2L22A

Mupirocin didomain acp
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
VADDECAQFLRQSLAAMLYCEPGQIRDGSRFLELGLDSVIAAQWIREINKHYQLKIPADGIYTYPVFKAFTQWVGTQLQPTQATAAPVQREPVATAPQPGAQASAQRESIQDYLKQSLGELLFLDPGQLRSGAQFLDLGMDSVTGTQWMRGVSRHFSIQLAADAIYTWPTLKSLADEVDRRVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Mupirocin didomain Acyl Carrier Protein
publication title A conserved motif flags acyl carrier proteins for beta-branching in polyketide synthesis.
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 46
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2l22A01
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2l22A02
5KP7B 2KOSA 4NEOA 2CGQA 2EHSA 1OR5A 2L9FA 2MD9A 2MF4A 2N6ZA 2EHTA 2K94A 2JQ4A 5HV8A 2AFDA 2CG5B 2AVAA 2K92A 3GZLA 3GZMA 2QNWA 2AF8A 2PNGA 2M5RA 2FVAA 2N50A 4R0MA 1KLPA 2DNWA 1HY8A 2LTEA 2FVEA 2MR7A 4H2WC 2K93A 4BPFA 2LKIA 2GDWA 2XZ1C 2LOLA 2K0YA 2N6YA 4PXHB 2KR5A 2MVVA 4BPHA 5KP6B 3CE7A 2FAEA 2KOPA 2GDXA 2KOQA 3EJEA 1DNYA 2N5IA 2X2BA 2FQ0A 2MY5A 5CZDB 2MVUA 2CQ8A 3EJDA 2FQ2A 4HKGA 2K2QA 1X3OA 4H2XC 1L0IA 4CA3A 2LPKA 2N5HA 2JU2A 3NY7B 2JU1A 2KGEA 2L0QA 2CNRA 1VKUA 4H2YC 2KOOA 3LMOA 2LIWA 2XZ0D 2K0XA 1F80D 4IZ6A 2LIUA 2KW2A 3EJBA 1T8KA 5EJDA 2FADA 2KGCA 5KP8B 2VSQA 2MR8A 1ACPA 1DV5A 5HVCA 2KGAA 2GDYA 4MRTC 1L0HA 2LL8A 2KG9A 2FQ1A 2N98A 4PWVB 2FVFA 2KGDA 2KG8A 2FACA 2KG6A 2L4BA 2KORA 3RG2A 2FHSC 2KWLA 2L22A 4BPGA 1HQBA 4DG9A 2JGPA 2ROQA 2LMLA 1AF8A 1NQ4A 2AFEA
chains in the Genus database with same CATH superfamily
5KP7B 2KOSA 1KD1Q 3CCLP 1A8OA 5F2OA 1VQMP 2CGQA 1VQ6P 1OR5A 3DS2A 1K73Q 1EOQA 2OTLP 4XFYA 2E1MA 2MF4A 2K94A 3G21A 3G26A 4U0CA 3G28A 3CCQP 3CC7P 2ERHA 3E2DA 3GZMA 2QNWA 5I4TG 2DNWA 3CCUP 2K93A 2XZ1C 2LOLA 4QNBA 3Q20A 3CPWO 4F37A 2GDXA 2KOQA 3M1MA 5JPAA 3G6EP 1VQ8P 2FQ0A 3CC4P 5CZDB 1K9MQ 1E0HA 2MVUA 3DS1A 2FQ2A 3DS0A 4HKGA 1L0IA 4CA3A 1D1DA 4IPYA 1FR2A 2DGYA 2L0QA 2XZ0D 1EIAA 3CCVP 1GXHA 2JB0A 4GR6A 2PY8A 2Z45A 3B5IA 2BHVA 5KP8B 4XFXA 2PEIA 5HVCA 1AUMA 2GZEA 4PH0A 3G1IA 1BAJA 4U0BA 2GDYA 1EMVA 3CMEP 2KG9A 3G71P 2KG8A 2FACA 1YIJP 5HGMA 1ZNVA 3H47A 