1VQ7P

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq7P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq7P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq7P02
1VQPP 2QA4P 3I56P 1YIJP 3CCSP 3CCQP 1S72P 1YJ9P 3CMAP 1VQMP 1K8AQ 1Q7YQ 2QEXP 1JJ2O 3CC2P 3CCJP 1YJNP 1Q86Q 1QVFO 1VQ6P 1Q81Q 3CCLP 1Q82Q 1K9MQ 3CXCO 1VQLP 3CD6P 3G4SP 1K73Q 1KD1Q 3CCMP 1VQ8P 3CPWO 1VQOP 1NJIQ 3CCEP 3G6EP 2OTJP 1M90Q 1VQNP 1W2BO 3OW2O 1QVGO 1KC8Q 3CCRP 3CMEP 3CC4P 2OTLP 3CCUP 1VQ5P 3I55P 3CC7P 1KQSO 1VQ7P 1VQ9P 1N8RQ 3CCVP 1M1KQ 1YJWP 3G71P 1YI2P 1VQ4P 1VQKP 1YITP 1YHQP
chains in the Genus database with same CATH superfamily
1HF9A 4R4LA 3SWYA 3U1CA 2N1TB 1NWQA 3QH9A 2KNCB 1YJ9P 4UB6E 3V2NA 3M0DC 2G3AA 2ZT9D 2FXPA 1X0TA 4A7PA 3CD6P 3AEBC 1BDCA 1WT6A 1PGJA 2VRSA 3II6A 3HTKA 4D6TG 4YTPC 1U7MA 4COPA 1LP1A 3A0BE 1D1DA 4PXHB 3L73J 4M0IA 1P84H 3KDPB 1XTGB 1N7SB 1UJZA 5AW9B 2JP3A 1SQPD 1VQ5P 1CEIA 1YJWP 2Q1KA 2ROQA 2KODA 3JCUE 4OWFA 3H0DA 1BSHA 4IL6X 1GK4A 3MHVA 1SQQE 2E76C 4C46A 3H1HD 1L0ND 1SQXD 3SWFA 2PENA 3RG6C 2AEJA 2E43A 2Z5IA 4NPDA 2WSFJ 2MY5A 1JOCA 1T3UA 2K2QA 2FY8A 1H0TB 2K0XA 5KLVE 2PEIA 2VLNA 3DTJA 1NTZK 3QWOC 3ZDMA 2OYOA 2OYIB 4H44D 2HFED 1NU1E 2CNRA 2VLOA 2L9FA 3GLMA 1A02F 1YI2P 2YNYA 4EIJA 1KLPA 2XNXA 4N3YB 2QJKC 3H1JE 1S72P 2K92A 3B5NB 1NTMK 1PPJG 4ZKPA 1K9MQ 3V2QA 2HLOA 2K9JA 3G26A 1SFCD 2WVRA 1KILE 1S9KE 5AVSB 1L0IA 3VMZA 3IR9A 5AW2B 2OTKE 1K04A 5GTIE 1EZVG 3BCCE 2FQ2A 3PP5A 3CX5H 3MTUE 3KZIE 1Q86Q 4ZKUA 3CCLP 2QM7A 1M6NA 1ZNVA 1X8YA 1VQ8P 3WMM0 2AVAA 1IUQA 1SQPG 2PEKA 1R5LA 4WBAA 4H13C 2JWDA 1JY2N 2OARA 4HYTB 1QLED 3S4RA 4DCKA 1NTKJ 2E74B 1JY3P 2GDXA 1RQUA 2Z5HA 2QM8A 4AYCA 3MGNA 2A45G 4UB6H 1S5LX 1AVYA 1MZ9A 1VF5C 4UHPB 3AE2C 1GL2A 5AVQB 1NTMJ 4PD4H 5H2FH 1PPJE 1S5LH 1GW3A 2IZ1A 5KKZC 2EHSA 2PRRA 5CZDB 4HKZH 2E42A 1PEMA 1M1KQ 1NVOA 2BCCJ 5AVRB 3LIDA 3CWBE 3H1IG 1BE3D 1LGHB 1YTZI 2D2CC 2OYHB 4YPCA 3H1HE 1J2JB 1PEOA 3EJBA 1Q2NA 4GR6A 1SQBG 4OVNF 5GTHE 1URQD 3TK1A 1VF5D 2JO1A 2Y0EA 4JF7A 2QSIA 4H2XC 1RO0A 1FAVA 1OFCX 1LT1A 1FOSE 2B87A 1LTIC 2LL8A 3BCCD 3M0AA 3R2PA 3Q3DA 1ZLLA 4NEOA 5F2NA 5BU5A 1EZVE 1RF1A 1IZNB 5CMZA 2GZJA 3MD0A 1AQ5A 3BRVB 1H88A 4C7NA 3L73G 3EQ2A 2KSJA 3CE7A 1PGQA 3MUDC 3L73D 3HYBA 3H1KD 4H13D 2K94A 1PZQA 1M56D 3KZIH 2FXMA 2J59M 1AUMA 1AJYA 1SQPJ 2ZYDA 1FDOA 2ONTA 2XNDH 4I2LC 5KKZB 2O01H 2OYIA 2QE7H 1FE6A 1GXHA 3H1KJ 3W67A 2D2CD 3MIWA 4ZNCA 2ERHA 1L0LE 5AW0B 3I5CA 3BATA 1S3JA 2Q7CA 4PV1B 5KP8B 3CMEP 3V4WA 1LTJA 4U0AA 1VQKP 1BSNA 2FYUE 2QA4P 2MR7A 1SQQG 3CXHH 4KT0J 3TNUA 1NH4A 3VP8A 2W8ZA 2FQ1A 2KNCA 4BRYB 2HR3A 3A5TA 4XFJA 1LT9B 1L0HA 2Y9YA 4YXDC 5I4TG 1AVOA 1E6JP 1H8AA 1SQPK 4AQRD 3A0HH 2Z44A 3EJDA 2P9XA 2ZVNB 4WVZA 2L6EA 2KGDA 3GHGA 1JUNA 3VTPC 1RQVA 1VQ4P 4U0BA 3AE1C 2XV5A 2PFXA 5AW5B 1T8KA 1SQVJ 5H2FE 1MUUA 2Q5UA 3VN0A 1BCCG 2LIUA 1ZOYC 2KI7B 1OWAA 1HH0A 2W27A 4BPHA 3RL0C 2JQ4A 2R3SA 1R5SA 2OTLP 1KB9H 3U59A 2C0WA 4R4MA 1K05A 2KB7P 3GHGC 1K30A 3HD7D 1IFJA 5C39A 1D7MA 4U3FJ 2A06G 3CMAP 1JY2O 5AW1B 3M9HA 5HV8A 3KXDA 1OVRA 4U7JA 1X3OA 3G4SP 5AW4B 2M8PA 1PIXA 2JU1A 2HODA 1SQXK 3R4YA 2RN0A 3CC7P 4U0DA 1IJDB 1LP1B 2FYNB 1XTCC 3B5ND 1UNKA 4DG9A 4PD4D 1FBMA 1NAFA 2XXMA 1YIJP 2Y0CA 1URQC 3L75J 3CXHI 3L70D 2K88A 2KOPA 1FZCB 2PP6A 1YBKA 2WSEH 1EDLA 1OIPA 5GTIH 1L0NG 3WUVA 3PLNA 3H1IJ 1BCCJ 2FFDB 3L74E 1RE4A 3KPEA 4L76A 3L74D 3SWKA 1Q90D 5E79H 2ZT9C 3RK3E 3L72J 1UIXA 3RL0D 5TISE 4WY4D 3GF3A 1HGZA 3B4QA 1VQ7P 1N8RQ 2LOLA 2KWLA 2LXCB 5KLVD 1HJBA 2B89A 2GZFA 3JC22 2FVEA 2O01J 5KLVG 5TJHA 1CZQA 2N50A 3WU2H 2SPZA 5AVWB 2P7JA 1KILA 1USDA 3H1LD 4H44C 3HUSC 1NKZB 2DW3A 4DOJA 3CCVP 5CBOA 1AF8A 3D71A 2E5YA 1LTSC 1KZUB 1Y47A 3CCSP 3WUTA 4XA4A 4BPFA 2FFDA 3H6PA 1A02J 2YIUB 1EQ7A 2R44A 