1VQ7P

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq7P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq7P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq7P02
3OW2O 1QVGO 1W2BO 3G71P 1Q81Q 1VQNP 3CCEP 3CCVP 3CCLP 3CD6P 1Q82Q 1Q7YQ 2QEXP 1YJWP 1NJIQ 1KQSO 1VQ8P 3G6EP 3CPWO 1M90Q 1VQ9P 3CCQP 3CC4P 3CC2P 1VQ6P 2OTLP 2OTJP 3I56P 1K9MQ 3CC7P 1VQ4P 3G4SP 3CCSP 3CCUP 1N8RQ 1M1KQ 1KC8Q 1VQ7P 1VQOP 1VQKP 3I55P 1VQLP 1VQ5P 1YI2P 1VQPP 1YHQP 1KD1Q 1K73Q 3CCJP 1S72P 1YJNP 1Q86Q 2QA4P 1YITP 3CMEP 1QVFO 1YJ9P 1VQMP 3CMAP 1YIJP 3CCRP 1K8AQ 3CCMP 1JJ2O 3CXCO
chains in the Genus database with same CATH superfamily
1WT6A 3PHLA 3LIEA 1EOQA 1KYOH 1KTMA 2Z46A 1SQQE 4IFFA 4XA4A 3G26A 1BGYD 3L73E 1GTWA 3HUSC 1KZUB 1ZR4A 3B5NB 1VQ7P 3FWNA 4H2WC 5AW9B 1SQXJ 1EC5A 1OVUA 2Q5UA 2KI7B 4XROA 4PV1B 2M5RA 1NTME 1JY3O 4A7PA 1YTZT 1FZCB 1J1DC 4M0IA 1PZQA 1H8AA 1SQVK 4N78D 4UHPB 1S3JA 1X22A 1GDTA 2LXBA 5C39A 3L74D 3RL0C 3B8EB 5APTA 1SQVG 2L91A 1X8YA 4OGQB 4UB8H 2HR3A 1ZMBA 2YMYA 3AEBC 1QGKB 3CPWO 5HGOA 5AW8B 3TSIA 1N7SB 3H1HE 5CCHA 3CX5E 2IZ0A 2BHVA 1DNYA 3CXHI 4D6TG 1SQQJ 1Z56A 2IYPA 2KSJA 3L73J 5HGNA 1RF0A 4XFYA 2A45G 3L75J 2MR7A 2MKVA 4JYCA 3AECC 3MGNA 1NTKD 3GKLC 1EDJA 2IFNA 3Q5RA 2KG9A 1KQLA 2V4HA 4HYTB 1KYOE 4GOFA 1KORA 3TGUD 1IMQA 3P05A 5AVSB 2Y0EA 1NHLA 2W83C 1NAYA 2WSCH 1GZLA 3VMYA 2QRXA 1S2EA 1LGHB 1LTIC 2DW3A 4WY4A 3HD7B 1EIAA 3NXSA 1AQ5A 2FVEA 4PXHB 1CZQA 3H1HJ 1IUQA 2YIUC 3H0DA 3C9IA 4COPA 4U3FJ 2KXPB 1PPJE 2A06G 2WSFH 2V7QH 2B88A 2GZJA 2K0DX 1R5LA 1ZP0C 1OFCX 3FGAD 3U43A 1S72P 4YPCA 2ZXEB 5TJHA 4OWFA 4OVNF 2WSSH 1OVVA 4ZMDA 2N1TB 3AE9C 3H1KJ 1NU1K 2YO2A 2J59M 1NJIQ 1YJWP 1S9KD 3CWBE 1P84E 1S5LE 1NOHA 5CBOA 4DT0A 3VTPC 1JUNA 2AXTH 1NU1G 2X2BA 3VMAA 2KLVA 3HE5A 5BU5A 2K9JB 1E0HA 4IZ6A 3HZQA 3L71D 3H1JG 2XNDH 5KLVJ 5BS1A 2YMKA 3K5BA 3O8ZA 3AE5C 2W6BA 1Q2NA 3P8MC 2ZYDA 4ASWA 2GZEA 1FZGA 1FDIA 2XKMA 1PV3A 3H1IG 1W2BO 1FE6A 1VF5B 3WUTA 4WY4D 5CCHC 3KPEA 2N5HA 1KC8Q 3Q3DA 3F89A 3G1IA 4GT1A 3BCCJ 2PNGA 3L70D 1RF0C 1DH3A 1JCCA 4HKZH 5APSA 2FXMA 1VHNA 5APWA 2E5TA 2ZXXA 1BCCE 3CCUP 4NPFX 1NTZK 1LT9B 4Y99C 2PAJA 1SP4A 2FFDA 3CCJP 2WSCJ 1FZEA 2IZ1A 2AXTE 2FACA 4QKOA 4KT0J 1CI6B 1NTZG 1NVOA 4YXDC 4WY4C 1ZLLA 2OGUA 4AUWA 1GD2E 1BE3G 4JBZA 3WU2E 1JM0A 3WUUA 1Y47A 3G0VA 3NTEA 3RK3D 3CMEP 3AEFC 2OTKE 5KP8B 1Q90D 4HJGH 2RN0A 1ACPA 2WSFJ 1M6NA 1NYHA 4CPGA 2V7QJ 4IOIH 2P10A 1L4AA 1M57D 1N73A 3CCSP 2PEKA 3JSVC 4H0LD 5B5EH 1Y8AA 2DNWA 1L0LJ 2KS1B 2K88A 2Y0DA 1QLED 3P8CE 2KOOA 2YXRB 1USEA 3CXCO 1PEQA 2VSQA 3G28A 3L72J 4H13D 1M8OB 2PEQA 3H32A 1KQGB 1ZV8A 2R3CA 1AFOA 5AW2B 1JOCA 3AE1C 3D6YA 1BGYE 2KGDA 1FOSE 3A0BH 5KKZC 3TNUA 3VYIA 3WUVA 5L8RJ 3B4QA 4HH2A 2JR8A 2E74B 4HB1A 5AVVB 4PD4I 2JDIH 1RO2A 3WBHA 2FYUG 3IFMA 4N78E 3SWYA 1PGOA 4I6MC 2ZYAA 1SQPK 2M3EA 4JF7A 4XRQA 4TT3H 1AUMA 5DJTB 1NU1D 4XE5B 2L5GB 2E75B 1SQPG 1FDMA 2M3BA 4W7ZA 2BCCE 3SFDC 2KORA 3R2PA 5CJ0A 3KXDA 2JU2A 1XTCC 5HV8A 1KILA 3RK2C 1GL2D 1VDFA 1BGYJ 5B5EE 5AW7B 1NWQA 1J1EB 1NO4A 2FXOA 3CWBD 5KJ7A 1GPJA 2K93A 3H1ID 1NTKE 1ZRTE 3A3YB 2JYLA 4DZOA 1JY2O 2B87A 2ZJSE 3DS5A 2FFDC 2N50A 4B86A 1M7LA 1YJ9P 1G2CB 3A0BE 2Z5HA 2J58A 1LTSC 4EDFA 1EZVG 1L0NG 3OJAB 3H1LG 2WT7A 2UWJE 2M0BA 3L74J 2MD9A 2M8PA 3DPHA 5I4TG 4DCKA 1KN7A 3E7KA 2Q9IA 3VP8A 1L0HA 3NMDA 5GTIH 2W27A 4EOTA 2Y9ZA 1HUCA 1GMJA 1PP9E 1R8EA 2EHTA 1OWAA 2LPKA 2XU6A 3V6IA 4C7NA 2HYNA 2GDWA 1SQBJ 4C7NB 1RF1B 2H8PD 4BRYB 2AEMA 1A8OA 1M90Q 2GZIA 2MVUA 2ZFCA 5AVXB 2R44A 1L4AC 1N73C 3CLQA 2E76D 5GTHH 2JP3A 2HPCB 1KD1Q 2JO1A 2K92A 1LP1A 3BRTB 4K3AA 2DGYA 4H2YC 1BE3D 1IFDA 3MP7B 1NTKJ 1SFCA 1JB0J 3TYYA 1FJPA 3V4QA 1MFZA 1H88A 1BCCD 2N98A 1CW5A 3TGUJ 1S9KE 2Z5IA 1LJ2A 2C0XA 2LF4A 3H25A 5AW6B 2IFMA 1VPCA 