2FVAA 1DNYA 3H4EA 2LPKA 4COPA 1F80D 4XFXA 2QNWA 1N8RQ 1IMPA 3CCUP 3OW2O 2GZGA 4PWVB 2PEJA 5BS2A 3HYBA 2EHTA 4U0FA 1K9MQ 5HVCA 2AVAA 2CWOA 1NQ4A 2LF4A 2N6ZA 4BPHA 2FQ0A 5KP8B 2M8NA 1YJWP 1QVGO 1Z6MA 4BPGA 2JBGA 1T8KA 2PEKA 2K92A 2K94A 3DTJA 3RG6C 1VQ7P 2M8LA 1IMQA 2GDWA 4QNBA 2PEMA 3I55P 2QEXP 1VQ4P 3GZLA 1OR5A 2K0XA 5HV8A 1VQPP 2EIAA 3G29A 2PEIA 1ZMBA 2KG6A 5HGNA 2OARA 4F37A 2MF4A 3LMOA 2KORA 1A43A 3DS0A 2M8PA 2Z46A 3CCSP 1L0HA 2ROQA 2VLOA 2CG5B 1W2BO 2PEQA 1Q86Q 1RO0A 3DPHA 3GJNA 2KGAA 5KP6B 3EJEA 2GZFA 3G26A 2VSQA 2FHSC 1NJIQ 1RNIA 5HGMA 1YJNP 4H2WC 4COCA 3MGEA 3CMAP 1K73Q 1HQBA 4DG9A 2N5IA 2GDXA 1FR2A 2OTLP 4QKOA 2FACA 2PY8A 2GZIA 1VQMP 3I56P 2JGPA 2KG8A 2XZ0D 1HY8A 3CCRP 1YJ9P 1KQSO 1M90Q 4U0CA 5EW5E 2MVVA 3B5IA 3G71P 2VLQA 1YIJP 3E2DA 1L0IA 2LKIA 5F2KA 2L0QA 3H0DA 2K0DX 1VQNP 2FVEA 2EG5A 2PEOA 2KG9A 1YI2P 2XT1A 3B4QA 2GZJA 1Q81Q 2JYGA 4IZ6A 2X2BA 5EJDA 2FADA 4H2YC 2GYKA 4U0DA 5I4TG 1EMVA 1M6EX 5DCKA 3CC7P 1CEIA 3G4SP 3M1MA 3NY7B 2XV6A 2NO8A 2MR8A 3DS1A 2K93A 1E0HA 3HZQA 1ZNVA 2VLNA 5F2OA 1DV5A 1Q82Q 3CPWO 2MVUA 2AFDA 2M5RA 5F2NA 3G1GA 1ACPA 3EJBA 4PH0A 2KWLA 3G1IA 1VQLP 3CC4P 2WPTA 3GZMA 3GKLC 3G0VA 1QVFO 2DGYA 2N50A 2PENA 2CNRA 1UNKA 1KD1Q 1GXGA 2GZEA 4XFZA 1D1DA 2KW2A 1KLPA 1VQ9P 4NEOA 2L4BA 2KOQA 2KOSA 1S72P 2N5HA 1VQKP 3EJDA 3P05A 4XROA 2N98A 1EIAA 2ONTA 2KGCA 3DS5A 2JU1A 3DS2A 4H2XC 2MY5A 3G21A 2DNWA 3CCQP 2LOLA 1M6NA 3CE7A 2L6EA 4HKGA 4U0BA
chains in the Genus database with same CATH topology
2LL8A 2CQ8A 2KG6A 4BPFA 2AF8A 5KP7B 2MF4A 2JU2A 2CGQA 2LIWA 3LMOA 2L22A 3NY7B 2EHSA 2KORA 2LIUA 2LMLA 2MR8A 2K93A 1VKUA 1L0HA 2ROQA 2CG5B 1DV5A 2PNGA 4CA3A 4MRTC 2MVUA 2AFDA 2KGAA 2M5RA 5KP6B 3EJEA 1X3OA 2LTEA 2GDYA 2VSQA 2FHSC 1ACPA 3EJBA 3RG2A 2K2QA 2FAEA 2KOOA 2AFEA 4H2WC 2KGEA 2KWLA 2FVFA 2KGDA 2MR7A 2FQ2A 4R0MA 1HQBA 4DG9A 2K0YA 2FVAA 2N5IA 2GDXA 1DNYA 2FACA 3GZMA 2LPKA 1F80D 2QNWA 2KOPA 2N50A 4PXHB 2CNRA 4PWVB 2JGPA 2KG8A 2EHTA 2XZ0D 1HY8A 5HVCA 2AVAA 2KR5A 1NQ4A 2N6ZA 2KW2A 4BPHA 1KLPA 2FQ0A 4NEOA 2L4BA 2MVVA 2KOQA 5KP8B 2KOSA 2XZ1C 