3CCEP 2JBGA 2ROQA 3WBHA 2K0DX 2GZIA 1IMPA 2JYLA 2M8LA 4XROA 1GPJA 5HV8A 1VQ5P 4U0DA 2QA4P 1KQSO 2JAZA 1W2BO 2VLNA 2K92A 1M90Q 3G29A 2AF8A 2GYKA 3HZQA 1YITP 2N50A 2VLOA 2OARA 1KLPA 1HY8A 2LTEA 2FVEA 3GJNA 4H2WC 3VRLC 2PEJA 4BPFA 2LKIA 1QRJA 1Z6MA 1M6EX 4PXHB 3CC2P 1VQ4P 2KODA 3CE7A 2FAEA 3EJEA 1M6NA 4PH1A 4QKOA 2X2BA 4XRQA 3DS3A 4UHPB 3NY7B 1UJZA 2KGEA 1VKUA 2NO8A 2KOOA 3LMOA 1M74A 1S72P 2LIWA 2K0XA 2LIUA 3EJBA 2BUOA 5EJDA 1YJNP 2VLQA 1A43A 2MR8A 1DV5A 2KGAA 2EFJA 1E6JP 4MRTC 1IMQA 2JYGA 3DPHA 2KGDA 1Q81Q 1Q7YQ 3RG2A 1QVGO 2L22A 1JJ2O 1VQOP 1NJIQ 1AF8A 3HYBA 2GZJA 3MGEA 3P05A 1VQKP 2L6EA 2EIAA 1YJ9P 2L9FA 4U0AA 5DCKA 3DS4A 2JQ4A 2AVAA 1BXIA 2WPTA 1UNKA 2FVAA 2M5RA 2P9XA 4R0MA 2MR7A 4WYMA 1RO2A 5HGNA 2K0YA 3OW2O 2N6YA 1QVFO 2KOPA 2XXMA 1GXGA 2JO0A 3H0DA 1DNYA 3G1GA 2N5IA 2CQ8A 4H2XC 3CCMP 2N5HA 2JU2A 3CCSP 2JU1A 1VQ7P 4H2YC 3B4QA 2GZGA 4U0FA 2M8PA 1F80D 2VLPA 1M1KQ 3CMAP 1VHNA 2FADA 2KGCA 2K5XA 3I56P 1CEIA 1ACPA 2PEOA 1VQ9P 3H4EA 2XT1A 1L0HA 1AYIA 1VQPP 2OTJP 2QEXP 4PWVB 1KC8Q 3G0VA 2FVFA 1RO0A 3GKLC 2PEKA 3LRYA 1YJWP 2FHSC 3I55P 4BPGA 1HQBA 2LF4A 2JGPA 7CEIA 1Q82Q 3NTEA 2PENA 3CXCO 2AFEA 1VQLP 4NEOA 2EHSA 5HGOA 1N8RQ 3DTJA 3CD6P 2MD9A 2N6ZA 2EHTA 4U0EA 3DS5A 3G4SP 2AFDA 1VQNP 2CG5B 1YI2P 3GZLA 2PNGA 2Z44A 4COCA 2GDWA 2GZFA 2EG5A 2KR5A 2MVVA 1K8AQ 4BPHA 2M8NA 5KP6B 3RG6C 1MZ8A 5HGLA 2MY5A 3EJDA 5BS1A 3CCRP 2K2QA 1X3OA 2LPKA 5BS2A 2XV6A 1Q86Q 2CNRA 4IZ6A 2CWOA 2KW2A 1T8KA 2PEMA 1RNIA 3CCJP 1K30A 2VSQA 2ONTA 1ZMBA 5F2KA 2LL8A 3U43A 2FQ1A 2N98A 1IUQA 2KG6A 2L4BA 4GR2A 2KORA 2KWLA 1YHQP 4COPA 4DG9A 5EW5E 5F2NA 2Z46A 2LMLA 4M0IA 2PEQA 4XFZA 1NQ4A
chains in the Genus database with same CATH topology
5KP7B 2KOSA 4NEOA 2CGQA 2EHSA 1OR5A 2L9FA 2MD9A 2MF4A 2N6ZA 2EHTA 2K94A 2JQ4A 5HV8A 2AFDA 2CG5B 2AVAA 2K92A 3GZLA 3GZMA 2QNWA 2AF8A 2PNGA 2M5RA 2FVAA 2N50A 4R0MA 1KLPA 2DNWA 1HY8A 2LTEA 2FVEA 2MR7A 4H2WC 2K93A 4BPFA 2LKIA 2GDWA 2XZ1C 2LOLA 2K0YA 2N6YA 4PXHB 2KR5A 2MVVA 4BPHA 5KP6B 3CE7A 2FAEA 2KOPA 2GDXA 2KOQA 3EJEA 1DNYA 2N5IA 2X2BA 2FQ0A 2MY5A 5CZDB 2MVUA 2CQ8A 3EJDA 2FQ2A 4HKGA 2K2QA 1X3OA 