1Q86Q 1KMIZ 3L35A 3Q1MA 1JJ2O 2NPSA 1KILD 2KUBA 3L71E 4AQRD 2KOSA 5KAFH 4H2XC 1ZNVA 1M6EX 3BATA 2OYHA 2GUSA 3ABVC 3W67A 5F2OA 2OYHB 1OVRA 2QVAA 1HVVA 4RKUJ 3VOPA 4K35A 2HLOA 2CNRA 2FVFA 3CX5H 3IAOA 2EHSA 2OQQA 3M1MA 4PJ0H 1KV4A 4PWVB 3IF4A 1JTHB 1RQUA 2HODA 1JMMA 3HE4A 3PRJA 5KP6B 1VQMP 3RL0D 4RJTA 1KILC 4COCA 1RHZB 3W68A 2WWWA 3EQ2A 2KP8A 2KZJA 5KJ7C 1SQVE 3RGUA 2Y0CA 1EDLA 2QM8A 2FQ1A 1LTAC 4U0EA 2G3AA 3B5NA 1SQXG 1DD4A 2SPZA 1SLQA 1AV1A 2VLQA 3AE6C 3L71J 2JWDA 1T8ZA 2LL8A 3CCMP 2QJYC 1FZCA 4IFMA 2P2UA 1S4XA 1SFCD 2POHA 2K2QA 3CC2P 3EFFK 4D6TE 2LOLA 1IFNA 3OA7A 2E43A 3G4SP 1NAFA 1HJBA 1AVYA 5KAFE 3G9RA 4O9BA 2PEJA 1FZAA 1XTGB 1LWUA 3EWKA 1NKZB 3RK3E 1LWUB 2MF4A 2N5IA 3H47A 1ZXGA 2BCCD 4RO0A 1N7SA 1G1IA 1EZVD 1EXIA 4GR6A 1SS1A 3L70J 3L73G 4PJ0E 2KOQA 3L75G 4TLFA 1GK4A 1MZ9A 2N6ZA 2C0WA 1IFMA 1GW3A 2Q7CA 3D70A 1SFCC 1P84H 3PLNA 1S5LH 4Z1MH 3GF7A 1ZRTD 4IL6E 2OYIB 1FR2A 3KDPB 1UNKA 2VLNA 1NTMJ 1KQFB 2MJZA 2M8NA 2IBZI 1YIJP 2A06E 1N7LA 2OARA 4F37A 3G71P 2NPSC 4BXLA 3H4EA 3HD7A 3A7OA 4N6JA 2JJLA 2KB7P 2FHSC 1PP9D 2IX7C 1VQ5P 1K04A 2OYHC 1KB9I 1K8AQ 1VKUA 3HYBA 4U3FG 4NEOA 1NU1E 2QEXP 5APUA 3FXDA 2PENA 2BEZF 2CGQA 2KZIA 1W5CE 3ITKA 3S4RA 2K3RA 4L73A 1M1JB 3HRNA 2EIAA 1RE4A 1YI2P 3H1JE 5HGMA 1AVOA 1DX7A 2E5YA 5B66H 3H1KG 4L75A 2PFXA 2N1TA 2WPVB 4RESB 4ZKUA 1VQ8P 3GHGB 2P9XA 1GK6A 4MN4C 1BDCA 1JY3P 1VQ4P 1FAVA 2D2CB 5EJDA 1HWTC 1IFPA 1N8RQ 4WYMA 3H1IE 4H44B 1VQOP 1IK9A 3B5NC 5CCHD 1TU3F 2CPBA 5AVUB 1GW4A 2MR8A 3B71A 4PV1C 2K9JA 3HTKB 4C7RA 5KLIB 1FZCC 2WVRA 5KLVG 1DEEG 3EFGA 5BS2A 2OTLP 5E79E 3CX5I 3WU2H 1FU1A 1LTJB 3RBZA 1PPJG 2G8YA 1NU1J 4GDOA 2QJKB 3CXHD 5KTBA 1LTTC 1U7MA 4LGDE 4OGQC 1UIXA 1LWUC 3GMAA 1N86A 3SSUA 3G6EP 2AF8A 1URQB 1KYOI 1RY3A 1N7SC 1OZHA 2QIWA 4H0LB 2JEEA 2OYOA 3MUDA 1NTZE 2VRSA 3BCCG 1AF8A 1YJNP 2I8DA 1LT1A 3CWBJ 1IK7A 3KHUA 1BE3E 2AXCA 1SQVD 5B66E 3QH9A 4DG9A 2GZGA 1ZN5A 3DS4A 1LT9A 2WPTA 2KGCA 1CI6A 3MTUE 1Q82Q 4D6TD 1GXGA 1KILE 1QL2A 3FXEA 2HFED 3HD7C 2P67A 5HVCA 3B5IA 5K5GB 3SWKA 1FC2C 2RKLA 4JYBA 1Q81Q 3M9QA 1P84I 1L0LK 2JWAA 1IJDB 3M06A 4WVZA 3NFQA 1JY2N 4WB4A 2WITA 4U7JA 1UJZA 1YTZI 4GR2A 1L0LG 2Q3EA 1GL2B 1RE4C 3P32A 2KS1A 4XFXA 4U0DA 3L72G 1BCCJ 2N1TC 1HGVA 2KLUA 1RE3A 2KOPA 2ONTA 1S1CX 1VF5D 2D2CC 2CK3H 2JQ4A 3U1CA 3TDKA 4H44C 1PFIA 2QJPB 4QMAA 3SWFA 4I7ZB 1SQPE 2WPSA 2A06D 2LIUA 1F80D 2O3JA 2FYUK 2KK7A 1RQVA 5KLIC 3R4YA 5KAIH 3RK2D 2M8LA 1VQ6P 1BSNA 1OW6A 1SVFA 2M8RA 5AVZB 1YHQP 3AEEC 1U7JA 1X79B 1QX8A 2O01J 2YXQB 1DD3A 1QVGO 3P7KA 3V4WA 2NRGA 2BEQD 1K30A 1VF5C 2E76B 2WSEH 2L4BA 1MFTA 3JCUH 3H1JD 1EZVE 2LKIA 3MUDC 2YNYA 3H1LE 4IPYA 2JU1A 1OW7A 2L9FA 1BGYG 1D1DA 1M56D 1S5LX 1M74A 1RNIA 2I1JA 3A5TA 5AW4B 3EJEA 1LTBC 3LIDA 4BPFA 1LT9C 1VQKP 1L0NK 2ZT9B 2O1JA 1L4AD 2XXMA 1K73Q 1QRJA 1G2CA 4EI2A 2QNWA 1D7MA 2KIKA 3FWLA 3CMAP 3BASA 4GOEA 3AEGC 1OX3A 3L74G 2W8ZA 3MGEA 2ZYGA 3AE3C 2W6JH 1SQBK 3HUSB 5KAIE 3E2DA 1HF9A 3IR9A 3VMZA 4W7YA 1AJYA 3CXHH 2KW2A 3M9HA 3GZLA 2Q3IA 5F2KA 1SQBG 5AVQB 2LTEA 2BCCJ 2LKMA 1RF1A 3GG2A 4BRYA 1J1DB 1L2PA 5AVTB 1R5SA 2WMMA 2FBWC 3USSA 1NTZD 2WPQA 3AEDC 3GW6A 3GLMA 3Q5SA 3RL0B 2HPCA 1YYCA 2PY8A 5CMZA 4L76A 3JCUE 3MIWA 1T2KC 4DOJA 4PD4D 2RMZA 2M5AB 3TGUG 1RE3C 5APYA 5H2FH 4ZKPA 1BSHA 1HQBA 1WRGA 3EJBA 1VQLP 4I7ZC 2B9BA 1H89A 2KNCB 1WMKA 5EFWB 1EDKA 2E74C 2ZVOB 3KYQA 5CHXA 2K37A 2YKOA 4I2LC 2QE7H 3FX0A 5M1BA 3V5BA 1PP9J 2A45H 2LXCB 3L72D 5KJ7D 2XZRA 3MD0A 2N9BA 1ZMEC 4KJMA 1K05A 2C9NY 2K0XA 3CXHE 1FS0E 2PEOA 2E75C 2WSEJ 1H0TB 3LMOA 2C9LY 7CEIA 3O6QB 4U0AA 4R4MA 4I1LA 1JTHA 3EJDA 2N6YA 2RH0A 3A0HE 1UIIA 3VP9A 2FYUD 3S9OA 2R5BA 3VN0A 1EQ7A 2YIUB 2AEFA 3KQGA 4GKGA 1IZNB 1JEKA 3L37A 4IL6H 4R0MA 1J1EC 3M0AA 2FQ2A 1SQXK 3M0DA 3I5CA 3CC4P 3S1KA 