5CZDB 4BPGA 1L0IA 2LKIA 2N5HA 2L0QA 1T8KA 3EJDA 2FVEA 2K92A 2K94A 2N98A 2KG9A 2FQ1A 2N6YA 2L9FA 2JQ4A 2KGCA 1AF8A 2JU1A 4IZ6A 2GDWA 4H2XC 2MY5A 2X2BA 2MD9A 2DNWA 3GZLA 2LOLA 5EJDA 1OR5A 2K0XA 3CE7A 5HV8A 2FADA 4H2YC 4HKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LL8 A;  2CQ8 A;  2KG6 A;  4BPF A;  2AF8 A;  5KP7 B;  2MF4 A;  2JU2 A;  2CGQ A;  2LIW A;  3LMO A;  2L22 A;  3NY7 B;  2EHS A;  2KOR A;  2LIU A;  2LML A;  2MR8 A;  2K93 A;  1VKU A;  1L0H A;  2ROQ A;  2CG5 B;  1DV5 A;  2PNG A;  4CA3 A;  4MRT C;  2MVU A;  2AFD A;  2KGA A;  2M5R A;  5KP6 B;  3EJE A;  1X3O A;  2LTE A;  2GDY A;  2VSQ A;  2FHS C;  1ACP A;  3EJB A;  3RG2 A;  2K2Q A;  2FAE A;  2KOO A;  2AFE A;  4H2W C;  2KGE A;  2KWL A;  2FVF A;  2KGD A;  2MR7 A;  2FQ2 A;  4R0M A;  1HQB A;  4DG9 A;  2K0Y A;  2FVA A;  2N5I A;  2GDX A;  1DNY A;  2FAC A;  3GZM A;  2LPK A;  1F80 D;  2QNW A;  2KOP A;  2N50 A;  4PXH B;  2CNR A;  4PWV B;  2JGP A;  2KG8 A;  2EHT A;  2XZ0 D;  1HY8 A;  5HVC A;  2AVA A;  2KR5 A;  1NQ4 A;  2N6Z A;  2KW2 A;  4BPH A;  1KLP A;  2FQ0 A;  4NEO A;  2L4B A;  2MVV A;  2KOQ A;  5KP8 B;  2KOS A;  2XZ1 C;  5CZD B;  4BPG A;  1L0I A;  2LKI A;  2N5H A;  2L0Q A;  1T8K A;  3EJD A;  2FVE A;  2K92 A;  2K94 A;  2N98 A;  2KG9 A;  2FQ1 A;  2N6Y A;  2L9F A;  2JQ4 A;  2KGC A;  1AF8 A;  2JU1 A;  4IZ6 A;  2GDW A;  4H2X C;  2MY5 A;  2X2B A;  2MD9 A;  2DNW A;  3GZL A;  2LOL A;  5EJD A;  1OR5 A;  2K0X A;  3CE7 A;  5HV8 A;  2FAD A;  4H2Y C;  4HKG A; 
#chains in the Genus database with same CATH topology
 4U0A A;  2LL8 A;  2CQ8 A;  1E6J P;  4BPF A;  2BHV A;  3CCL P;  5KP7 B;  1BAJ A;  3WBH A;  2CGQ A;  2LIW A;  3CME P;  2L22 A;  2EHS A;  1K8A Q;  1GXH A;  1VQO P;  1VKU A;  5HGL A;  1GPJ A;  2JYL A;  3CXC O;  3CC2 P;  2EFJ A;  4IPY A;  4PH1 A;  1YIT P;  2PNG A;  2P9X A;  4MRT C;  1MZ8 A;  1RO2 A;  2JB0 A;  1Q7Y Q;  1X3O A;  2LTE A;  1UJZ A;  1YHQ P;  3Q20 A;  2KOD A;  3NTE A;  3H47 A;  2FAE A;  2KGE A;  3DS4 A;  2KGD A;  1A8O A;  2MR7 A;  2FQ2 A;  3LRY A;  3CCM P;  1KC8 Q;  4U0E A;  2KOP