2JU1A

Solution structure of acyl carrier protein domain from module 2 of 6-deoxyerythronolide b synthase (debs)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
GSHMLRDRLAGLPRAERTAELVRLVRTSTATVLGHDDPKAVRATTPFKELGFDSLAAVRLRNLLNAATGLRLPSTLVFDHPNASAVAGFLDAELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Erythronolide synthase
publication title Solution structure and proposed domain domain recognition interface of an acyl carrier protein domain from a modular polyketide synthase.
pubmed doi rcsb
source organism Saccharopolyspora erythraea
total genus 22
structure length 95
sequence length 95
ec nomenclature ec 2.3.1.94: 6-deoxyerythronolide-B synthase.
pdb deposition date 2007-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ju1A00
2JU2A 4NEOA 2KGDA 4HKGA 5HVCA 2JGPA 2EHTA 2FACA 2FVAA 2K93A 5KP8B 1DV5A 4IZ6A 1T8KA 2L9FA 3LMOA 2MF4A 2KWLA 2LIWA 2CG5B 4BPHA 2KG6A 3EJBA 5CZDB 2EHSA 4R0MA 1HY8A 2K2QA 2N98A 2KOSA 1HQBA 2JQ4A 2KG8A 2MR7A 2MY5A 4BPGA 2KW2A 2AF8A 1NQ4A 3GZLA 2KGEA 2M5RA 1X3OA 2K92A 1KLPA 2K0XA 4H2XC 5KP6B 2N5HA 2KORA 2FVEA 4MRTC 2FQ0A 2MR8A 4CA3A 1L0HA 1OR5A 1AF8A 2KOQA 2JU1A 2XZ0D 4PXHB 2LOLA 2LPKA 2LKIA 2KGAA 2VSQA 3CE7A 2KOOA 2L22A 2KG9A 4PWVB 2KOPA 5KP7B 2FADA 4BPFA 2CGQA 2GDXA 2KGCA 2N6YA 2LIUA 2FAEA 2XZ1C 2CNRA 2DNWA 2K94A 2LTEA 3EJEA 2PNGA 5HV8A 2N5IA 5EJDA 2AFEA 3NY7B 2K0YA 1F80D 2MD9A 2FQ2A 3GZMA 1ACPA 2FQ1A 4H2YC 2CQ8A 2L0QA 3EJDA 1L0IA 2N6ZA 2FVFA 2MVVA 3RG2A 2GDYA 2FHSC 1VKUA 2QNWA 2AFDA 2LMLA 2AVAA 4H2WC 2GDWA 2ROQA 2X2BA 2MVUA 2N50A 1DNYA 4DG9A 2LL8A 2KR5A 2L4BA
chains in the Genus database with same CATH superfamily
1EIAA 2DGYA 2KGDA 5F2OA 3DS3A 2VLQA 1T8KA 3LMOA 2KWLA 2ERHA 3HZQA 3G1IA 3EJBA 3OW2O 2N98A 1HQBA 2GZJA 2JQ4A 5HGNA 1A43A 2KW2A 3DS2A 1Q81Q 1KC8Q 2AF8A 2BUOA 1YJWP 2K0XA 2K0DX 2PEOA 2N5HA 2FVEA 3H4EA 2MR8A 2KODA 1VQ5P 3I55P 2JU1A 2Z45A 2KGAA 3G26A 2L22A 3CCLP 1FR2A 4PWVB 1IMPA 1Q86Q 2GDXA 5DCKA 1YHQP 3EJEA 4COCA 4QKOA 3U43A 1VQ4P 4COPA 3I56P 2FQ2A 4WYMA 3DS0A 1ZNVA 4H2YC 3G4SP 1AUMA 1JJ2O 2GZIA 3EJDA 4XFZA 1L0IA 1VQOP 1NJIQ 4U0DA 2QNWA 4QNBA 2AVAA 4XFXA 2XT1A 