4WBAA 2FAEA 1BAJA 1PGPA 2KGEA 1SQPD 2HG5D 4C46A 1YQ3C 1JMBA 5H2FE 2PEMA 3V2NA 4Y28J 1KB9E 3VRLC 1MV8A 1YBKA 2PGDA 2NZ2A 1MKMA 3MZWB 3L75E 2IBZG 2EFJA 3PTZA 2KODA 2PRRA 1QEXA 2AFEA 1AQTA 5AW3B 1YQ4C 2XNXA 1EDIA 3NY7B 2LR2A 1RF1C 1VQNP 1PEMA 3CD6P 1SQQK 2XZ1C 1MUUA 3V2PA 3RG2A 2NPSD 1IMPA 4PH1A 3G3ZA 3L70G 2Z45A 5CCGA 1L0ND 2KOGA 3SFEC 3H1LD 1OIPA 2FVAA 1SQQG 2W6AA 3RG6C 2QA4P 4WWIA 1SQVJ 1NTMK 1E79H 1PGJA 2AVAA 1SQBD 3IN6A 3Q5PA 4MRTC 2XDJA 2OTJP 5EW5E 1NTMG 1GU4A 2P58A 2OYIA 2Z44A 2H43A 4U3FE 3GZMA 3L4FA 1T8KA 2Y9YA 1JNMA 5TISH 1FZFA 4D6TJ 1ZW0A 2MY5A 5BVZA 3KZIH 5E79H 1HBWA 2Z4EA 3PP5A 1HY8A 3I56P 2K1AA 1NH4A 2XV6A 2FADA 3H1KE 1FJKA 4U0CA 4Y99B 5KP7B 3U1AA 3BRVB 2WPRA 1W2EA 3H1HG 3B5ND 3D71A 1G1JA 2VLPA 4PV1D 1PL5A 4WY4B 3E1IA 3AE4C 2AEJA 2PP6A 3CL3D 3PH0A 2K94A 1M1JA 1GU5A 4IFDK 3L36A 5KLVE 1BXIA 2EG5A 2GA1A 2VLOA 1VL2A 2K5XA 3GJNA 1IC2A 1QL1A 3E1RA 4PD4H 3CI9A 2IPPA 1DEBA 4OGQD 4UB8E 1Q7YQ 3M0DC 3GHGA 4JQ0D 2A45I 2PEIA 3CC7P 4EIJA 3RBXA 1N7SD 5CZDB 3AE7C 5APQA 2KG8A 1NKNA 2E42A 3LRYA 5CCGD 5KLVK 2WTYA 1LTGC 1HJ0A 3NTNA 3HTKA 2L6EA 2YKPA 1CEIA 3CCEP 3CCVP 1KLPA 3T97A 1A02J 1KQSO 2P7JA 5TISE 3T97B 3BCCE 3BVHA 5AW5B 1ZR2A 3KZIE 4U0BA 1LTJA 1KFNA 2YO3A 4NPDA 5KKZB 3RK3B 2NO8A 2I1KA 1OW8A 1N2DC 3AE8C 3HE5B 3G21A 2JGPA 4BWNA 1SQXD 3Q20A 2O01H 1T3UA 1LNQA 1URQA 3H1JJ 1T3JA 1DIPA 5CCGC 1FOSF 3DTJA 5F2NA 3HD7D 3CWBG 4OH8B 1MZ8A 2IBZD 4H13B 3G29A 3OW2O 3MHVA 4YTPC 4R4LA 2BQ1E 3H1IJ 4PD4E 5JPAA 2L0QA 4QNBA 5DCKA 2OYIC 4W80A 3DS0A 4KHXA 3RL0g 3DS1A 1JCDA 1DV5A 3RK2B 1KB9D 1SQQD 3L73D 2L22A 1L0LE 1RO0A 2N1TD 3L75D 2GYKA 1E6JP 2E1MA 2GM4A 3L72E 3TF5A 2AFDA 1X0TA 2QG4A 2D2CD 1CSBA 2FFDB 2IYOA 1NTMD 4H44D 3M91A 3QWOC 4AYCA 5HGLA 1GXHA 1NTZJ 1HH0A 4BPHA 1T6AA 1M1KQ 1M1JC 1BE3J 1GL2A 1VQPP 4DJGA 1KFMA 3VMXA 1BCCG 1EXJA 5DJUB 2FYUE 4IL6X 3DS3A 5APXA 3F5HA 2R32A 3H1HD 3DS2A 4JPZB 3N7NA 3GHGC 3GF3A 3CX5D 2CG5B 2J5UA 4U3FD 1L4AB 2JB0A 1RH5B 1URQD 1N73B 1AYIA 4YXWH 2WZ7A 3V2RA 2P1JA 1HTLC 1IO4A 3CCLP 3H32B 1Y9BA 2ZAEB 3G1GA 4M3LA 1VQ9P 1KYOD 3H1KD 5AW1B 1LTJC 3B4SA 2ERHA 2KR5A 4GIFA 3RK3C 1JO5A 3TNUB 2QJKC 5AW0B 1YITP 2FYNB 3CCRP 2CQ8A 1EMVA 2XZ0D 2LMLA 1USDA 1OR5A 5BU8B 4GODA 2IDBA 5AVRB 1Z6MA 2MVVA 5APVA 1URQC 2ZVNB 4H0LC 2FYUJ 5KLVD 2KG6A 3L74E 1L0NE 2CPSA 4H13C 2CWOA 1PPJD 3H6PA 3C8VA 3A2AA 1SQPJ 1SQBE 3ZDMA 3M9BA 2K9YA 2YKQA 3LW5H 2JBGA 3CE7A 1KILB 3D6ZA 2Q6QA 2ITAA 4CA3A 3BCCD 1P84D 1T2KD 1IFJA 2H7HA 4LC1A 3HUSA 1U57A 1OMIA 2KSEA 1ZOYC 1OXZA 2B87B 3TGUE 1HGZA 2K0YA 2BCCG 1E5WA 2QJYB 2H89C 4UB6H 2E74D 2WT7B 1L0NJ 2FQ0A 3CCQP 3H1LJ 1K9MQ 1NTKK 2GZFA 1X9VA 3A0HH 3AE2C 1GL2C 1NQ4A 3WMM0 4ASVA 5AVYB 2O1KA 4N3YB 1QVFO 1NTKG 5CJ4A 2FXPA 2ROQA 2WQYC 2QSIA 2M5AA 4ZNCA 4XFJA 2JO0A 2E75D 3PJSK 4U0FA 4HKGA 1PEUA 2N9YB 2JKVA 1FDOA 2KWLA 2R3SA 2QJPC 2GDXA 1JY3N 1KB9H 2KNCA 1LP1B 4L74A 1FBMA 1SFCB 1PIXA 1L0LD 1PP9G 3Q2YA 2KYVA 4NPEA 1X3OA 3N4XA 3C1LA 1EZVI 2JYGA 1L0IA 4LLHA 2BUOA 2GDYA 4EYYQ 3II6A 3UIAA 2JAZA 2XT1A 2FYNC 2B89A 2ZT9D 2Q1KA 5AVWB 1NGMB 2NPSB 1PGQA 1IFIA 1H0TA 1SQXE 2FKWB 1BDDA 2E76C 1A43A 3U59A 3O6QA 2KGAA 4UB6E 1J2JB 3TK1A 3OAKA 2FYZA 5CBNA 1PEOA 3I55P 2FY8A 5GTIE 2O01N 4PH0A 2H88C 3JC22 2LIWA 2BASA 2IBZE 4XFZA 2XV5A 2R5DA 1JY2P 1AA0A 3V2QA 2W90A 1A02F 2HODB 2ZT9C 3LW5J 3AEAC 2QM7A 3HE4B 3L71G 3P8CD 2GUVA 1FZBA 5GTHE 4BPGA 3L70E
chains in the Genus database with same CATH topology