3M06A 1R8EA 2GDYA 2K9YA 3F89A 1IFIA 3EJEA 2EIAA 2P1JA 2E76D 4I7ZC 3A3YB 1QL2A 4H2YC 5APXA 3SFEC 3A7OA 3CPWO 1VHNA 3PTZA 3TSIA 1L0LG 2WITA 3K5BA 1X9VA 1L4AA 2OGUA 1SQQJ 1YHQP 1JMBA 1KYOH 3B5IA 2W90A 2XKMA 3C1LA 4U0EA 1SFCB 2E5TA 3FWNA 1QRJA 3SFDC 2FKWB 1MZ8A 3AE8C 3FX0A 2H89C 2GYKA 4QMAA 2QJKB 1RF0A 1FDIA 1JMMA 1NTZG 4LC1A 1OX3A 5KJ7D 2N6YA 3CC2P 1RO2A 3L70J 4H44B 3V6IA 1SQVD 3L72G 3MGEA 3VRLC 5CCGA 4GKGA 2FACA 2L22A 1IMQA 2L4BA 5AVVB 3NMDA 2GDWA 1EIAA 3H1JD 3N7NA 5BU8B 1JCDA 2B9BA 1ZR4A 1Y8AA 2KXPB 2LMLA 3HE4B 4CA3A 2ZFCA 1MFZA 1W5CE 2A45I 4JPZB 4M3LA 5APQA 2Z45A 2POHA 2RKLA 1VDFA 2YMYA 1LTBC 2CG5B 1NU1J 2NRGA 3H1LE 1T2KC 5M1BA 1IFPA 1M57D 3Q20A 4QNBA 1RHZB 2H7HA 3FXEA 3U1AA 2ZXXA 4U0CA 4O9BA 1QL1A 4HJGH 4BXLA 1N7SD 2A06D 2BASA 2KZIA 1QGKB 2DNWA 3V2PA 5E79E 1J1DC 5B66H 1BXIA 2WSEJ 1Q81Q 1MV8A 2WSCH 2WSFH 3L74J 1KB9E 3T97B 1KD1Q 5BS1A 4TT3H 2MF4A 2KK7A 3L35A 1KN7A 1T2KD 3H47A 1HJ0A 1NTZJ 2CWOA 2M5RA 2IYOA 1FZAA 1SQPE 4U0FA 3L70E 1DX7A 3CCMP 3D6YA 1RF1B 2M8LA 5F2KA 2LKMA 4XROA 5AVTB 1W2BO 2LTEA 1GPJA 2IFNA 5EJDA 2FVAA 3AE9C 3PJSK 2YKQA 3CXHE 3L74G 2FQ0A 2KG8A 2QG4A 1M6EX 3G1IA 1BE3E 1SQXE 4Z1MH 1GL2B 4I7ZB 1ZP0C 4GDOA 3P8CE 2M8NA 1L4AD 1N73A 2WQYC 2WSSH 1YQ3C 4GR2A 2JEEA 3RK3B 2O1JA 2KGAA 3G1GA 1NTKE 1SQVG 2N9BA 2K3RA 4PH0A 2C9LY 1EDKA 1SQXJ 2XDJA 3FWLA 2WMMA 1X22A 3H1ID 3N4XA 5AW3B 2PEOA 1OW7A 1GW4A 1H89A 2W6JH 1OVUA 3CWBJ 2E75D 1LT9C 2I1KA 1JEKA 3P05A 4H2WC 1LTJC 1LTJB 3H4EA 5F2OA 3L73E 2JGPA 4R0MA 5HVCA 1G1JA 3ABVC 3VOPA 5KLIC 1LTTC 1A8OA 1HVVA 4H0LD 5CHXA 3RK2D 3HD7A 1AV1A 1SQVK 3GJNA 2WTYA 1TU3F 1PP9J 1KC8Q 1N2DC 3CCUP 4PV1C 2KLUA 2IBZG 1ZMBA 5AVYB 3WBHA 3DS2A 3ITKA 3NXSA 2IFMA 2PEMA 5BS2A 4N6JA 2K37A 4PD4E 2CQ8A 2FADA 1WMKA 2KW2A 1FR2A 3Q5PA 2GM4A 1KQGB 5KAIH 3H1HG 1BGYE 1EXIA 4OGQD 2J58A 2KLVA 5KTBA 1FZCC 1YTZT 5B5EH 1URQA 2Y0DA 4D6TE 3P8CD 3OA7A 4K3AA 2ZVOB 3A2AA 2E75C 1HUCA 4WWIA 3GG2A 1PFIA 2KORA 3I55P 1WRGA 2WSCJ 3H32A 1NTZD 2MKVA 1SLQA 1BE3G 1SQXG 5AW8B 1RE4C 1DV5A 3AEGC 1JY3O 4BRYA 4L73A 1Q82Q 1GU5A 3IF4A 1RY3A 1LWUC 2IZ0A 4OH8B 2Z46A 1J1DB 1KYOE 1H0TA 5AW7B 3T97A 3PHLA 2X2BA 1FC2C 5KP6B 1G1IA 5KAFE 2KIKA 3AE7C 4LLHA 4IPYA 3CXCO 3P32A 3CWBG 2LPKA 2RMZA 4IL6E 1S2EA 3BVHA 1L2PA 2HG5D 1AQTA 1KFMA 3S1KA 2ZJSE 2JR8A 1HBWA 1N73C 3H32B 3AEFC 5HGLA 1EZVD 3FGAD 3JSVC 1LTAC 3E1IA 3BRTB 3G3ZA 1CSBA 5KLVK 2OYIC 3RL0g 2M0BA 3SSUA 4K35A 2MD9A 3OJAB 5HGNA 1N86A 3EFFK 2V4HA 3MUDA 4EI2A 4IFFA 5KP7B 2AFDA 1S5LE 4D6TD 2K1AA 1DIPA 1N7LA 2O1KA 4GIFA 1NTME 2LIWA 1CI6A 2YIUC 1KILB 3TGUE 2KOSA 2GUSA 3LW5J 4C7RA 1PEQA 2W6AA 4IZ6A 1USEA 3CLQA 4H0LB 5B66E 1IK9A 2OYHC 1JTHA 5B5EE 1G2CB 1NTZE 1HQBA 1NOHA 2CGQA 2WPQA 3NY7B 1VQLP 3DS5A 1KYOI 2KUBA 2VLQA 1FS0E 2Z4EA 1SQBK 2XU6A 4OGQC 1RF0C 3TNUB 2KSEA 2AFEA 3L71E 1FOSF 1NU1K 5KJ7C 4F37A 4XFXA 3H1JG 4IL6H 2M3BA 5KAFH 2Q9IA 1EZVI 2NZ2A 3RK3D 1NU1G 3VP9A 3A0HE 3G71P 5APTA 1KQFB 1DH3A 1SQBE 2UWJE 1L4AC 1NO4A 1L4AB 1L0NK 2GZIA 3IN6A 1IFMA 4PJ0H 1YJNP 2MVVA 3H1IE 2QNWA 1EDJA 1FZGA 4ASWA 1MFTA 3GHGB 2PAJA 1LTGC 1EC5A 2OTJP 1FJKA 2L0QA 1IO4A 3D70A 3L72D 5L8RJ 2H8PD 2CPBA 1NGMB 2NPSB 2JYGA 2ZYAA 5CCGC 3I56P 1BCCE 1BE3J 5CCHA 3LIEA 3PRJA 5KLVJ 3GKLC 1ZR2A 3M9QA 1PP9G 3G29A 3GW6A 1L0LK 5HGMA 4C7NB 3CCEP 2YKOA 3CL3D 3EWKA 5APYA 1ZN5A 2KS1A 3VMXA 1GL2C 3M0DA 2ZAEB 4L74A 1OVVA 1GD2E 1OXZA 2DGYA 2AXTE 3TF5A 1BGYG 4ASVA 3IAOA 3VMAA 1GZLA 1SQQK 3P8MC 2AEFA 1L0LD 2K0DX 1IC2A 1GTWA 4JBZA 2YO3A 4W80A 2IBZI 1NKNA 1KQSO 1NHLA 4DT0A 3AE4C 2LKIA 1T8ZA 3Q5SA 1PP9D 4XFZA 2XZ0D 1BGYJ 1Z56A 2PEQA 5APUA 2FYUG 2CK3H 1DNYA 1L0NE 1NJIQ 4WY4B 3DPHA 1M7LA 3RL0B 2K93A 2P58A 5DJUB 3L75D 4MRTC 2JO0A 2JB0A 1PGOA 1FZBA 2FYNC 1SVFA 1N73B 4I6MC 3CI9A 1VL2A 3B4SA 1P84I 2N98A 3CX5E 2Q3EA 1PV3A 