3H0DA 4H2WC 2X2BA 2MVUA 2N50A 2M8PA 2L6EA 2Z46A 4DG9A 2QA4P 2KR5A 2L4BA 2JU2A 3G21A 4GR6A 2P9XA 2JGPA 1YJ9P 2FACA 2K93A 1DV5A 2OARA 1M1KQ 2PEIA 2KG6A 1QVGO 2E1MA 1RO0A 4R0MA 1EMVA 2M8NA 1GXGA 1K73Q 3DPHA 2Z44A 3B4QA 3CMAP 3CC4P 2OTLP 2VLNA 1M90Q 3H47A 2KGEA 4H2XC 5KP6B 1KQSO 3DTJA 2NO8A 2GZGA 1L0HA 3DS4A 4U0EA 1E6JP 4PXHB 1YIJP 2LPKA 1BAJA 3CE7A 4U0CA 2GYKA 3G1GA 2KOOA 4U0FA 2KOPA 5KP7B 1QRJA 3M1MA 3CCEP 4XFYA 1VQLP 4XROA 1VHNA 1VQKP 2XV6A 1YJNP 2LTEA 2JYLA 1VQPP 1VQ9P 5EJDA 2LF4A 2JAZA 3NY7B 1A8OA 1ACPA 5F2NA 7CEIA 1GPJA 4PH0A 2GZFA 1Q7YQ 4GR2A 5BS1A 2L0QA 1AYIA 1IUQA 2FVFA 3RG2A 2CWOA 1RNIA 3G6EP 1VQ6P 3CPWO 1DNYA 2LL8A 1CEIA 4UHPB 5KP8B 4IZ6A 2L9FA 1YITP 2LIWA 4BPHA 2CG5B 5CZDB 2EHSA 4PH1A 2KG8A 1N8RQ 1RO2A 2MY5A 4BPGA 4M0IA 5HGLA 3MGEA 2XXMA 1E0HA 2BHVA 1YI2P 3GZLA 2M5RA 2PEKA 1QVFO 1KLPA 3CCJP 4MRTC 1UJZA 1ZMBA 2OTJP 2KOQA 2XZ0D 5HGOA 2LKIA 5F2KA 2VSQA 2KG9A 1UNKA 2GZEA 1MZ8A 2CGQA 2EIAA 2KGCA 5EW5E 2N6YA 1EOQA 2FAEA 2XZ1C 2CNRA 2DNWA 1M6EX 2JO0A 2JBGA 3WBHA 1K30A 5HV8A 1K9MQ 3CCQP 2N5IA 3CCUP 2AFEA 2K0YA 1F80D 2MD9A 3CCRP 3GZMA 2PEJA 1Q82Q 2WPTA 3G71P 3CCSP 3LRYA 2N6ZA 2MVVA 2GDYA 2FHSC 3G0VA 2K5XA 2LMLA 5JPAA 2ROQA 3CXCO 2ONTA 3DS5A 3NTEA 1IMQA 1K8AQ 4NEOA 4HKGA 5HVCA 4U0AA 2VLPA 1VQNP 2EHTA 3CCVP 2FVAA 2PY8A 2QEXP 3CMEP 2MF4A 3G28A 2PEQA 1HY8A 2K2QA 2KOSA 3GJNA 2MR7A 2JYGA 1VQ8P 1GXHA 1NQ4A 1X3OA 2K92A 1Z6MA 1VQ7P 2EFJA 2KORA 5I4TG 3VRLC 2FQ0A 2PENA 4CA3A 1OR5A 1AF8A 1D1DA 2EG5A 2LOLA 4F37A 2JB0A 3CCMP 2FADA 3RG6C 4BPFA 1KD1Q 3DS1A 4IPYA 4U0BA 3CC2P 2LIUA 1W2BO 2K94A 3G29A 3B5IA 2PNGA 4XRQA 3HYBA 3Q20A 1M74A 3CD6P 2FQ1A 2VLOA 5BS2A 2CQ8A 2PEMA 1BXIA 3GKLC 3CC7P 1VQMP 1S72P 1VKUA 2AFDA 5HGMA 2GDWA 3E2DA 3P05A 2M8LA 1M6NA
chains in the Genus database with same CATH topology
2JU2A 4NEOA 2KGDA 4HKGA 5HVCA 2JGPA 2EHTA 2FACA 2FVAA 2K93A 5KP8B 1DV5A 4IZ6A 1T8KA 2L9FA 3LMOA 2MF4A 2KWLA 2LIWA 2CG5B 4BPHA 2KG6A 3EJBA 5CZDB 2EHSA 4R0MA 1HY8A 2K2QA 2N98A 2KOSA 1HQBA 2JQ4A 2KG8A 2MR7A 2MY5A 4BPGA 2KW2A 2AF8A 1NQ4A 3GZLA 2KGEA 2M5RA 1X3OA 2K92A 1KLPA 2K0XA 4H2XC 5KP6B 2N5HA 2KORA 2FVEA 4MRTC 2FQ0A 2MR8A 4CA3A 1L0HA 