1PEQA 1W2BO 3G28A 1Q81Q 1VQNP 1PEMA 2PEQA 1EOQA 3CD6P 1M74A 1Q7YQ 1RNIA 2Z46A 2JO0A 1RO0A 5BS2A 3G26A 1E6JP 2M8PA 3DPHA 5I4TG 2OTLP 2PEIA 4PH1A 3M1MA 4U0FA 3CC7P 2E1MA 1PEUA 1EIAA 2Z45A 1KC8Q 1VQ7P 4GR2A 1VQKP 3LRYA 3G1IA 2XXMA 1K73Q 3RG6C 2M8NA 2QA4P 1QRJA 1VQMP 4XFXA 1YIJP 4XROA 4U0DA 2CWOA 5HGLA 2OARA 4COCA 3CMAP 1IUQA 2L6EA 3H0DA 2PEOA 3G71P 4COPA 1RO2A 3CCEP 3CCVP 1A8OA 1KQSO 3H4EA 4M0IA 3MGEA 3G6EP 1M90Q 3WBHA 2OTJP 4U0BA 2ONTA 3E2DA 4U0AA 2JYGA 2Z44A 2BUOA 3CCUP 1M1KQ 4U0EA 1VQ5P 1VQPP 1KD1Q 3CCJP 1S72P 4XRQA 1YJNP 2XT1A 5F2KA 2DGYA 1AUMA 1K8AQ 3G21A 3HYBA 3CCMP 3DS3A 1ZMBA 3Q20A 1NJIQ 2QEXP 1YJWP 3CPWO 3DS2A 5HGOA 2M8LA 3CC4P 1VQ6P 2PENA 3CC2P 1A43A 3I56P 2XV6A 3G4SP 1BAJA 2LF4A 4U0CA 3DS4A 3DTJA 1PEOA 5F2NA 2BHVA 3I55P 2EIAA 1YI2P 1YHQP 2PY8A 3G0VA 5HGMA 1Q86Q 3NTEA 2PEMA 4PH0A 3CMEP 2PEJA 5HGNA 4XFYA 1JJ2O 3G29A 4XFZA 3VRLC 3OW2O 1QVGO 3HZQA 3CCLP 1Q82Q 3H47A 1M6NA 2BQ1E 1K30A 1VQ8P 3G1GA 1VQ9P 3CCQP 2P9XA 5BS1A 1K9MQ 5JPAA 4QNBA 1VQ4P 2EFJA 5DCKA 2JYLA 2KODA 4GR6A 3CCSP 4WYMA 3DS0A 1N8RQ 2PEKA 1VQOP 1VQLP 1M6EX 3B5IA 3DS1A 2EG5A 3P05A 4IPYA 3DS5A 1YITP 1D1DA 1QVFO 1YJ9P 5F2OA 3CCRP 3CXCO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 O;  1QVG O;  1W2B O;  3G71 P;  1Q81 Q;  1VQN P;  3CCE P;  3CCV P;  3CCL P;  3CD6 P;  1Q82 Q;  1Q7Y Q;  2QEX P;  1YJW P;  1NJI Q;  1KQS O;  1VQ8 P;  3G6E P;  3CPW O;  1M90 Q;  1VQ9 P;  3CCQ P;  3CC4 P;  3CC2 P;  1VQ6 P;  2OTL P;  2OTJ P;  3I56 P;  1K9M Q;  3CC7 P;  1VQ4 P;  3G4S P;  3CCS P;  3CCU P;  1N8R Q;  1M1K Q;  1KC8 Q;  1VQ7 P;  1VQO P;  1VQK P;  3I55 P;  1VQL P;  1VQ5 P;  1YI2 P;  1VQP P;  1YHQ P;  1KD1 Q;  1K73 Q;  3CCJ P;  1S72 P;  1YJN P;  1Q86 Q;  2QA4 P;  1YIT P;  3CME P;  1QVF O;  1YJ9 P;  1VQM P;  3CMA P;  1YIJ P;  3CCR P;  1K8A Q;  3CCM P;  1JJ2 O;  3CXC O; 
#chains in the Genus database with same CATH topology
 1WT6 A;  3PHL A;  3LIE A;  1EOQ A;  1KYO H;  1KTM A;  2Z46 A;  1SQQ E;  4IFF A;  4XA4 A;  3G26 A;  1BGY D;  3L73 E;  1GTW A;  3HUS C;  1KZU B;  1ZR4 A;  3B5N B;  1VQ7 P;  3FWN A;  4H2W C;  5AW9 B;  1SQX J;  1EC5 A;  1OVU A;  2Q5U A;  2KI7 B;  4XRO A;  4PV1 B;  2M5R A;  1NTM E;  1JY3 O;  4A7P A;  1YTZ T;  1FZC B;  1J1D C;  4M0I A;  1PZQ A;  1H8A A;  1SQV K;  4N78 D;  4UHP B;  1S3J A;  1X22 A;  1GDT A;  2LXB A;  5C39 A;  3L74 D;  3RL0 C;  3B8E B;  5APT A;  1SQV G;  2L91 A;  1X8Y A;  4OGQ B;  4UB8 H;  2HR3 A;  1ZMB A;  2YMY A;  3AEB C;  1QGK B;  3CPW O;  5HGO A;  5AW8 B;  3TSI A;  1N7S B;  3H1H E;  5CCH A;  3CX5 E;  2IZ0 A;  2BHV A;  1DNY A;  3CXH I;  4D6T G;  1SQQ J;  1Z56 A;  2IYP A;  2KSJ A;  3L73 J;  5HGN A;  1RF0 A;  4XFY A;  2A45 G;  3L75 J;  2MR7 A;  2MKV A;  4JYC A;  3AEC C;  3MGN A;  1NTK D;  3GKL C;  1EDJ A;  2IFN A;  3Q5R A;  2KG9 A;  1KQL A;  2V4H A;  4HYT B;  1KYO E;  4GOF A;  1KOR A;  3TGU D;  1IMQ A;  3P05 A;  5AVS B;  2Y0E A;  1NHL A;  2W83 C;  1NAY A;  2WSC H;  1GZL A;  3VMY A;  2QRX A;  1S2E A;  1LGH B;  1LTI C;  2DW3 A;  4WY4 A;  3HD7 B;  1EIA A;  3NXS A;  1AQ5 A;  2FVE A;  4PXH B;  1CZQ A;  3H1H J;  1IUQ A;  2YIU C;  3H0D A;  3C9I A;  4COP A;  4U3F J;  2KXP B;  1PPJ E;  2A06 G;  2WSF H;  2V7Q H;  2B88 A;  2GZJ A;  2K0D X;  1R5L A;  1ZP0 C;  1OFC X;  3FGA D;  3U43 A;  1S72 P;  4YPC A;  2ZXE B;  5TJH A;  4OWF A;  4OVN F;  2WSS H;  1OVV A;  4ZMD A;  2N1T B;  3AE9 C;  3H1K J;  1NU1 K;  2YO2 A;  2J59 M;  1NJI Q;  1YJW P;  1S9K D;  3CWB E;  1P84 E;  1S5L E;  1NOH A;  5CBO A;  4DT0 A;  3VTP C;  1JUN A;  2AXT H;  1NU1 G;  2X2B A;  3VMA A;  2KLV A;  3HE5 A;  5BU5 A;  2K9J B;  1E0H A;  4IZ6 A;  3HZQ A;  3L71 D;  3H1J G;  2XND H;  5KLV J;  5BS1 A;  2YMK A;  3K5B A;  3O8Z A;  3AE5 C;  2W6B A;  1Q2N A;  3P8M C;  2ZYD A;  4ASW A;  2GZE A;  1FZG A;  1FDI A;  2XKM A;  1PV3 A;  3H1I G;  1W2B O;  1FE6 A;  1VF5 B;  3WUT A;  4WY4 D;  5CCH C;  3KPE A;  2N5H A;  1KC8 Q;  3Q3D A;  3F89 A;  3G1I A;  4GT1 A;  3BCC J;  2PNG A;  3L70 D;  1RF0 C;  1DH3 A;  1JCC A;  4HKZ H;  5APS A;  2FXM A;  1VHN A;  5APW A;  2E5T A;  2ZXX A;  1BCC E;  