4H2XC 1L0IA 4CA3A 2LPKA 2N5HA 2JU2A 3NY7B 2JU1A 2KGEA 2L0QA 2CNRA 1VKUA 4H2YC 2KOOA 3LMOA 2LIWA 2XZ0D 2K0XA 1F80D 4IZ6A 2LIUA 2KW2A 3EJBA 1T8KA 5EJDA 2FADA 2KGCA 5KP8B 2VSQA 2MR8A 1ACPA 1DV5A 5HVCA 2KGAA 2GDYA 4MRTC 1L0HA 2LL8A 2KG9A 2FQ1A 2N98A 4PWVB 2FVFA 2KGDA 2KG8A 2FACA 2KG6A 2L4BA 2KORA 3RG2A 2FHSC 2KWLA 2L22A 4BPGA 1HQBA 4DG9A 2JGPA 2ROQA 2LMLA 1AF8A 1NQ4A 2AFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KP7 B;  2KOS A;  4NEO A;  2CGQ A;  2EHS A;  1OR5 A;  2L9F A;  2MD9 A;  2MF4 A;  2N6Z A;  2EHT A;  2K94 A;  2JQ4 A;  5HV8 A;  2AFD A;  2CG5 B;  2AVA A;  2K92 A;  3GZL A;  3GZM A;  2QNW A;  2AF8 A;  2PNG A;  2M5R A;  2FVA A;  2N50 A;  4R0M A;  1KLP A;  2DNW A;  1HY8 A;  2LTE A;  2FVE A;  2MR7 A;  4H2W C;  2K93 A;  4BPF A;  2LKI A;  2GDW A;  2XZ1 C;  2LOL A;  2K0Y A;  2N6Y A;  4PXH B;  2KR5 A;  2MVV A;  4BPH A;  5KP6 B;  3CE7 A;  2FAE A;  2KOP A;  2GDX A;  2KOQ A;  3EJE A;  1DNY A;  2N5I A;  2X2B A;  2FQ0 A;  2MY5 A;  5CZD B;  2MVU A;  2CQ8 A;  3EJD A;  2FQ2 A;  4HKG A;  2K2Q A;  1X3O A;  4H2X C;  1L0I A;  4CA3 A;  2LPK A;  2N5H A;  2JU2 A;  3NY7 B;  2JU1 A;  2KGE A;  2L0Q A;  2CNR A;  1VKU A;  4H2Y C;  2KOO A;  3LMO A;  2LIW A;  2XZ0 D;  2K0X A;  1F80 D;  4IZ6 A;  2LIU A;  2KW2 A;  3EJB A;  1T8K A;  5EJD A;  2FAD A;  2KGC A;  5KP8 B;  2VSQ A;  2MR8 A;  1ACP A;  1DV5 A;  5HVC A;  2KGA A;  2GDY A;  4MRT C;  1L0H A;  2LL8 A;  2KG9 A;  2FQ1 A;  2N98 A;  4PWV B;  2FVF A;  2KGD A;  2KG8 A;  2FAC A;  2KG6 A;  2L4B A;  2KOR A;  3RG2 A;  2FHS C;  2KWL A;  2L22 A;  4BPG A;  1HQB A;  4DG9 A;  2JGP A;  2ROQ A;  2LML A;  1AF8 A;  1NQ4 A;  2AFE A; 
#chains in the Genus database with same CATH topology
 5KP7 B;  2KOS A;  1KD1 Q;  3CCL P;  1A8O A;  5F2O A;  1VQM P;  2CGQ A;  1VQ6 P;  1OR5 A;  3DS2 A;  1K73 Q;  1EOQ A;  2OTL P;  4XFY A;  2E1M A;  2MF4 A;  2K94 A;  3G21 A;  3G26 A;  4U0C A;  3G28 A;  3CCQ P;  3CC7 P;  2ERH A;  3E2D A;  3GZM A;  2QNW A;  5I4T G;  2DNW A;  3CCU P;  2K93 A;  2XZ1 C;  2LOL A;  4QNB A;  3Q20 A;  3CPW O;  4F37 A;  2GDX A;  2KOQ A;  3M1M A;  5JPA A;  3G6E P;  1VQ8 P;  