1OR5A 1AF8A 2KOQA 2JU1A 2XZ0D 4PXHB 2LOLA 2LPKA 2LKIA 2KGAA 2VSQA 3CE7A 2KOOA 2L22A 2KG9A 4PWVB 2KOPA 5KP7B 2FADA 4BPFA 2CGQA 2GDXA 2KGCA 2N6YA 2LIUA 2FAEA 2XZ1C 2CNRA 2DNWA 2K94A 2LTEA 3EJEA 2PNGA 5HV8A 2N5IA 5EJDA 2AFEA 3NY7B 2K0YA 1F80D 2MD9A 2FQ2A 3GZMA 1ACPA 2FQ1A 4H2YC 2CQ8A 2L0QA 3EJDA 1L0IA 2N6ZA 2FVFA 2MVVA 3RG2A 2GDYA 2FHSC 1VKUA 2QNWA 2AFDA 2LMLA 2AVAA 4H2WC 2GDWA 2ROQA 2X2BA 2MVUA 2N50A 1DNYA 4DG9A 2LL8A 2KR5A 2L4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JU2 A;  4NEO A;  2KGD A;  4HKG A;  5HVC A;  2JGP A;  2EHT A;  2FAC A;  2FVA A;  2K93 A;  5KP8 B;  1DV5 A;  4IZ6 A;  1T8K A;  2L9F A;  3LMO A;  2MF4 A;  2KWL A;  2LIW A;  2CG5 B;  4BPH A;  2KG6 A;  3EJB A;  5CZD B;  2EHS A;  4R0M A;  1HY8 A;  2K2Q A;  2N98 A;  2KOS A;  1HQB A;  2JQ4 A;  2KG8 A;  2MR7 A;  2MY5 A;  4BPG A;  2KW2 A;  2AF8 A;  1NQ4 A;  3GZL A;  2KGE A;  2M5R A;  1X3O A;  2K92 A;  1KLP A;  2K0X A;  4H2X C;  5KP6 B;  2N5H A;  2KOR A;  2FVE A;  4MRT C;  2FQ0 A;  2MR8 A;  4CA3 A;  1L0H A;  1OR5 A;  1AF8 A;  2KOQ A;  2JU1 A;  2XZ0 D;  4PXH B;  2LOL A;  2LPK A;  2LKI A;  2KGA A;  2VSQ A;  3CE7 A;  2KOO A;  2L22 A;  2KG9 A;  4PWV B;  2KOP A;  5KP7 B;  2FAD A;  4BPF A;  2CGQ A;  2GDX A;  2KGC A;  2N6Y A;  2LIU A;  2FAE A;  2XZ1 C;  2CNR A;  2DNW A;  2K94 A;  2LTE A;  3EJE A;  2PNG A;  5HV8 A;  2N5I A;  5EJD A;  2AFE A;  3NY7 B;  2K0Y A;  1F80 D;  2MD9 A;  2FQ2 A;  3GZM A;  1ACP A;  2FQ1 A;  4H2Y C;  2CQ8 A;  2L0Q A;  3EJD A;  1L0I A;  2N6Z A;  2FVF A;  2MVV A;  3RG2 A;  2GDY A;  2FHS C;  1VKU A;  2QNW A;  2AFD A;  2LML A;  2AVA A;  4H2W C;  2GDW A;  2ROQ A;  2X2B A;  2MVU A;  2N50 A;  1DNY A;  4DG9 A;  2LL8 A;  2KR5 A;  2L4B A; 
#chains in the Genus database with same CATH topology
 1EIA A;  2DGY A;  2KGD A;  5F2O A;  3DS3 A;  2VLQ A;  1T8K A;  3LMO A;  2KWL A;  2ERH A;  3HZQ A;  3G1I A;  3EJB A;  3OW2 O;  2N98 A;  1HQB A;  2GZJ A;  2JQ4 A;  5HGN A;  1A43 A;  2KW2 A;  3DS2 A;  1Q81 Q;  1KC8 Q;  2AF8 A;  2BUO A;  1YJW P;  2K0X A;  2K0D X;  2PEO A;  2N5H A;  2FVE A;  3H4E A;  2MR8 A;  2KOD A;  1VQ5 P;  3I55 P;  2JU1 A;  2Z45 A;  