3CCU P;  4NPF X;  1NTZ K;  1LT9 B;  4Y99 C;  2PAJ A;  1SP4 A;  2FFD A;  3CCJ P;  2WSC J;  1FZE A;  2IZ1 A;  2AXT E;  2FAC A;  4QKO A;  4KT0 J;  1CI6 B;  1NTZ G;  1NVO A;  4YXD C;  4WY4 C;  1ZLL A;  2OGU A;  4AUW A;  1GD2 E;  1BE3 G;  4JBZ A;  3WU2 E;  1JM0 A;  3WUU A;  1Y47 A;  3G0V A;  3NTE A;  3RK3 D;  3CME P;  3AEF C;  2OTK E;  5KP8 B;  1Q90 D;  4HJG H;  2RN0 A;  1ACP A;  2WSF J;  1M6N A;  1NYH A;  4CPG A;  2V7Q J;  4IOI H;  2P10 A;  1L4A A;  1M57 D;  1N73 A;  3CCS P;  2PEK A;  3JSV C;  4H0L D;  5B5E H;  1Y8A A;  2DNW A;  1L0L J;  2KS1 B;  2K88 A;  2Y0D A;  1QLE D;  3P8C E;  2KOO A;  2YXR B;  1USE A;  3CXC O;  1PEQ A;  2VSQ A;  3G28 A;  3L72 J;  4H13 D;  1M8O B;  2PEQ A;  3H32 A;  1KQG B;  1ZV8 A;  2R3C A;  1AFO A;  5AW2 B;  1JOC A;  3AE1 C;  3D6Y A;  1BGY E;  2KGD A;  1FOS E;  3A0B H;  5KKZ C;  3TNU A;  3VYI A;  3WUV A;  5L8R J;  3B4Q A;  4HH2 A;  2JR8 A;  2E74 B;  4HB1 A;  5AVV B;  4PD4 I;  2JDI H;  1RO2 A;  3WBH A;  2FYU G;  3IFM A;  4N78 E;  3SWY A;  1PGO A;  4I6M C;  2ZYA A;  1SQP K;  2M3E A;  4JF7 A;  4XRQ A;  4TT3 H;  1AUM A;  5DJT B;  1NU1 D;  4XE5 B;  2L5G B;  2E75 B;  1SQP G;  1FDM A;  2M3B A;  4W7Z A;  2BCC E;  3SFD C;  2KOR A;  3R2P A;  5CJ0 A;  3KXD A;  2JU2 A;  1XTC C;  5HV8 A;  1KIL A;  3RK2 C;  1GL2 D;  1VDF A;  1BGY J;  5B5E E;  5AW7 B;  1NWQ A;  1J1E B;  1NO4 A;  2FXO A;  3CWB D;  5KJ7 A;  1GPJ A;  2K93 A;  3H1I D;  1NTK E;  1ZRT E;  3A3Y B;  2JYL A;  4DZO A;  1JY2 O;  2B87 A;  2ZJS E;  3DS5 A;  2FFD C;  2N50 A;  4B86 A;  1M7L A;  1YJ9 P;  1G2C B;  3A0B E;  2Z5H A;  2J58 A;  1LTS C;  4EDF A;  1EZV G;  1L0N G;  3OJA B;  3H1L G;  2WT7 A;  2UWJ E;  2M0B A;  3L74 J;  2MD9 A;  2M8P A;  3DPH A;  5I4T G;  4DCK A;  1KN7 A;  3E7K A;  2Q9I A;  3VP8 A;  1L0H A;  3NMD A;  5GTI H;  2W27 A;  4EOT A;  2Y9Z A;  1HUC A;  1GMJ A;  1PP9 E;  1R8E A;  2EHT A;  1OWA A;  2LPK A;  2XU6 A;  3V6I A;  4C7N A;  2HYN A;  2GDW A;  1SQB J;  4C7N B;  1RF1 B;  2H8P D;  4BRY B;  2AEM A;  1A8O A;  1M90 Q;  2GZI A;  2MVU A;  2ZFC A;  5AVX B;  2R44 A;  1L4A C;  1N73 C;  3CLQ A;  2E76 D;  5GTH H;  2JP3 A;  2HPC B;  1KD1 Q;  2JO1 A;  2K92 A;  1LP1 A;  3BRT B;  4K3A A;  2DGY A;  4H2Y C;  1BE3 D;  1IFD A;  3MP7 B;  1NTK J;  1SFC A;  1JB0 J;  3TYY A;  1FJP A;  3V4Q A;  1MFZ A;  1H88 A;  1BCC D;  2N98 A;  1CW5 A;  3TGU J;  1S9K E;  2Z5I A;  1LJ2 A;  2C0X A;  2LF4 A;  3H25 A;  5AW6 B;  2IFM A;  1VPC A;  1Q86 Q;  1KMI Z;  3L35 A;  3Q1M A;  1JJ2 O;  2NPS A;  1KIL D;  2KUB A;  3L71 E;  4AQR D;  2KOS A;  5KAF H;  4H2X C;  1ZNV A;  1M6E X;  3BAT A;  2OYH A;  2GUS A;  3ABV C;  3W67 A;  5F2O A;  2OYH B;  1OVR A;  2QVA A;  1HVV A;  4RKU J;  3VOP A;  4K35 A;  2HLO A;  2CNR A;  2FVF A;  3CX5 H;  3IAO A;  2EHS A;  2OQQ A;  3M1M A;  4PJ0 H;  1KV4 A;  4PWV B;  3IF4 A;  1JTH B;  1RQU A;  2HOD A;  1JMM A;  3HE4 A;  3PRJ A;  5KP6 B;  1VQM P;  3RL0 D;  4RJT A;  1KIL C;  4COC A;  1RHZ B;  3W68 A;  2WWW A;  3EQ2 A;  2KP8 A;  2KZJ A;  5KJ7 C;  1SQV E;  3RGU A;  2Y0C A;  1EDL A;  2QM8 A;  2FQ1 A;  1LTA C;  4U0E A;  2G3A A;  3B5N A;  1SQX G;  1DD4 A;  2SPZ A;  1SLQ A;  1AV1 A;  2VLQ A;  3AE6 C;  3L71 J;  2JWD A;  1T8Z A;  2LL8 A;  3CCM P;  2QJY C;  1FZC A;  4IFM A;  2P2U A;  1S4X A;  1SFC D;  2POH A;  2K2Q A;  3CC2 P;  3EFF K;  4D6T E;  2LOL A;  1IFN A;  3OA7 A;  2E43 A;  3G4S P;  1NAF A;  1HJB A;  1AVY A;  5KAF E;  3G9R A;  4O9B A;  2PEJ A;  1FZA A;  1XTG B;  1LWU A;  3EWK A;  1NKZ B;  3RK3 E;  1LWU B;  2MF4 A;  2N5I A;  3H47 A;  1ZXG A;  2BCC D;  4RO0 A;  1N7S A;  1G1I A;  1EZV D;  1EXI A;  4GR6 A;  1SS1 A;  3L70 J;  3L73 G;  4PJ0 E;  2KOQ A;  3L75 G;  4TLF A;  1GK4 A;  1MZ9 A;  2N6Z A;  2C0W A;  1IFM A;  1GW3 A;  2Q7C A;  