2FQ0 A;  3CC4 P;  5CZD B;  1K9M Q;  1E0H A;  2MVU A;  3DS1 A;  2FQ2 A;  3DS0 A;  4HKG A;  1L0I A;  4CA3 A;  1D1D A;  4IPY A;  1FR2 A;  2DGY A;  2L0Q A;  2XZ0 D;  1EIA A;  3CCV P;  1GXH A;  2JB0 A;  4GR6 A;  2PY8 A;  2Z45 A;  3B5I A;  2BHV A;  5KP8 B;  4XFX A;  2PEI A;  5HVC A;  1AUM A;  2GZE A;  4PH0 A;  3G1I A;  1BAJ A;  4U0B A;  2GDY A;  1EMV A;  3CME P;  2KG9 A;  3G71 P;  2KG8 A;  2FAC A;  1YIJ P;  5HGM A;  1ZNV A;  3H47 A;  3CCE P;  2JBG A;  2ROQ A;  3WBH A;  2K0D X;  2GZI A;  1IMP A;  2JYL A;  2M8L A;  4XRO A;  1GPJ A;  5HV8 A;  1VQ5 P;  4U0D A;  2QA4 P;  1KQS O;  2JAZ A;  1W2B O;  2VLN A;  2K92 A;  1M90 Q;  3G29 A;  2AF8 A;  2GYK A;  3HZQ A;  1YIT P;  2N50 A;  2VLO A;  2OAR A;  1KLP A;  1HY8 A;  2LTE A;  2FVE A;  3GJN A;  4H2W C;  3VRL C;  2PEJ A;  4BPF A;  2LKI A;  1QRJ A;  1Z6M A;  1M6E X;  4PXH B;  3CC2 P;  1VQ4 P;  2KOD A;  3CE7 A;  2FAE A;  3EJE A;  1M6N A;  4PH1 A;  4QKO A;  2X2B A;  4XRQ A;  3DS3 A;  4UHP B;  3NY7 B;  1UJZ A;  2KGE A;  1VKU A;  2NO8 A;  2KOO A;  3LMO A;  1M74 A;  1S72 P;  2LIW A;  2K0X A;  2LIU A;  3EJB A;  2BUO A;  5EJD A;  1YJN P;  2VLQ A;  1A43 A;  2MR8 A;  1DV5 A;  2KGA A;  2EFJ A;  1E6J P;  4MRT C;  1IMQ A;  2JYG A;  3DPH A;  2KGD A;  1Q81 Q;  1Q7Y Q;  3RG2 A;  1QVG O;  2L22 A;  1JJ2 O;  1VQO P;  1NJI Q;  1AF8 A;  3HYB A;  2GZJ A;  3MGE A;  3P05 A;  1VQK P;  2L6E A;  2EIA A;  1YJ9 P;  2L9F A;  4U0A A;  5DCK A;  3DS4 A;  2JQ4 A;  2AVA A;  1BXI A;  2WPT A;  1UNK A;  2FVA A;  2M5R A;  2P9X A;  4R0M A;  2MR7 A;  4WYM A;  1RO2 A;  5HGN A;  2K0Y A;  3OW2 O;  2N6Y A;  1QVF O;  2KOP A;  2XXM A;  1GXG A;  2JO0 A;  3H0D A;  1DNY A;  3G1G A;  2N5I A;  2CQ8 A;  4H2X C;  3CCM P;  2N5H A;  2JU2 A;  3CCS P;  2JU1 A;  1VQ7 P;  4H2Y C;  3B4Q A;  2GZG A;  4U0F A;  2M8P A;  1F80 D;  2VLP A;  1M1K Q;  3CMA P;  1VHN A;  2FAD A;  2KGC A;  2K5X A;  3I56 P;  1CEI A;  1ACP A;  2PEO A;  1VQ9 P;  3H4E A;  2XT1 A;  1L0H A;  1AYI A;  1VQP P;  2OTJ P;  2QEX P;  4PWV B;  1KC8 Q;  3G0V A;  2FVF A;  1RO0 A;  3GKL C;  2PEK A;  3LRY A;  1YJW P;  2FHS C;  3I55 P;  4BPG A;  1HQB A;  