2KGA A;  3G26 A;  2L22 A;  3CCL P;  1FR2 A;  4PWV B;  1IMP A;  1Q86 Q;  2GDX A;  5DCK A;  1YHQ P;  3EJE A;  4COC A;  4QKO A;  3U43 A;  1VQ4 P;  4COP A;  3I56 P;  2FQ2 A;  4WYM A;  3DS0 A;  1ZNV A;  4H2Y C;  3G4S P;  1AUM A;  1JJ2 O;  2GZI A;  3EJD A;  4XFZ A;  1L0I A;  1VQO P;  1NJI Q;  4U0D A;  2QNW A;  4QNB A;  2AVA A;  4XFX A;  2XT1 A;  3H0D A;  4H2W C;  2X2B A;  2MVU A;  2N50 A;  2M8P A;  2L6E A;  2Z46 A;  4DG9 A;  2QA4 P;  2KR5 A;  2L4B A;  2JU2 A;  3G21 A;  4GR6 A;  2P9X A;  2JGP A;  1YJ9 P;  2FAC A;  2K93 A;  1DV5 A;  2OAR A;  1M1K Q;  2PEI A;  2KG6 A;  1QVG O;  2E1M A;  1RO0 A;  4R0M A;  1EMV A;  2M8N A;  1GXG A;  1K73 Q;  3DPH A;  2Z44 A;  3B4Q A;  3CMA P;  3CC4 P;  2OTL P;  2VLN A;  1M90 Q;  3H47 A;  2KGE A;  4H2X C;  5KP6 B;  1KQS O;  3DTJ A;  2NO8 A;  2GZG A;  1L0H A;  3DS4 A;  4U0E A;  1E6J P;  4PXH B;  1YIJ P;  2LPK A;  1BAJ A;  3CE7 A;  4U0C A;  2GYK A;  3G1G A;  2KOO A;  4U0F A;  2KOP A;  5KP7 B;  1QRJ A;  3M1M A;  3CCE P;  4XFY A;  1VQL P;  4XRO A;  1VHN A;  1VQK P;  2XV6 A;  1YJN P;  2LTE A;  2JYL A;  1VQP P;  1VQ9 P;  5EJD A;  2LF4 A;  2JAZ A;  3NY7 B;  1A8O A;  1ACP A;  5F2N A;  7CEI A;  1GPJ A;  4PH0 A;  2GZF A;  1Q7Y Q;  4GR2 A;  5BS1 A;  2L0Q A;  1AYI A;  1IUQ A;  2FVF A;  3RG2 A;  2CWO A;  1RNI A;  3G6E P;  1VQ6 P;  3CPW O;  1DNY A;  2LL8 A;  1CEI A;  4UHP B;  5KP8 B;  4IZ6 A;  2L9F A;  1YIT P;  2LIW A;  4BPH A;  2CG5 B;  5CZD B;  2EHS A;  4PH1 A;  2KG8 A;  1N8R Q;  1RO2 A;  2MY5 A;  4BPG A;  4M0I A;  5HGL A;  3MGE A;  2XXM A;  1E0H A;  2BHV A;  1YI2 P;  3GZL A;  2M5R A;  2PEK A;  1QVF O;  1KLP A;  3CCJ P;  4MRT C;  1UJZ A;  1ZMB A;  2OTJ P;  2KOQ A;  2XZ0 D;  5HGO A;  2LKI A;  5F2K A;  2VSQ A;  2KG9 A;  1UNK A;  2GZE A;  1MZ8 A;  2CGQ A;  2EIA A;  2KGC A;  5EW5 E;  2N6Y A;  1EOQ A;  2FAE A;  2XZ1 C;  2CNR A;  2DNW A;  1M6E X;  2JO0 A;  2JBG A;  3WBH A;  1K30 A;  5HV8 A;  1K9M Q;  3CCQ P;  2N5I A;  3CCU P;  2AFE A;  2K0Y A;  1F80 D;  2MD9 A;  3CCR P;  3GZM A;  2PEJ A;  1Q82 Q;  2WPT A;  3G71 P;  3CCS P;  3LRY A;  2N6Z A;  2MVV A;  2GDY A;  2FHS C;  3G0V A;  2K5X A;  2LML A;  5JPA A;  