3D70 A;  1SFC C;  1P84 H;  3PLN A;  1S5L H;  4Z1M H;  3GF7 A;  1ZRT D;  4IL6 E;  2OYI B;  1FR2 A;  3KDP B;  1UNK A;  2VLN A;  1NTM J;  1KQF B;  2MJZ A;  2M8N A;  2IBZ I;  1YIJ P;  2A06 E;  1N7L A;  2OAR A;  4F37 A;  3G71 P;  2NPS C;  4BXL A;  3H4E A;  3HD7 A;  3A7O A;  4N6J A;  2JJL A;  2KB7 P;  2FHS C;  1PP9 D;  2IX7 C;  1VQ5 P;  1K04 A;  2OYH C;  1KB9 I;  1K8A Q;  1VKU A;  3HYB A;  4U3F G;  4NEO A;  1NU1 E;  2QEX P;  5APU A;  3FXD A;  2PEN A;  2BEZ F;  2CGQ A;  2KZI A;  1W5C E;  3ITK A;  3S4R A;  2K3R A;  4L73 A;  1M1J B;  3HRN A;  2EIA A;  1RE4 A;  1YI2 P;  3H1J E;  5HGM A;  1AVO A;  1DX7 A;  2E5Y A;  5B66 H;  3H1K G;  4L75 A;  2PFX A;  2N1T A;  2WPV B;  4RES B;  4ZKU A;  1VQ8 P;  3GHG B;  2P9X A;  1GK6 A;  4MN4 C;  1BDC A;  1JY3 P;  1VQ4 P;  1FAV A;  2D2C B;  5EJD A;  1HWT C;  1IFP A;  1N8R Q;  4WYM A;  3H1I E;  4H44 B;  1VQO P;  1IK9 A;  3B5N C;  5CCH D;  1TU3 F;  2CPB A;  5AVU B;  1GW4 A;  2MR8 A;  3B71 A;  4PV1 C;  2K9J A;  3HTK B;  4C7R A;  5KLI B;  1FZC C;  2WVR A;  5KLV G;  1DEE G;  3EFG A;  5BS2 A;  2OTL P;  5E79 E;  3CX5 I;  3WU2 H;  1FU1 A;  1LTJ B;  3RBZ A;  1PPJ G;  2G8Y A;  1NU1 J;  4GDO A;  2QJK B;  3CXH D;  5KTB A;  1LTT C;  1U7M A;  4LGD E;  4OGQ C;  1UIX A;  1LWU C;  3GMA A;  1N86 A;  3SSU A;  3G6E P;  2AF8 A;  1URQ B;  1KYO I;  1RY3 A;  1N7S C;  1OZH A;  2QIW A;  4H0L B;  2JEE A;  2OYO A;  3MUD A;  1NTZ E;  2VRS A;  3BCC G;  1AF8 A;  1YJN P;  2I8D A;  1LT1 A;  3CWB J;  1IK7 A;  3KHU A;  1BE3 E;  2AXC A;  1SQV D;  5B66 E;  3QH9 A;  4DG9 A;  2GZG A;  1ZN5 A;  3DS4 A;  1LT9 A;  2WPT A;  2KGC A;  1CI6 A;  3MTU E;  1Q82 Q;  4D6T D;  1GXG A;  1KIL E;  1QL2 A;  3FXE A;  2HFE D;  3HD7 C;  2P67 A;  5HVC A;  3B5I A;  5K5G B;  3SWK A;  1FC2 C;  2RKL A;  4JYB A;  1Q81 Q;  3M9Q A;  1P84 I;  1L0L K;  2JWA A;  1IJD B;  3M06 A;  4WVZ A;  3NFQ A;  1JY2 N;  4WB4 A;  2WIT A;  4U7J A;  1UJZ A;  1YTZ I;  4GR2 A;  1L0L G;  2Q3E A;  1GL2 B;  1RE4 C;  3P32 A;  2KS1 A;  4XFX A;  4U0D A;  3L72 G;  1BCC J;  2N1T C;  1HGV A;  2KLU A;  1RE3 A;  2KOP A;  2ONT A;  1S1C X;  1VF5 D;  2D2C C;  2CK3 H;  2JQ4 A;  3U1C A;  3TDK A;  4H44 C;  1PFI A;  2QJP B;  4QMA A;  3SWF A;  4I7Z B;  1SQP E;  2WPS A;  2A06 D;  2LIU A;  1F80 D;  2O3J A;  2FYU K;  2KK7 A;  1RQV A;  5KLI C;  3R4Y A;  5KAI H;  3RK2 D;  2M8L A;  1VQ6 P;  1BSN A;  1OW6 A;  1SVF A;  2M8R A;  5AVZ B;  1YHQ P;  3AEE C;  1U7J A;  1X79 B;  1QX8 A;  2O01 J;  2YXQ B;  1DD3 A;  1QVG O;  3P7K A;  3V4W A;  2NRG A;  2BEQ D;  1K30 A;  1VF5 C;  2E76 B;  2WSE H;  2L4B A;  1MFT A;  3JCU H;  3H1J D;  1EZV E;  2LKI A;  3MUD C;  2YNY A;  3H1L E;  4IPY A;  2JU1 A;  1OW7 A;  2L9F A;  1BGY G;  1D1D A;  1M56 D;  1S5L X;  1M74 A;  1RNI A;  2I1J A;  3A5T A;  5AW4 B;  3EJE A;  1LTB C;  3LID A;  4BPF A;  1LT9 C;  1VQK P;  1L0N K;  2ZT9 B;  2O1J A;  1L4A D;  2XXM A;  1K73 Q;  1QRJ A;  1G2C A;  4EI2 A;  2QNW A;  1D7M A;  2KIK A;  3FWL A;  3CMA P;  3BAS A;  4GOE A;  3AEG C;  1OX3 A;  3L74 G;  2W8Z A;  3MGE A;  2ZYG A;  3AE3 C;  2W6J H;  1SQB K;  3HUS B;  5KAI E;  3E2D A;  1HF9 A;  3IR9 A;  3VMZ A;  4W7Y A;  1AJY A;  3CXH H;  2KW2 A;  3M9H A;  3GZL A;  2Q3I A;  5F2K A;  1SQB G;  5AVQ B;  2LTE A;  2BCC J;  2LKM A;  1RF1 A;  3GG2 A;  4BRY A;  1J1D B;  1L2P A;  5AVT B;  1R5S A;  2WMM A;  2FBW C;  3USS A;  1NTZ D;  2WPQ A;  3AED C;  3GW6 A;  3GLM A;  3Q5S A;  3RL0 B;  2HPC A;  1YYC A;  2PY8 A;  5CMZ A;  4L76 A;  3JCU E;  3MIW A;  1T2K C;  4DOJ A;  4PD4 D;  2RMZ A;  2M5A B;  3TGU G;  1RE3 C;  5APY A;  5H2F H;  4ZKP A;  1BSH A;  1HQB A;  1WRG A;  3EJB A;  1VQL P;  4I7Z C;  2B9B A;  1H89 A;  2KNC B;  1WMK A;  5EFW B;  1EDK A;  2E74 C;  2ZVO B;  3KYQ A;  5CHX A;  2K37 A;  