2H43A 3AE5C 2FYUJ 3HUSA 4RJTA 1AA0A 2NO8A 1SQVE 4XFYA 5APSA 2JU2A 2BCCD 3DS3A 2AF8A 1DD3A 2XZRA 3D6ZA 2NPSC 4JYBA 3V5BA 1MKMA 2IDBA 2JKVA 3NTEA 3G9RA 1OZHA 2GUVA 3C9IA 4RESB 4LGDE 1LWUB 2K9JB 3DS4A 1X79B 4WY4A 2OQQA 1VKUA 4EYYQ 3HD7B 2R5BA 1PGPA 2GZEA 4WYMA 1VPCA 1RH5B 1OW8A 3L37A 3AECC 3G28A 4NPEA 1VQNP 2PY8A 5KJ7A 1Z6MA 1IMPA 1ZV8A 4U3FG 2HPCB 4HKGA 3HTKB 4ZMDA 3VMYA 3H1KE 1OR5A 1E5WA 3HRNA 2E76B 3CCQP 1KORA 1M1JA 3LMOA 4WY4C 4EOTA 3A0BH 2YO2A 2KYVA 2KOOA 2FBWC 3O6QB 2CPSA 1DEBA 1ZRTE 4AUWA 1RNIA 4GT1A 4CPGA 3RG2A 2QIWA 1YQ4C 4PH1A 5APVA 2C9NY 1RE3C 3KYQA 1JO5A 5CCGD 2LF4A 3H1LG 2FYUD 3M9BA 2FAEA 3WUUA 3C8VA 1PPJD 3MZWB 4GOFA 1F80D 2GZGA 2BCCE 2EHTA 3AE6C 1SP4A 1IFNA 2YXRB 5K5GB 2YMKA 1NU1D 4RO0A 3BCCJ 2PEJA 1KTMA 1M1JB 4PV1D 3H1HJ 1LNQA 2FXOA 1S4XA 2K0YA 2KG9A 1GXGA 2AXTH 4N78D 2V7QH 3F5HA 3Q5RA 2XV6A 2R3CA 4N78E 2IX7C 3O8ZA 2QJYB 1S9KD 2O01N 3AEAC 4JQ0D 3H1JJ 2KGEA 1ZMEC 2N5IA 1L0LJ 4IFDK 1E79H 4PD4I 1YITP 1PL5A 1FZEA 2J5UA 1VQ6P 4L75A 2L5GB 4COCA 1P84D 2XT1A 4NPFX 5CJ0A 1S1CX 5DCKA 5CJ4A 3AEEC 3OW2O 2N6ZA 3CCRP 4IOIH 3FXDA 1KB9I 1RF1C 2E74C 3EFGA 2M5AA 3WU2E 1E0HA 1T3JA 1M74A 1CI6B 3E1RA 1QEXA 1NTKG 1FZFA 3CC4P 1URQB 3RK2C 1LJ2A 2QRXA 3HE5B 1FU1A 4U3FE 1PP9E 2GA1A 1FJPA 2NPSA 2IBZD 2NPSD 1K8AQ 2W6BA 3RBXA 2BEZF 4RKUJ 4BWNA 3B71A 3S9OA 1FDMA 1AYIA 4XRQA 2EFJA 1M90Q 3G21A 3RK3C 3GZLA 4QKOA 2BUOA 3H25A 2HPCA 2QEXP 2RH0A 2C0XA 1NTKD 3L75E 5TISH 3AEDC 2M5AB 2VSQA 2OYHA 3NFQA 1SQBD 3AE3C 5GTHH 5AVUB 5DJTB 2M8RA 2E74D 2K5XA 2AXCA 4Y99C 2WZ7A 3KQGA 4DZOA 1Q7YQ 1JCCA 4D6TJ 3B5NA 3L72E 1JY2P 2PNGA 3L4FA 2FHSC 4JYCA 1W2EA 3B5NC 1J1EB 2EG5A 5AW6B 1KFNA 1DD4A 2WT7A 1U57A 2G8YA 2WPRA 2MJZA 3M1MA 2D2CB 2YXQB 1A43A 3RGUA 1KB9D 1M1JC 1JNMA 3VYIA 7CEIA 4BPGA 1KILD 2AEMA 2KS1B 3TGUD 2FVFA 1ZXGA 3TGUG 3DS1A 3E7KA 3GF7A 4DJGA 1NTKK 2R5DA 2HODB 4H13B 3LRYA 1L0NJ 4KJMA 2V7QJ 1JB0J 2YKPA 2QJPC 3B8EB 4PWVB 2QVAA 2E75B 2N9YB 4H0LC 1NTMG 4GODA 3USSA 2IBZE 5EFWB 1QVGO 3CXHD 2WPSA 1NTMD 4IFMA 1ZRTD 2M3EA 1DEEG 2WPVB 3RBZA 1G2CA 3OAKA 3TDKA 2IPPA 4HB1A 1LWUA 3V4QA 3TYYA 1BAJA 1OW6A 3CCJP 1SQQD 4W7YA 4WB4A 5KLIB 2WT7B 2L91A 3L71J 1GK6A 3M91A 1SQBJ 4HH2A 3BASA 2N1TA 3CX5D 1VF5B 1GL2D 2Y9ZA 2KOQA 1HWTC 4EDFA 1QX8A 4B86A 1NYHA 1UIIA 3L71D 2P67A 1QVFO 2N5HA 5KAIE 4MN4C 1GU4A 2BHVA 2LXBA 2Q3IA 4I1LA 2B88A 3G6EP 4UB8H 1J1EC 2KG6A 1JM0A 3HUSB 1N7SA 1EDIA 2N1TC 4UB8E 1HGVA 3H1KG 3HE4A 1VQPP 3UIAA 3L75G 3MP7B 2MR8A 2KP8A 1N7SC 1ACPA 4TLFA 5JPAA 3G0VA 4Y99B 2A06E 1CW5A 4PJ0E 1VQOP 2LR2A 2JBGA 2ITAA 5BVZA 1KILC 3BCCG 3NTNA 2XZ1C 2WPTA 2I1JA 3L71G 2ZT9B 2KR5A 2JJLA 2FFDC 2JDIH 3L70G 5EW5E 5APWA 2QJPB 2JWAA 4OGQB 2N1TD 1M8OB 3JCUH 4GOEA 1ZW0A 2KOGA 2QJYC 2KGCA 1BCCD 3U43A 1P84E 3CX5I 2A45H 1U7JA 2H88C 1BGYD 1SS1A 3HZQA 1BDDA 4Y28J 1JY3N 2WWWA 1KV4A 2PGDA 2ZXEB 3DS0A 1KQLA 3LW5H 2BEQD 1OMIA 3RK2B 2B87B 2P10A 1SFCA 4YXWH 1IFDA 3Q1MA 1JTHB 3Q2YA 2VLPA 5AVXB 1Y9BA 4U3FD 1SFCC 3E2DA 3HD7C 1JJ2O 1IK7A 1EOQA 2KZJA 1NAYA 2P2UA 5CBNA 1K73Q 1YYCA 3CWBD 3IFMA 2ZYGA 1VQ9P 2W83C 1LT9A 1KMIZ 5AVZB 5HGOA 1EXJA 5CCHD 1AFOA 1VQMP 4XE5B 2IYPA 1T6AA 1HY8A 2HYNA 3V2RA 3L36A 2Q6QA 1EMVA 1HTLC 3GMAA 4KHXA 3PH0A 1NQ4A 2FYUK 1GDTA 2R32A 2MVUA 3O6QA 4W7ZA 1PEUA 2BCCG 2E1MA 3HE5A 1GMJA 1FZCA 1KYOD 3GZMA 2O3JA 2JYLA 5CCHC 1RE3A 3TGUJ 2BQ1E 3H1LJ 3P7KA 3W68A 2I8DA 3KHUA 2JAZA 2FYZA
chains in the Genus database with same CATH topology