2LF4 A;  2JGP A;  7CEI A;  1Q82 Q;  3NTE A;  2PEN A;  3CXC O;  2AFE A;  1VQL P;  4NEO A;  2EHS A;  5HGO A;  1N8R Q;  3DTJ A;  3CD6 P;  2MD9 A;  2N6Z A;  2EHT A;  4U0E A;  3DS5 A;  3G4S P;  2AFD A;  1VQN P;  2CG5 B;  1YI2 P;  3GZL A;  2PNG A;  2Z44 A;  4COC A;  2GDW A;  2GZF A;  2EG5 A;  2KR5 A;  2MVV A;  1K8A Q;  4BPH A;  2M8N A;  5KP6 B;  3RG6 C;  1MZ8 A;  5HGL A;  2MY5 A;  3EJD A;  5BS1 A;  3CCR P;  2K2Q A;  1X3O A;  2LPK A;  5BS2 A;  2XV6 A;  1Q86 Q;  2CNR A;  4IZ6 A;  2CWO A;  2KW2 A;  1T8K A;  2PEM A;  1RNI A;  3CCJ P;  1K30 A;  2VSQ A;  2ONT A;  1ZMB A;  5F2K A;  2LL8 A;  3U43 A;  2FQ1 A;  2N98 A;  1IUQ A;  2KG6 A;  2L4B A;  4GR2 A;  2KOR A;  2KWL A;  1YHQ P;  4COP A;  4DG9 A;  5EW5 E;  5F2N A;  2Z46 A;  2LML A;  4M0I A;  2PEQ A;  4XFZ A;  1NQ4 A; 
#chains in the Genus database with same CATH homology
 5KP7 B;  2KOS A;  4NEO A;  2CGQ A;  2EHS A;  1OR5 A;  2L9F A;  2MD9 A;  2MF4 A;  2N6Z A;  2EHT A;  2K94 A;  2JQ4 A;  5HV8 A;  2AFD A;  2CG5 B;  2AVA A;  2K92 A;  3GZL A;  3GZM A;  2QNW A;  2AF8 A;  2PNG A;  2M5R A;  2FVA A;  2N50 A;  4R0M A;  1KLP A;  2DNW A;  1HY8 A;  2LTE A;  2FVE A;  2MR7 A;  4H2W C;  2K93 A;  4BPF A;  2LKI A;  2GDW A;  2XZ1 C;  2LOL A;  2K0Y A;  2N6Y A;  4PXH B;  2KR5 A;  2MVV A;  4BPH A;  5KP6 B;  3CE7 A;  2FAE A;  2KOP A;  2GDX A;  2KOQ A;  3EJE A;  1DNY A;  2N5I A;  2X2B A;  2FQ0 A;  2MY5 A;  5CZD B;  2MVU A;  2CQ8 A;  3EJD A;  2FQ2 A;  4HKG A;  2K2Q A;  1X3O A;  4H2X C;  1L0I A;  4CA3 A;  2LPK A;  2N5H A;  2JU2 A;  3NY7 B;  2JU1 A;  2KGE A;  2L0Q A;  2CNR A;  1VKU A;  4H2Y C;  2KOO A;  3LMO A;  2LIW A;  2XZ0 D;  2K0X A;  1F80 D;  4IZ6 A;  2LIU A;  2KW2 A;  3EJB A;  1T8K A;  5EJD A;  2FAD A;  2KGC A;  5KP8 B;  2VSQ A;  2MR8 A;  1ACP A;  1DV5 A;  5HVC A;  2KGA A;  2GDY A;  4MRT C;  1L0H A;  2LL8 A;  2KG9 A;  2FQ1 A;  2N98 A;  4PWV B;  2FVF A;  2KGD A;  2KG8 A;  2FAC A;  2KG6 A;  2L4B A;  2KOR A;  3RG2 A;  2FHS C;  2KWL A;  2L22 A;  4BPG A;  1HQB A;  4DG9 A;  2JGP A;  2ROQ A;  2LML A;  1AF8 A;  1NQ4 A;  2AFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...