2ROQ A;  3CXC O;  2ONT A;  3DS5 A;  3NTE A;  1IMQ A;  1K8A Q;  4NEO A;  4HKG A;  5HVC A;  4U0A A;  2VLP A;  1VQN P;  2EHT A;  3CCV P;  2FVA A;  2PY8 A;  2QEX P;  3CME P;  2MF4 A;  3G28 A;  2PEQ A;  1HY8 A;  2K2Q A;  2KOS A;  3GJN A;  2MR7 A;  2JYG A;  1VQ8 P;  1GXH A;  1NQ4 A;  1X3O A;  2K92 A;  1Z6M A;  1VQ7 P;  2EFJ A;  2KOR A;  5I4T G;  3VRL C;  2FQ0 A;  2PEN A;  4CA3 A;  1OR5 A;  1AF8 A;  1D1D A;  2EG5 A;  2LOL A;  4F37 A;  2JB0 A;  3CCM P;  2FAD A;  3RG6 C;  4BPF A;  1KD1 Q;  3DS1 A;  4IPY A;  4U0B A;  3CC2 P;  2LIU A;  1W2B O;  2K94 A;  3G29 A;  3B5I A;  2PNG A;  4XRQ A;  3HYB A;  3Q20 A;  1M74 A;  3CD6 P;  2FQ1 A;  2VLO A;  5BS2 A;  2CQ8 A;  2PEM A;  1BXI A;  3GKL C;  3CC7 P;  1VQM P;  1S72 P;  1VKU A;  2AFD A;  5HGM A;  2GDW A;  3E2D A;  3P05 A;  2M8L A;  1M6N A; 
#chains in the Genus database with same CATH homology
 2JU2 A;  4NEO A;  2KGD A;  4HKG A;  5HVC A;  2JGP A;  2EHT A;  2FAC A;  2FVA A;  2K93 A;  5KP8 B;  1DV5 A;  4IZ6 A;  1T8K A;  2L9F A;  3LMO A;  2MF4 A;  2KWL A;  2LIW A;  2CG5 B;  4BPH A;  2KG6 A;  3EJB A;  5CZD B;  2EHS A;  4R0M A;  1HY8 A;  2K2Q A;  2N98 A;  2KOS A;  1HQB A;  2JQ4 A;  2KG8 A;  2MR7 A;  2MY5 A;  4BPG A;  2KW2 A;  2AF8 A;  1NQ4 A;  3GZL A;  2KGE A;  2M5R A;  1X3O A;  2K92 A;  1KLP A;  2K0X A;  4H2X C;  5KP6 B;  2N5H A;  2KOR A;  2FVE A;  4MRT C;  2FQ0 A;  2MR8 A;  4CA3 A;  1L0H A;  1OR5 A;  1AF8 A;  2KOQ A;  2JU1 A;  2XZ0 D;  4PXH B;  2LOL A;  2LPK A;  2LKI A;  2KGA A;  2VSQ A;  3CE7 A;  2KOO A;  2L22 A;  2KG9 A;  4PWV B;  2KOP A;  5KP7 B;  2FAD A;  4BPF A;  2CGQ A;  2GDX A;  2KGC A;  2N6Y A;  2LIU A;  2FAE A;  2XZ1 C;  2CNR A;  2DNW A;  2K94 A;  2LTE A;  3EJE A;  2PNG A;  5HV8 A;  2N5I A;  5EJD A;  2AFE A;  3NY7 B;  2K0Y A;  1F80 D;  2MD9 A;  2FQ2 A;  3GZM A;  1ACP A;  2FQ1 A;  4H2Y C;  2CQ8 A;  2L0Q A;  3EJD A;  1L0I A;  2N6Z A;  2FVF A;  2MVV A;  3RG2 A;  2GDY A;  2FHS C;  1VKU A;  2QNW A;  2AFD A;  2LML A;  2AVA A;  4H2W C;  2GDW A;  2ROQ A;  2X2B A;  2MVU A;  2N50 A;  1DNY A;  4DG9 A;  2LL8 A;  2KR5 A;  2L4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...