2QA4P 3DS4A 2XV6A 1YIJP 2EIAA 3HZQA 2BUOA 1S72P 2DGYA 1YJ9P 2QEXP 1BAJA 3CCJP 3DS0A 2PEOA 1PEOA 1Q82Q 4WYMA 1K9MQ 3Q20A 1VQLP 3DS5A 4QNBA 4GR6A 3CD6P 3CPWO 3G28A 3G26A 2Z46A 1VQNP 4U0CA 2PY8A 1RO0A 1KQSO 3P05A 1YITP 4COPA 1YHQP 5I4TG 3H4EA 5F2OA 4XFZA 1D1DA 3B5IA 3E2DA 4M0IA 3CCQP 4U0EA 1Q7YQ 2PEQA 1JJ2O 1EOQA 1Q86Q 4XFXA 1QVFO 5F2NA 1VQ6P 1A8OA 1E6JP 1Q81Q 3CCLP 4IPYA 4COCA 3CXCO 1QRJA 1M6NA 1K73Q 1KD1Q 2XT1A 5BS1A 1VQ8P 2BHVA 1NJIQ 5DCKA 3G6EP 2Z44A 3OW2O 2P9XA 1KC8Q 3CCRP 3DPHA 3CCUP 1VQ5P 1IUQA 2L6EA 2PEKA 1VQ7P 2EG5A 1VQ9P 3H47A 1N8RQ 1YJWP 1ZMBA 3G71P 1RNIA 2JO0A 3WBHA 2CWOA 1VQ4P 2KODA 4U0BA 3DS2A 1VQPP 3H0DA 5HGOA 3HYBA 2PEMA 3M1MA 5BS2A 1VQMP 1A43A 2OARA 4PH1A 3CC2P 1M74A 1RO2A 3G0VA 5JPAA 5HGLA 1YJNP 4U0FA 3CCMP 1AUMA 1VQOP 3MGEA 2OTJP 3VRLC 2M8LA 5F2KA 4XROA 2LF4A 1W2BO 2ONTA 3CC4P 2OTLP 2PENA 3RG6C 3DS1A 3CCVP 2JYGA 1PEUA 1K30A 5HGNA 3I56P 1EIAA 1M6EX 3G1IA 3LRYA 3CCSP 2E1MA 3CMAP 1K8AQ 4XFYA 2PEIA 2M8NA 3DTJA 3G29A 3DS3A 5HGMA 2JYLA 3G4SP 2M8PA 4XRQA 4GR2A 2PEJA 3CCEP 2EFJA 1M90Q 2BQ1E 1QVGO 3NTEA 3CMEP 3I55P 3G21A 3CC7P 1PEQA 3G1GA 4U0DA 1PEMA 1M1KQ 1YI2P 4PH0A 4U0AA 2Z45A 1VQKP 2XXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP P;  2QA4 P;  3I56 P;  1YIJ P;  3CCS P;  3CCQ P;  1S72 P;  1YJ9 P;  3CMA P;  1VQM P;  1K8A Q;  1Q7Y Q;  2QEX P;  1JJ2 O;  3CC2 P;  3CCJ P;  1YJN P;  1Q86 Q;  1QVF O;  1VQ6 P;  1Q81 Q;  3CCL P;  1Q82 Q;  1K9M Q;  3CXC O;  1VQL P;  3CD6 P;  3G4S P;  1K73 Q;  1KD1 Q;  3CCM P;  1VQ8 P;  3CPW O;  1VQO P;  1NJI Q;  3CCE P;  3G6E P;  2OTJ P;  1M90 Q;  1VQN P;  1W2B O;  3OW2 O;  1QVG O;  1KC8 Q;  3CCR P;  3CME P;  3CC4 P;  2OTL P;  3CCU P;  1VQ5 P;  3I55 P;  3CC7 P;  1KQS O;  1VQ7 P;  1VQ9 P;  1N8R Q;  3CCV P;  1M1K Q;  1YJW P;  3G71 P;  1YI2 P;  1VQ4 P;  1VQK P;  1YIT P;  1YHQ P; 
#chains in the Genus database with same CATH topology
 1HF9 A;  4R4L A;  3SWY A;  3U1C A;  2N1T B;  1NWQ A;  3QH9 A;  2KNC B;  1YJ9 P;  4UB6 E;  3V2N A;  3M0D C;  2G3A A;  2ZT9 D;  2FXP A;  1X0T A;  4A7P A;  3CD6 P;  3AEB C;  1BDC A;  1WT6 A;  1PGJ A;  2VRS A;  3II6 A;  3HTK A;  4D6T G;  4YTP C;  1U7M A;  4COP A;  1LP1 A;  3A0B E;  1D1D A;  4PXH B;  3L73 J;  4M0I A;  1P84 H;  3KDP B;  1XTG B;  1N7S B;  1UJZ A;  5AW9 B;  2JP3 A;  1SQP D;  1VQ5 P;  1CEI A;  1YJW P;  2Q1K A;  2ROQ A;  2KOD A;  3JCU E;  4OWF A;  3H0D A;  1BSH A;  4IL6 X;  1GK4 A;  3MHV A;  1SQQ E;  2E76 C;  4C46 A;  3H1H D;  1L0N D;  1SQX D;  3SWF A;  2PEN A;  3RG6 C;  2AEJ A;  2E43 A;  2Z5I A;  4NPD A;  2WSF J;  2MY5 A;  1JOC A;  1T3U A;  2K2Q A;  2FY8 A;  1H0T B;  2K0X A;  5KLV E;  2PEI A;  2VLN A;  3DTJ A;  1NTZ K;  3QWO C;  3ZDM A;  2OYO A;  2OYI B;  4H44 D;  2HFE D;  1NU1 E;  2CNR A;  2VLO A;  2L9F A;  3GLM A;  1A02 F;  1YI2 P;  2YNY A;  4EIJ A;  1KLP A;  2XNX A;  4N3Y B;  2QJK C;  3H1J E;  1S72 P;  2K92 A;  3B5N B;  1NTM K;  1PPJ G;  4ZKP A;  1K9M Q;  3V2Q A;  2HLO A;  2K9J A;  3G26 A;  1SFC D;  2WVR A;  1KIL E;  1S9K E;  5AVS B;  1L0I A;  3VMZ A;  3IR9 A;  5AW2 B;  2OTK E;  1K04 A;  5GTI E;  1EZV G;  3BCC E;  2FQ2 A;  3PP5 A;  3CX5 H;  3MTU E;  3KZI E;  1Q86 Q;  4ZKU A;  3CCL P;  2QM7 A;  1M6N A;  1ZNV A;  1X8Y A;  1VQ8 P;  3WMM 0;  2AVA A;  1IUQ A;  1SQP G;  2PEK A;  1R5L A;  4WBA A;  4H13 C;  2JWD A;  1JY2 N;  2OAR A;  4HYT B;  1QLE D;  3S4R A;  4DCK A;  1NTK J;  2E74 B;  1JY3 P;  2GDX A;  1RQU A;  2Z5H A;  2QM8 A;  4AYC A;  3MGN A;  2A45 G;  4UB6 H;  1S5L X;  1AVY A;  1MZ9 A;  1VF5 C;  4UHP B;  3AE2 C;  1GL2 A;  5AVQ B;  1NTM J;  4PD4 H;  5H2F H;  1PPJ E;  1S5L H;  1GW3 A;  2IZ1 A;  5KKZ C;  2EHS A;  2PRR A;  5CZD B;  4HKZ H;  2E42 A;  1PEM A;  1M1K Q;  1NVO A;  2BCC J;  5AVR B;  3LID A;  3CWB E;  3H1I G;  1BE3 D;  1LGH B;  1YTZ I;  2D2C C;  2OYH B;  4YPC A;  3H1H E;  1J2J B;  1PEO A;  3EJB A;  1Q2N A;  4GR6 A;  1SQB G;  4OVN F;  5GTH E;  1URQ D;  3TK1 A;  1VF5 D;  2JO1 A;  2Y0E A;  4JF7 A;  2QSI A;  4H2X C;  1RO0 A;  1FAV A;  1OFC X;  1LT1 A;  1FOS E;  2B87 A;  1LTI C;  2LL8 A;  3BCC D;  3M0A A;  3R2P A;  