2YKO A;  4I2L C;  2QE7 H;  3FX0 A;  5M1B A;  3V5B A;  1PP9 J;  2A45 H;  2LXC B;  3L72 D;  5KJ7 D;  2XZR A;  3MD0 A;  2N9B A;  1ZME C;  4KJM A;  1K05 A;  2C9N Y;  2K0X A;  3CXH E;  1FS0 E;  2PEO A;  2E75 C;  2WSE J;  1H0T B;  3LMO A;  2C9L Y;  7CEI A;  3O6Q B;  4U0A A;  4R4M A;  4I1L A;  1JTH A;  3EJD A;  2N6Y A;  2RH0 A;  3A0H E;  1UII A;  3VP9 A;  2FYU D;  3S9O A;  2R5B A;  3VN0 A;  1EQ7 A;  2YIU B;  2AEF A;  3KQG A;  4GKG A;  1IZN B;  1JEK A;  3L37 A;  4IL6 H;  4R0M A;  1J1E C;  3M0A A;  2FQ2 A;  1SQX K;  3M0D A;  3I5C A;  3CC4 P;  3S1K A;  4WBA A;  2FAE A;  1BAJ A;  1PGP A;  2KGE A;  1SQP D;  2HG5 D;  4C46 A;  1YQ3 C;  1JMB A;  5H2F E;  2PEM A;  3V2N A;  4Y28 J;  1KB9 E;  3VRL C;  1MV8 A;  1YBK A;  2PGD A;  2NZ2 A;  1MKM A;  3MZW B;  3L75 E;  2IBZ G;  2EFJ A;  3PTZ A;  2KOD A;  2PRR A;  1QEX A;  2AFE A;  1AQT A;  5AW3 B;  1YQ4 C;  2XNX A;  1EDI A;  3NY7 B;  2LR2 A;  1RF1 C;  1VQN P;  1PEM A;  3CD6 P;  1SQQ K;  2XZ1 C;  1MUU A;  3V2P A;  3RG2 A;  2NPS D;  1IMP A;  4PH1 A;  3G3Z A;  3L70 G;  2Z45 A;  5CCG A;  1L0N D;  2KOG A;  3SFE C;  3H1L D;  1OIP A;  2FVA A;  1SQQ G;  2W6A A;  3RG6 C;  2QA4 P;  4WWI A;  1SQV J;  1NTM K;  1E79 H;  1PGJ A;  2AVA A;  1SQB D;  3IN6 A;  3Q5P A;  4MRT C;  2XDJ A;  2OTJ P;  5EW5 E;  1NTM G;  1GU4 A;  2P58 A;  2OYI A;  2Z44 A;  2H43 A;  4U3F E;  3GZM A;  3L4F A;  1T8K A;  2Y9Y A;  1JNM A;  5TIS H;  1FZF A;  4D6T J;  1ZW0 A;  2MY5 A;  5BVZ A;  3KZI H;  5E79 H;  1HBW A;  2Z4E A;  3PP5 A;  1HY8 A;  3I56 P;  2K1A A;  1NH4 A;  2XV6 A;  2FAD A;  3H1K E;  1FJK A;  4U0C A;  4Y99 B;  5KP7 B;  3U1A A;  3BRV B;  2WPR A;  1W2E A;  3H1H G;  3B5N D;  3D71 A;  1G1J A;  2VLP A;  4PV1 D;  1PL5 A;  4WY4 B;  3E1I A;  3AE4 C;  2AEJ A;  2PP6 A;  3CL3 D;  3PH0 A;  2K94 A;  1M1J A;  1GU5 A;  4IFD K;  3L36 A;  5KLV E;  1BXI A;  2EG5 A;  2GA1 A;  2VLO A;  1VL2 A;  2K5X A;  3GJN A;  1IC2 A;  1QL1 A;  3E1R A;  4PD4 H;  3CI9 A;  2IPP A;  1DEB A;  4OGQ D;  4UB8 E;  1Q7Y Q;  3M0D C;  3GHG A;  4JQ0 D;  2A45 I;  2PEI A;  3CC7 P;  4EIJ A;  3RBX A;  1N7S D;  5CZD B;  3AE7 C;  5APQ A;  2KG8 A;  1NKN A;  2E42 A;  3LRY A;  5CCG D;  5KLV K;  2WTY A;  1LTG C;  1HJ0 A;  3NTN A;  3HTK A;  2L6E A;  2YKP A;  1CEI A;  3CCE P;  3CCV P;  1KLP A;  3T97 A;  1A02 J;  1KQS O;  2P7J A;  5TIS E;  3T97 B;  3BCC E;  3BVH A;  5AW5 B;  1ZR2 A;  3KZI E;  4U0B A;  1LTJ A;  1KFN A;  2YO3 A;  4NPD A;  5KKZ B;  3RK3 B;  2NO8 A;  2I1K A;  1OW8 A;  1N2D C;  3AE8 C;  3HE5 B;  3G21 A;  2JGP A;  4BWN A;  1SQX D;  3Q20 A;  2O01 H;  1T3U A;  1LNQ A;  1URQ A;  3H1J J;  1T3J A;  1DIP A;  5CCG C;  1FOS F;  3DTJ A;  5F2N A;  3HD7 D;  3CWB G;  4OH8 B;  1MZ8 A;  2IBZ D;  4H13 B;  3G29 A;  3OW2 O;  3MHV A;  4YTP C;  4R4L A;  2BQ1 E;  3H1I J;  4PD4 E;  5JPA A;  2L0Q A;  4QNB A;  5DCK A;  2OYI C;  4W80 A;  3DS0 A;  4KHX A;  3RL0 g;  3DS1 A;  1JCD A;  1DV5 A;  3RK2 B;  1KB9 D;  1SQQ D;  3L73 D;  2L22 A;  1L0L E;  1RO0 A;  2N1T D;  3L75 D;  2GYK A;  1E6J P;  2E1M A;  2GM4 A;  3L72 E;  3TF5 A;  2AFD A;  1X0T A;  2QG4 A;  2D2C D;  1CSB A;  2FFD B;  2IYO A;  1NTM D;  4H44 D;  3M91 A;  3QWO C;  4AYC A;  5HGL A;  1GXH A;  1NTZ J;  1HH0 A;  4BPH A;  1T6A A;  1M1K Q;  1M1J C;  1BE3 J;  1GL2 A;  1VQP P;  4DJG A;  1KFM A;  3VMX A;  1BCC G;  1EXJ A;  5DJU B;  2FYU E;  4IL6 X;  3DS3 A;  5APX A;  3F5H A;  2R32 A;  3H1H D;  3DS2 A;  4JPZ B;  3N7N A;  3GHG C;  3GF3 A;  3CX5 D;  2CG5 B;  2J5U A;  4U3F D;  1L4A B;  2JB0 A;  1RH5 B;  1URQ D;  1N73 B;  1AYI A;  4YXW H;  2WZ7 A;  3V2R A;  2P1J A;  1HTL C;  1IO4 A;  3CCL P;  3H32 B;  1Y9B A;  2ZAE B;  3G1G A;  4M3L A;  1VQ9 P;  1KYO D;  3H1K D;  5AW1 B;  1LTJ C;  3B4S A;  2ERH A;  2KR5 A;  4GIF A;  