A;  3G6E P;  4PXH B;  3VRL C;  1VHN A;  5HGO A;  2KR5 A;  2VLP A;  2XZ1 C;  5CZD B;  4M0I A;  1IUQ A;  3CCE P;  1K30 A;  1QRJ A;  2K5X A;  2QA4 P;  4GR2 A;  1EOQ A;  2JAZ A;  2FQ1 A;  2N6Y A;  2L9F A;  2JQ4 A;  1VQ5 P;  1AF8 A;  1M74 A;  1M1K Q;  1VQ8 P;  2E1M A;  2MD9 A;  4XRQ A;  2OTJ P;  7CEI A;  2Z44 A;  2ERH A;  2AF8 A;  1JJ2 O;  2JU2 A;  2XXM A;  1AUM A;  3DS3 A;  5JPA A;  4GR6 A;  1AYI A;  3CCV P;  2LIU A;  2LML A;  3U43 A;  2BUO A;  5BS1 A;  4UHP B;  3CCJ P;  4CA3 A;  1BXI A;  2GDY A;  4XFY A;  2JO0 A;  3G28 A;  3RG2 A;  2K2Q A;  1VQ6 P;  3CD6 P;  2KOO A;  2AFE A;  4WYM A;  2FVF A;  4R0M A;  2Z45 A;  2K0Y A;  2FVA A;  1DNY A;  3H4E A;  2LPK A;  4COP A;  1F80 D;  4XFX A;  2QNW A;  1N8R Q;  1IMP A;  3CCU P;  3OW2 O;  2GZG A;  4PWV B;  2PEJ A;  5BS2 A;  3HYB A;  2EHT A;  4U0F A;  1K9M Q;  5HVC A;  2AVA A;  2CWO A;  1NQ4 A;  2LF4 A;  2N6Z A;  4BPH A;  2FQ0 A;  5KP8 B;  2M8N A;  1YJW P;  1QVG O;  1Z6M A;  4BPG A;  2JBG A;  1T8K A;  2PEK A;  2K92 A;  2K94 A;  3DTJ A;  3RG6 C;  1VQ7 P;  2M8L A;  1IMQ A;  2GDW A;  4QNB A;  2PEM A;  3I55 P;  2QEX P;  1VQ4 P;  3GZL A;  1OR5 A;  2K0X A;  5HV8 A;  1VQP P;  2EIA A;  3G29 A;  2PEI A;  1ZMB A;  2KG6 A;  5HGN A;  2OAR A;  4F37 A;  2MF4 A;  3LMO A;  2KOR A;  1A43 A;  3DS0 A;  2M8P A;  2Z46 A;  3CCS P;  1L0H A;  2ROQ A;  2VLO A;  2CG5 B;  1W2B O;  2PEQ A;  1Q86 Q;  1RO0 A;  3DPH A;  3GJN A;  2KGA A;  5KP6 B;  3EJE A;  2GZF A;  3G26 A;  2VSQ A;  2FHS C;  1NJI Q;  1RNI A;  5HGM A;  1YJN P;  4H2W C;  4COC A;  3MGE A;  3CMA P;  1K73 Q;  1HQB A;  4DG9 A;  2N5I A;  2GDX A;  1FR2 A;  2OTL P;  4QKO A;  2FAC A;  2PY8 A;  2GZI A;  1VQM P;  3I56 P;  2JGP A;  2KG8 A;  2XZ0 D;  1HY8 A;  3CCR P;  1YJ9 P;  1KQS O;  1M90 Q;  4U0C A;  5EW5 E;  2MVV A;  3B5I A;  3G71 P;  2VLQ A;  1YIJ P;  3E2D A;  1L0I A;  2LKI A;  5F2K A;  2L0Q A;  3H0D A;  2K0D X;  1VQN P;  2FVE A;  2EG5 A;  2PEO A;  2KG9 A;  1YI2 P;  2XT1 A;  3B4Q A;  2GZJ A;  1Q81 Q;  2JYG A;  4IZ6 A;  2X2B A;  5EJD A;  2FAD A;  4H2Y C;  2GYK A;  4U0D A;  5I4T