3Q3D A;  1ZLL A;  4NEO A;  5F2N A;  5BU5 A;  1EZV E;  1RF1 A;  1IZN B;  5CMZ A;  2GZJ A;  3MD0 A;  1AQ5 A;  3BRV B;  1H88 A;  4C7N A;  3L73 G;  3EQ2 A;  2KSJ A;  3CE7 A;  1PGQ A;  3MUD C;  3L73 D;  3HYB A;  3H1K D;  4H13 D;  2K94 A;  1PZQ A;  1M56 D;  3KZI H;  2FXM A;  2J59 M;  1AUM A;  1AJY A;  1SQP J;  2ZYD A;  1FDO A;  2ONT A;  2XND H;  4I2L C;  5KKZ B;  2O01 H;  2OYI A;  2QE7 H;  1FE6 A;  1GXH A;  3H1K J;  3W67 A;  2D2C D;  3MIW A;  4ZNC A;  2ERH A;  1L0L E;  5AW0 B;  3I5C A;  3BAT A;  1S3J A;  2Q7C A;  4PV1 B;  5KP8 B;  3CME P;  3V4W A;  1LTJ A;  4U0A A;  1VQK P;  1BSN A;  2FYU E;  2QA4 P;  2MR7 A;  1SQQ G;  3CXH H;  4KT0 J;  3TNU A;  1NH4 A;  3VP8 A;  2W8Z A;  2FQ1 A;  2KNC A;  4BRY B;  2HR3 A;  3A5T A;  4XFJ A;  1LT9 B;  1L0H A;  2Y9Y A;  4YXD C;  5I4T G;  1AVO A;  1E6J P;  1H8A A;  1SQP K;  4AQR D;  3A0H H;  2Z44 A;  3EJD A;  2P9X A;  2ZVN B;  4WVZ A;  2L6E A;  2KGD A;  3GHG A;  1JUN A;  3VTP C;  1RQV A;  1VQ4 P;  4U0B A;  3AE1 C;  2XV5 A;  2PFX A;  5AW5 B;  1T8K A;  1SQV J;  5H2F E;  1MUU A;  2Q5U A;  3VN0 A;  1BCC G;  2LIU A;  1ZOY C;  2KI7 B;  1OWA A;  1HH0 A;  2W27 A;  4BPH A;  3RL0 C;  2JQ4 A;  2R3S A;  1R5S A;  2OTL P;  1KB9 H;  3U59 A;  2C0W A;  4R4M A;  1K05 A;  2KB7 P;  3GHG C;  1K30 A;  3HD7 D;  1IFJ A;  5C39 A;  1D7M A;  4U3F J;  2A06 G;  3CMA P;  1JY2 O;  5AW1 B;  3M9H A;  5HV8 A;  3KXD A;  1OVR A;  4U7J A;  1X3O A;  3G4S P;  5AW4 B;  2M8P A;  1PIX A;  2JU1 A;  2HOD A;  1SQX K;  3R4Y A;  2RN0 A;  3CC7 P;  4U0D A;  1IJD B;  1LP1 B;  2FYN B;  1XTC C;  3B5N D;  1UNK A;  4DG9 A;  4PD4 D;  1FBM A;  1NAF A;  2XXM A;  1YIJ P;  2Y0C A;  1URQ C;  3L75 J;  3CXH I;  3L70 D;  2K88 A;  2KOP A;  1FZC B;  2PP6 A;  1YBK A;  2WSE H;  1EDL A;  1OIP A;  5GTI H;  1L0N G;  3WUV A;  3PLN A;  3H1I J;  1BCC J;  2FFD B;  3L74 E;  1RE4 A;  3KPE A;  4L76 A;  3L74 D;  3SWK A;  1Q90 D;  5E79 H;  2ZT9 C;  3RK3 E;  3L72 J;  1UIX A;  3RL0 D;  5TIS E;  4WY4 D;  3GF3 A;  1HGZ A;  3B4Q A;  1VQ7 P;  1N8R Q;  2LOL A;  2KWL A;  2LXC B;  5KLV D;  1HJB A;  2B89 A;  2GZF A;  3JC2 2;  2FVE A;  2O01 J;  5KLV G;  5TJH A;  1CZQ A;  2N50 A;  3WU2 H;  2SPZ A;  5AVW B;  2P7J A;  1KIL A;  1USD A;  3H1L D;  4H44 C;  3HUS C;  1NKZ B;  2DW3 A;  4DOJ A;  3CCV P;  5CBO A;  1AF8 A;  3D71 A;  2E5Y A;  1LTS C;  1KZU B;  1Y47 A;  3CCS P;  3WUT A;  4XA4 A;  4BPF A;  2FFD A;  3H6P A;  1A02 J;  2YIU B;  1EQ7 A;  2R44 A;  3M06 A;  1R8E A;  2GDY A;  2K9Y A;  3F89 A;  1IFI A;  3EJE A;  2EIA A;  2P1J A;  2E76 D;  4I7Z C;  3A3Y B;  1QL2 A;  4H2Y C;  5APX A;  3SFE C;  3A7O A;  3CPW O;  1VHN A;  3PTZ A;  3TSI A;  1L0L G;  2WIT A;  3K5B A;  1X9V A;  1L4A A;  2OGU A;  1SQQ J;  1YHQ P;  1JMB A;  1KYO H;  3B5I A;  2W90 A;  2XKM A;  3C1L A;  4U0E A;  1SFC B;  2E5T A;  3FWN A;  1QRJ A;  3SFD C;  2FKW B;  1MZ8 A;  3AE8 C;  3FX0 A;  2H89 C;  2GYK A;  4QMA A;  2QJK B;  1RF0 A;  1FDI A;  1JMM A;  1NTZ G;  4LC1 A;  1OX3 A;  5KJ7 D;  2N6Y A;  3CC2 P;  1RO2 A;  3L70 J;  4H44 B;  3V6I A;  1SQV D;  3L72 G;  3MGE A;  3VRL C;  5CCG A;  4GKG A;  2FAC A;  2L22 A;  1IMQ A;  2L4B A;  5AVV B;  3NMD A;  2GDW A;  1EIA A;  3H1J D;  3N7N A;  5BU8 B;  1JCD A;  2B9B A;  1ZR4 A;  1Y8A A;  2KXP B;  2LML A;  3HE4 B;  4CA3 A;  2ZFC A;  1MFZ A;  1W5C E;  2A45 I;  4JPZ B;  4M3L A;  5APQ A;  2Z45 A;  2POH A;  2RKL A;  1VDF A;  2YMY A;  1LTB C;  2CG5 B;  1NU1 J;  2NRG A;  3H1L E;  1T2K C;  5M1B A;  1IFP A;  1M57 D;  3Q20 A;  4QNB A;  1RHZ B;  2H7H A;  3FXE A;  3U1A A;  2ZXX A;  4U0C A;  4O9B A;  1QL1 A;  4HJG H;  4BXL A;  1N7S D;  2A06 D;  2BAS A;  2KZI A;  1QGK B;  2DNW A;  3V2P A;  5E79 E;  1J1D C;  5B66 H;  1BXI A;  2WSE J;  1Q81 Q;  1MV8 A;  2WSC H;  2WSF H;  