3RK3 C;  1JO5 A;  3TNU B;  2QJK C;  5AW0 B;  1YIT P;  2FYN B;  3CCR P;  2CQ8 A;  1EMV A;  2XZ0 D;  2LML A;  1USD A;  1OR5 A;  5BU8 B;  4GOD A;  2IDB A;  5AVR B;  1Z6M A;  2MVV A;  5APV A;  1URQ C;  2ZVN B;  4H0L C;  2FYU J;  5KLV D;  2KG6 A;  3L74 E;  1L0N E;  2CPS A;  4H13 C;  2CWO A;  1PPJ D;  3H6P A;  3C8V A;  3A2A A;  1SQP J;  1SQB E;  3ZDM A;  3M9B A;  2K9Y A;  2YKQ A;  3LW5 H;  2JBG A;  3CE7 A;  1KIL B;  3D6Z A;  2Q6Q A;  2ITA A;  4CA3 A;  3BCC D;  1P84 D;  1T2K D;  1IFJ A;  2H7H A;  4LC1 A;  3HUS A;  1U57 A;  1OMI A;  2KSE A;  1ZOY C;  1OXZ A;  2B87 B;  3TGU E;  1HGZ A;  2K0Y A;  2BCC G;  1E5W A;  2QJY B;  2H89 C;  4UB6 H;  2E74 D;  2WT7 B;  1L0N J;  2FQ0 A;  3CCQ P;  3H1L J;  1K9M Q;  1NTK K;  2GZF A;  1X9V A;  3A0H H;  3AE2 C;  1GL2 C;  1NQ4 A;  3WMM 0;  4ASV A;  5AVY B;  2O1K A;  4N3Y B;  1QVF O;  1NTK G;  5CJ4 A;  2FXP A;  2ROQ A;  2WQY C;  2QSI A;  2M5A A;  4ZNC A;  4XFJ A;  2JO0 A;  2E75 D;  3PJS K;  4U0F A;  4HKG A;  1PEU A;  2N9Y B;  2JKV A;  1FDO A;  2KWL A;  2R3S A;  2QJP C;  2GDX A;  1JY3 N;  1KB9 H;  2KNC A;  1LP1 B;  4L74 A;  1FBM A;  1SFC B;  1PIX A;  1L0L D;  1PP9 G;  3Q2Y A;  2KYV A;  4NPE A;  1X3O A;  3N4X A;  3C1L A;  1EZV I;  2JYG A;  1L0I A;  4LLH A;  2BUO A;  2GDY A;  4EYY Q;  3II6 A;  3UIA A;  2JAZ A;  2XT1 A;  2FYN C;  2B89 A;  2ZT9 D;  2Q1K A;  5AVW B;  1NGM B;  2NPS B;  1PGQ A;  1IFI A;  1H0T A;  1SQX E;  2FKW B;  1BDD A;  2E76 C;  1A43 A;  3U59 A;  3O6Q A;  2KGA A;  4UB6 E;  1J2J B;  3TK1 A;  3OAK A;  2FYZ A;  5CBN A;  1PEO A;  3I55 P;  2FY8 A;  5GTI E;  2O01 N;  4PH0 A;  2H88 C;  3JC2 2;  2LIW A;  2BAS A;  2IBZ E;  4XFZ A;  2XV5 A;  2R5D A;  1JY2 P;  1AA0 A;  3V2Q A;  2W90 A;  1A02 F;  2HOD B;  2ZT9 C;  3LW5 J;  3AEA C;  2QM7 A;  3HE4 B;  3L71 G;  3P8C D;  2GUV A;  1FZB A;  5GTH E;  4BPG A;  3L70 E; 
#chains in the Genus database with same CATH homology
 1PEQ A;  1W2B O;  3G28 A;  1Q81 Q;  1VQN P;  1PEM A;  2PEQ A;  1EOQ A;  3CD6 P;  1M74 A;  1Q7Y Q;  1RNI A;  2Z46 A;  2JO0 A;  1RO0 A;  5BS2 A;  3G26 A;  1E6J P;  2M8P A;  3DPH A;  5I4T G;  2OTL P;  2PEI A;  4PH1 A;  3M1M A;  4U0F A;  3CC7 P;  2E1M A;  1PEU A;  1EIA A;  2Z45 A;  1KC8 Q;  1VQ7 P;  4GR2 A;  1VQK P;  3LRY A;  3G1I A;  2XXM A;  1K73 Q;  3RG6 C;  2M8N A;  2QA4 P;  1QRJ A;  1VQM P;  4XFX A;  1YIJ P;  4XRO A;  4U0D A;  2CWO A;  5HGL A;  2OAR A;  4COC A;  3CMA P;  1IUQ A;  2L6E A;  3H0D A;  2PEO A;  3G71 P;  4COP A;  1RO2 A;  3CCE P;  3CCV P;  1A8O A;  1KQS O;  3H4E A;  4M0I A;  3MGE A;  3G6E P;  1M90 Q;  3WBH A;  2OTJ P;  4U0B A;  2ONT A;  3E2D A;  4U0A A;  2JYG A;  2Z44 A;  2BUO A;  3CCU P;  1M1K Q;  4U0E A;  1VQ5 P;  1VQP P;  1KD1 Q;  3CCJ P;  1S72 P;  4XRQ A;  1YJN P;  2XT1 A;  5F2K A;  2DGY A;  1AUM A;  1K8A Q;  3G21 A;  3HYB A;  3CCM P;  3DS3 A;  1ZMB A;  3Q20 A;  1NJI Q;  2QEX P;  1YJW P;  3CPW O;  3DS2 A;  5HGO A;  2M8L A;  3CC4 P;  1VQ6 P;  2PEN A;  3CC2 P;  1A43 A;  3I56 P;  2XV6 A;  3G4S P;  1BAJ A;  2LF4 A;  4U0C A;  3DS4 A;  3DTJ A;  1PEO A;  5F2N A;  2BHV A;  3I55 P;  2EIA A;  1YI2 P;  1YHQ P;  2PY8 A;  3G0V A;  5HGM A;  1Q86 Q;  3NTE A;  2PEM A;  4PH0 A;  3CME P;  2PEJ A;  5HGN A;  4XFY A;  1JJ2 O;  3G29 A;  4XFZ A;  3VRL C;  3OW2 O;  1QVG O;  3HZQ A;  3CCL P;  1Q82 Q;  3H47 A;  1M6N A;  2BQ1 E;  1K30 A;  1VQ8 P;  3G1G A;  1VQ9 P;  3CCQ P;  2P9X A;  5BS1 A;  1K9M Q;  5JPA A;  4QNB A;  1VQ4 P;  2EFJ A;  5DCK A;  2JYL A;  2KOD A;  4GR6 A;  3CCS P;  4WYM A;  3DS0 A;  1N8R Q;  2PEK A;  1VQO P;  1VQL P;  1M6E X;  3B5I A;  3DS1 A;  2EG5 A;  3P05 A;  4IPY A;  3DS5 A;  1YIT P;  1D1D A;  1QVF O;  1YJ9 P;  5F2O A;  3CCR P;  3CXC O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...