G;  1EMV A;  1M6E X;  5DCK A;  3CC7 P;  1CEI A;  3G4S P;  3M1M A;  3NY7 B;  2XV6 A;  2NO8 A;  2MR8 A;  3DS1 A;  2K93 A;  1E0H A;  3HZQ A;  1ZNV A;  2VLN A;  5F2O A;  1DV5 A;  1Q82 Q;  3CPW O;  2MVU A;  2AFD A;  2M5R A;  5F2N A;  3G1G A;  1ACP A;  3EJB A;  4PH0 A;  2KWL A;  3G1I A;  1VQL P;  3CC4 P;  2WPT A;  3GZM A;  3GKL C;  3G0V A;  1QVF O;  2DGY A;  2N50 A;  2PEN A;  2CNR A;  1UNK A;  1KD1 Q;  1GXG A;  2GZE A;  4XFZ A;  1D1D A;  2KW2 A;  1KLP A;  1VQ9 P;  4NEO A;  2L4B A;  2KOQ A;  2KOS A;  1S72 P;  2N5H A;  1VQK P;  3EJD A;  3P05 A;  4XRO A;  2N98 A;  1EIA A;  2ONT A;  2KGC A;  3DS5 A;  2JU1 A;  3DS2 A;  4H2X C;  2MY5 A;  3G21 A;  2DNW A;  3CCQ P;  2LOL A;  1M6N A;  3CE7 A;  2L6E A;  4HKG A;  4U0B A; 
#chains in the Genus database with same CATH homology
 2LL8 A;  2CQ8 A;  2KG6 A;  4BPF A;  2AF8 A;  5KP7 B;  2MF4 A;  2JU2 A;  2CGQ A;  2LIW A;  3LMO A;  2L22 A;  3NY7 B;  2EHS A;  2KOR A;  2LIU A;  2LML A;  2MR8 A;  2K93 A;  1VKU A;  1L0H A;  2ROQ A;  2CG5 B;  1DV5 A;  2PNG A;  4CA3 A;  4MRT C;  2MVU A;  2AFD A;  2KGA A;  2M5R A;  5KP6 B;  3EJE A;  1X3O A;  2LTE A;  2GDY A;  2VSQ A;  2FHS C;  1ACP A;  3EJB A;  3RG2 A;  2K2Q A;  2FAE A;  2KOO A;  2AFE A;  4H2W C;  2KGE A;  2KWL A;  2FVF A;  2KGD A;  2MR7 A;  2FQ2 A;  4R0M A;  1HQB A;  4DG9 A;  2K0Y A;  2FVA A;  2N5I A;  2GDX A;  1DNY A;  2FAC A;  3GZM A;  2LPK A;  1F80 D;  2QNW A;  2KOP A;  2N50 A;  4PXH B;  2CNR A;  4PWV B;  2JGP A;  2KG8 A;  2EHT A;  2XZ0 D;  1HY8 A;  5HVC A;  2AVA A;  2KR5 A;  1NQ4 A;  2N6Z A;  2KW2 A;  4BPH A;  1KLP A;  2FQ0 A;  4NEO A;  2L4B A;  2MVV A;  2KOQ A;  5KP8 B;  2KOS A;  2XZ1 C;  5CZD B;  4BPG A;  1L0I A;  2LKI A;  2N5H A;  2L0Q A;  1T8K A;  3EJD A;  2FVE A;  2K92 A;  2K94 A;  2N98 A;  2KG9 A;  2FQ1 A;  2N6Y A;  2L9F A;  2JQ4 A;  2KGC A;  1AF8 A;  2JU1 A;  4IZ6 A;  2GDW A;  4H2X C;  2MY5 A;  2X2B A;  2MD9 A;  2DNW A;  3GZL A;  2LOL A;  5EJD A;  1OR5 A;  2K0X A;  3CE7 A;  5HV8 A;  2FAD A;  4H2Y C;  4HKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...