3L74 J;  1KB9 E;  3T97 B;  1KD1 Q;  5BS1 A;  4TT3 H;  2MF4 A;  2KK7 A;  3L35 A;  1KN7 A;  1T2K D;  3H47 A;  1HJ0 A;  1NTZ J;  2CWO A;  2M5R A;  2IYO A;  1FZA A;  1SQP E;  4U0F A;  3L70 E;  1DX7 A;  3CCM P;  3D6Y A;  1RF1 B;  2M8L A;  5F2K A;  2LKM A;  4XRO A;  5AVT B;  1W2B O;  2LTE A;  1GPJ A;  2IFN A;  5EJD A;  2FVA A;  3AE9 C;  3PJS K;  2YKQ A;  3CXH E;  3L74 G;  2FQ0 A;  2KG8 A;  2QG4 A;  1M6E X;  3G1I A;  1BE3 E;  1SQX E;  4Z1M H;  1GL2 B;  4I7Z B;  1ZP0 C;  4GDO A;  3P8C E;  2M8N A;  1L4A D;  1N73 A;  2WQY C;  2WSS H;  1YQ3 C;  4GR2 A;  2JEE A;  3RK3 B;  2O1J A;  2KGA A;  3G1G A;  1NTK E;  1SQV G;  2N9B A;  2K3R A;  4PH0 A;  2C9L Y;  1EDK A;  1SQX J;  2XDJ A;  3FWL A;  2WMM A;  1X22 A;  3H1I D;  3N4X A;  5AW3 B;  2PEO A;  1OW7 A;  1GW4 A;  1H89 A;  2W6J H;  1OVU A;  3CWB J;  2E75 D;  1LT9 C;  2I1K A;  1JEK A;  3P05 A;  4H2W C;  1LTJ C;  1LTJ B;  3H4E A;  5F2O A;  3L73 E;  2JGP A;  4R0M A;  5HVC A;  1G1J A;  3ABV C;  3VOP A;  5KLI C;  1LTT C;  1A8O A;  1HVV A;  4H0L D;  5CHX A;  3RK2 D;  3HD7 A;  1AV1 A;  1SQV K;  3GJN A;  2WTY A;  1TU3 F;  1PP9 J;  1KC8 Q;  1N2D C;  3CCU P;  4PV1 C;  2KLU A;  2IBZ G;  1ZMB A;  5AVY B;  3WBH A;  3DS2 A;  3ITK A;  3NXS A;  2IFM A;  2PEM A;  5BS2 A;  4N6J A;  2K37 A;  4PD4 E;  2CQ8 A;  2FAD A;  1WMK A;  2KW2 A;  1FR2 A;  3Q5P A;  2GM4 A;  1KQG B;  5KAI H;  3H1H G;  1BGY E;  1EXI A;  4OGQ D;  2J58 A;  2KLV A;  5KTB A;  1FZC C;  1YTZ T;  5B5E H;  1URQ A;  2Y0D A;  4D6T E;  3P8C D;  3OA7 A;  4K3A A;  2ZVO B;  3A2A A;  2E75 C;  1HUC A;  4WWI A;  3GG2 A;  1PFI A;  2KOR A;  3I55 P;  1WRG A;  2WSC J;  3H32 A;  1NTZ D;  2MKV A;  1SLQ A;  1BE3 G;  1SQX G;  5AW8 B;  1RE4 C;  1DV5 A;  3AEG C;  1JY3 O;  4BRY A;  4L73 A;  1Q82 Q;  1GU5 A;  3IF4 A;  1RY3 A;  1LWU C;  2IZ0 A;  4OH8 B;  2Z46 A;  1J1D B;  1KYO E;  1H0T A;  5AW7 B;  3T97 A;  3PHL A;  2X2B A;  1FC2 C;  5KP6 B;  1G1I A;  5KAF E;  2KIK A;  3AE7 C;  4LLH A;  4IPY A;  3CXC O;  3P32 A;  3CWB G;  2LPK A;  2RMZ A;  4IL6 E;  1S2E A;  3BVH A;  1L2P A;  2HG5 D;  1AQT A;  1KFM A;  3S1K A;  2ZJS E;  2JR8 A;  1HBW A;  1N73 C;  3H32 B;  3AEF C;  5HGL A;  1EZV D;  3FGA D;  3JSV C;  1LTA C;  3E1I A;  3BRT B;  3G3Z A;  1CSB A;  5KLV K;  2OYI C;  3RL0 g;  2M0B A;  3SSU A;  4K35 A;  2MD9 A;  3OJA B;  5HGN A;  1N86 A;  3EFF K;  2V4H A;  3MUD A;  4EI2 A;  4IFF A;  5KP7 B;  2AFD A;  1S5L E;  4D6T D;  2K1A A;  1DIP A;  1N7L A;  2O1K A;  4GIF A;  1NTM E;  2LIW A;  1CI6 A;  2YIU C;  1KIL B;  3TGU E;  2KOS A;  2GUS A;  3LW5 J;  4C7R A;  1PEQ A;  2W6A A;  4IZ6 A;  1USE A;  3CLQ A;  4H0L B;  5B66 E;  1IK9 A;  2OYH C;  1JTH A;  5B5E E;  1G2C B;  1NTZ E;  1HQB A;  1NOH A;  2CGQ A;  2WPQ A;  3NY7 B;  1VQL P;  3DS5 A;  1KYO I;  2KUB A;  2VLQ A;  1FS0 E;  2Z4E A;  1SQB K;  2XU6 A;  4OGQ C;  1RF0 C;  3TNU B;  2KSE A;  2AFE A;  3L71 E;  1FOS F;  1NU1 K;  5KJ7 C;  4F37 A;  4XFX A;  3H1J G;  4IL6 H;  2M3B A;  5KAF H;  2Q9I A;  1EZV I;  2NZ2 A;  3RK3 D;  1NU1 G;  3VP9 A;  3A0H E;  3G71 P;  5APT A;  1KQF B;  1DH3 A;  1SQB E;  2UWJ E;  1L4A C;  1NO4 A;  1L4A B;  1L0N K;  2GZI A;  3IN6 A;  1IFM A;  4PJ0 H;  1YJN P;  2MVV A;  3H1I E;  2QNW A;  1EDJ A;  1FZG A;  4ASW A;  1MFT A;  3GHG B;  2PAJ A;  1LTG C;  1EC5 A;  2OTJ P;  1FJK A;  2L0Q A;  1IO4 A;  3D70 A;  3L72 D;  5L8R J;  2H8P D;  2CPB A;  1NGM B;  2NPS B;  2JYG A;  2ZYA A;  5CCG C;  3I56 P;  1BCC E;  1BE3 J;  5CCH A;  3LIE A;  3PRJ A;  5KLV J;  3GKL C;  1ZR2 A;  3M9Q A;  1PP9 G;  3G29 A;  3GW6 A;  1L0L K;  5HGM A;  4C7N B;  3CCE P;  2YKO A;  3CL3 D;  3EWK A;  5APY A;  1ZN5 A;  2KS1 A;  3VMX A;  1GL2 C;  3M0D A;  2ZAE B;  4L74 A;  1OVV A;  1GD2 E;  1OXZ A;  2DGY A;  2AXT E;  3TF5 A;  1BGY G;  4ASV A;  3IAO A;  3VMA A;  1GZL A;  1SQQ K;  3P8M C;  2AEF A;  1L0L D;  2K0D X;  1IC2 A;  1GTW A;  4JBZ A;  2YO3 A;  4W80 A;  2IBZ I;  1NKN A;  1KQS O;  1NHL A;  4DT0 A;  3AE4 C;  2LKI A;  1T8Z A;  3Q5S A;  1PP9 D;  4XFZ A;  2XZ0 D;  1BGY J;  1Z56 A;  2PEQ A;  5APU A;  2FYU G;  2CK3 H;  1DNY A;  1L0N E;  1NJI Q;  4WY4 B;  3DPH A;  1M7L A;  3RL0 B;  2K93 A;  2P58 A;  5DJU B;  3L75 D;  4MRT C;  2JO0 A;  2JB0 A;  1PGO A;  1FZB A;  2FYN C;  1SVF A;  1N73 B;  4I6M C;  3CI9 A;  1VL2 A;  3B4S A;  1P84 I;  2N98 A;  3CX5 E;  2Q3E A;  1PV3 A;  2H43 A;  3AE5 C;  2FYU J;  3HUS A;  4RJT A;  1AA0 A;  2NO8 A;  1SQV E;  4XFY A;  5APS A;  2JU2 A;  2BCC D;  3DS3 A;  2AF8 A;  1DD3 A;  2XZR A;  3D6Z A;  2NPS C;  4JYB A;  3V5B A;  1MKM A;  2IDB A;  2JKV A;  3NTE A;  3G9R A;  1OZH A;  2GUV A;  3C9I A;  4RES B;  4LGD E;  1LWU B;  2K9J B;  3DS4 A;  1X79 B;  4WY4 A;  2OQQ A;  1VKU A;  4EYY Q;  3HD7 B;  2R5B A;  1PGP A;  2GZE A;  4WYM A;  1VPC A;  1RH5 B;  1OW8 A;  3L37 A;  3AEC C;  3G28 A;  4NPE A;  1VQN P;  2PY8 A;  5KJ7 A;  1Z6M A;  1IMP A;  1ZV8 A;  4U3F G;  2HPC B;  4HKG A;  3HTK B;  4ZMD A;  3VMY A;  3H1K E;  1OR5 A;  1E5W A;  3HRN A;  2E76 B;  3CCQ P;  1KOR A;  1M1J A;  3LMO A;  4WY4 C;  4EOT A;  3A0B H;  2YO2 A;  2KYV A;  2KOO A;  2FBW C;  3O6Q B;  2CPS A;  1DEB A;  1ZRT E;  4AUW A;  1RNI A;  4GT1 A;  4CPG A;  3RG2 A;  2QIW A;  1YQ4 C;  4PH1 A;  5APV A;  2C9N Y;  1RE3 C;  3KYQ A;  1JO5 A;  5CCG D;  2LF4 A;  3H1L G;  2FYU D;  3M9B A;  2FAE A;  3WUU A;  3C8V A;  1PPJ D;  3MZW B;  4GOF A;  1F80 D;  2GZG A;  2BCC E;  2EHT A;  3AE6 C;  1SP4 A;  1IFN A;  2YXR B;  5K5G B;  2YMK A;  1NU1 D;  4RO0 A;  3BCC J;  2PEJ A;  1KTM A;  1M1J B;  4PV1 D;  3H1H J;  1LNQ A;  2FXO A;  1S4X A;  2K0Y A;  2KG9 A;  1GXG A;  2AXT H;  4N78 D;  2V7Q H;  3F5H A;  3Q5R A;  2XV6 A;  2R3C A;  4N78 E;  2IX7 C;  3O8Z A;  2QJY B;  1S9K D;  2O01 N;  3AEA C;  4JQ0 D;  3H1J J;  2KGE A;  1ZME C;  2N5I A;  1L0L J;  4IFD K;  1E79 H;  4PD4 I;  1YIT P;  1PL5 A;  1FZE A;  2J5U A;  1VQ6 P;  4L75 A;  2L5G B;  4COC A;  1P84 D;  2XT1 A;  4NPF X;  5CJ0 A;  1S1C X;  5DCK A;  5CJ4 A;  3AEE C;  3OW2 O;  2N6Z A;  3CCR P;  4IOI H;  3FXD A;  1KB9 I;  1RF1 C;  2E74 C;  3EFG A;  2M5A A;  3WU2 E;  1E0H A;  1T3J A;  1M74 A;  1CI6 B;  3E1R A;  1QEX A;  1NTK G;  1FZF A;  3CC4 P;  1URQ B;  3RK2 C;  1LJ2 A;  2QRX A;  3HE5 B;  1FU1 A;  4U3F E;  1PP9 E;  2GA1 A;  1FJP A;  2NPS A;  2IBZ D;  2NPS D;  1K8A Q;  2W6B A;  3RBX A;  2BEZ F;  4RKU J;  4BWN A;  3B71 A;  3S9O A;  1FDM A;  1AYI A;  4XRQ A;  2EFJ A;  1M90 Q;  3G21 A;  3RK3 C;  3GZL A;  4QKO A;  2BUO A;  3H25 A;  2HPC A;  2QEX P;  2RH0 A;  2C0X A;  1NTK D;  3L75 E;  5TIS H;  3AED C;  2M5A B;  2VSQ A;  2OYH A;  3NFQ A;  1SQB D;  3AE3 C;  5GTH H;  5AVU B;  5DJT B;  2M8R A;  2E74 D;  2K5X A;  2AXC A;  4Y99 C;  2WZ7 A;  3KQG A;  4DZO A;  1Q7Y Q;  1JCC A;  4D6T J;  3B5N A;  3L72 E;  1JY2 P;  2PNG A;  3L4F A;  2FHS C;  4JYC A;  1W2E A;  3B5N C;  1J1E B;  2EG5 A;  5AW6 B;  1KFN A;  1DD4 A;  2WT7 A;  1U57 A;  2G8Y A;  2WPR A;  2MJZ A;  3M1M A;  2D2C B;  2YXQ B;  1A43 A;  3RGU A;  1KB9 D;  1M1J C;  1JNM A;  3VYI A;  7CEI A;  4BPG A;  1KIL D;  2AEM A;  2KS1 B;  3TGU D;  2FVF A;  1ZXG A;  3TGU G;  3DS1 A;  3E7K A;  3GF7 A;  4DJG A;  1NTK K;  2R5D A;  2HOD B;  4H13 B;  3LRY A;  1L0N J;  4KJM A;  2V7Q J;  1JB0 J;  2YKP A;  2QJP C;  3B8E B;  4PWV B;  2QVA A;  2E75 B;  2N9Y B;  4H0L C;  1NTM G;  4GOD A;  3USS A;  2IBZ E;  5EFW B;  1QVG O;  3CXH D;  2WPS A;  1NTM D;  4IFM A;  1ZRT D;  2M3E A;  1DEE G;  2WPV B;  3RBZ A;  1G2C A;  3OAK A;  3TDK A;  2IPP A;  4HB1 A;  1LWU A;  3V4Q A;  3TYY A;  1BAJ A;  1OW6 A;  3CCJ P;  1SQQ D;  4W7Y A;  4WB4 A;  5KLI B;  2WT7 B;  2L91 A;  3L71 J;  1GK6 A;  3M91 A;  1SQB J;  4HH2 A;  3BAS A;  2N1T A;  3CX5 D;  1VF5 B;  1GL2 D;  2Y9Z A;  2KOQ A;  1HWT C;  4EDF A;  1QX8 A;  4B86 A;  1NYH A;  1UII A;  3L71 D;  2P67 A;  1QVF O;  2N5H A;  5KAI E;  4MN4 C;  1GU4 A;  2BHV A;  2LXB A;  2Q3I A;  4I1L A;  2B88 A;  3G6E P;  4UB8 H;  1J1E C;  2KG6 A;  1JM0 A;  3HUS B;  1N7S A;  1EDI A;  2N1T C;  4UB8 E;  1HGV A;  3H1K G;  3HE4 A;  1VQP P;  3UIA A;  3L75 G;  3MP7 B;  2MR8 A;  2KP8 A;  1N7S C;  1ACP A;  4TLF A;  5JPA A;  3G0V A;  4Y99 B;  2A06 E;  1CW5 A;  4PJ0 E;  1VQO P;  2LR2 A;  2JBG A;  2ITA A;  5BVZ A;  1KIL C;  3BCC G;  3NTN A;  2XZ1 C;  2WPT A;  2I1J A;  3L71 G;  2ZT9 B;  2KR5 A;  2JJL A;  2FFD C;  2JDI H;  3L70 G;  5EW5 E;  5APW A;  2QJP B;  2JWA A;  4OGQ B;  2N1T D;  1M8O B;  3JCU H;  4GOE A;  1ZW0 A;  2KOG A;  2QJY C;  2KGC A;  1BCC D;  3U43 A;  1P84 E;  3CX5 I;  2A45 H;  1U7J A;  2H88 C;  1BGY D;  1SS1 A;  3HZQ A;  1BDD A;  4Y28 J;  1JY3 N;  2WWW A;  1KV4 A;  2PGD A;  2ZXE B;  3DS0 A;  1KQL A;  3LW5 H;  2BEQ D;  1OMI A;  3RK2 B;  2B87 B;  2P10 A;  1SFC A;  4YXW H;  1IFD A;  3Q1M A;  1JTH B;  3Q2Y A;  2VLP A;  5AVX B;  1Y9B A;  4U3F D;  1SFC C;  3E2D A;  3HD7 C;  1JJ2 O;  1IK7 A;  1EOQ A;  2KZJ A;  1NAY A;  2P2U A;  5CBN A;  1K73 Q;  1YYC A;  3CWB D;  3IFM A;  2ZYG A;  1VQ9 P;  2W83 C;  1LT9 A;  1KMI Z;  5AVZ B;  5HGO A;  1EXJ A;  5CCH D;  1AFO A;  1VQM P;  4XE5 B;  2IYP A;  1T6A A;  1HY8 A;  2HYN A;  3V2R A;  3L36 A;  2Q6Q A;  1EMV A;  1HTL C;  3GMA A;  4KHX A;  3PH0 A;  1NQ4 A;  2FYU K;  1GDT A;  2R32 A;  2MVU A;  3O6Q A;  4W7Z A;  1PEU A;  2BCC G;  2E1M A;  3HE5 A;  1GMJ A;  1FZC A;  1KYO D;  3GZM A;  2O3J A;  2JYL A;  5CCH C;  1RE3 A;  3TGU J;  2BQ1 E;  3H1L J;  3P7K A;  3W68 A;  2I8D A;  3KHU A;  2JAZ A;  2FYZ A; 
#chains in the Genus database with same CATH homology
 2QA4 P;  3DS4 A;  2XV6 A;  1YIJ P;  2EIA A;  3HZQ A;  2BUO A;  1S72 P;  2DGY A;  1YJ9 P;  2QEX P;  1BAJ A;  3CCJ P;  3DS0 A;  2PEO A;  1PEO A;  1Q82 Q;  4WYM A;  1K9M Q;  3Q20 A;  1VQL P;  3DS5 A;  4QNB A;  4GR6 A;  3CD6 P;  3CPW O;  3G28 A;  3G26 A;  2Z46 A;  1VQN P;  4U0C A;  2PY8 A;  1RO0 A;  1KQS O;  3P05 A;  1YIT P;  4COP A;  1YHQ P;  5I4T G;  3H4E A;  5F2O A;  4XFZ A;  1D1D A;  3B5I A;  3E2D A;  4M0I A;  3CCQ P;  4U0E A;  1Q7Y Q;  2PEQ A;  1JJ2 O;  1EOQ A;  1Q86 Q;  4XFX A;  1QVF O;  5F2N A;  1VQ6 P;  1A8O A;  1E6J P;  1Q81 Q;  3CCL P;  4IPY A;  4COC A;  3CXC O;  1QRJ A;  1M6N A;  1K73 Q;  1KD1 Q;  2XT1 A;  5BS1 A;  1VQ8 P;  2BHV A;  1NJI Q;  5DCK A;  3G6E P;  2Z44 A;  3OW2 O;  2P9X A;  1KC8 Q;  3CCR P;  3DPH A;  3CCU P;  1VQ5 P;  1IUQ A;  2L6E A;  2PEK A;  1VQ7 P;  2EG5 A;  1VQ9 P;  3H47 A;  1N8R Q;  1YJW P;  1ZMB A;  3G71 P;  1RNI A;  2JO0 A;  3WBH A;  2CWO A;  1VQ4 P;  2KOD A;  4U0B A;  3DS2 A;  1VQP P;  3H0D A;  5HGO A;  3HYB A;  2PEM A;  3M1M A;  5BS2 A;  1VQM P;  1A43 A;  2OAR A;  4PH1 A;  3CC2 P;  1M74 A;  1RO2 A;  3G0V A;  5JPA A;  5HGL A;  1YJN P;  4U0F A;  3CCM P;  1AUM A;  1VQO P;  3MGE A;  2OTJ P;  3VRL C;  2M8L A;  5F2K A;  4XRO A;  2LF4 A;  1W2B O;  2ONT A;  3CC4 P;  2OTL P;  2PEN A;  3RG6 C;  3DS1 A;  3CCV P;  2JYG A;  1PEU A;  1K30 A;  5HGN A;  3I56 P;  1EIA A;  1M6E X;  3G1I A;  3LRY A;  3CCS P;  2E1M A;  3CMA P;  1K8A Q;  4XFY A;  2PEI A;  2M8N A;  3DTJ A;  3G29 A;  3DS3 A;  5HGM A;  2JYL A;  3G4S P;  2M8P A;  4XRQ A;  4GR2 A;  2PEJ A;  3CCE P;  2EFJ A;  1M90 Q;  2BQ1 E;  1QVG O;  3NTE A;  3CME P;  3I55 P;  3G21 A;  3CC7 P;  1PEQ A;  3G1G A;  4U0D A;  1PEM A;  1M1K Q;  1YI2 P;  4PH0 A;  4U0A A;  2Z45 A;  1VQK P;  2XXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...