1VQ7P

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq7P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq7P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq7P02
3G71P 1YJ9P 3CMAP 2QEXP 1YITP 3CC7P 3CC4P 1Q81Q 1S72P 1Q86Q 1VQ5P 3G4SP 3I56P 1K8AQ 1KD1Q 1M90Q 1VQ4P 2OTLP 1Q7YQ 2OTJP 1VQLP 1VQNP 3OW2O 1YI2P 1Q82Q 1K9MQ 1W2BO 3CCQP 1YIJP 1N8RQ 1VQ7P 1JJ2O 1VQ8P 3CC2P 3CCSP 1QVFO 3CCMP 3I55P 3CCLP 1YJNP 1VQMP 1K73Q 3CCVP 3CMEP 1YHQP 1QVGO 2QA4P 3CCEP 1VQPP 3CD6P 1KC8Q 1NJIQ 3CXCO 1YJWP 3CCJP 3CCRP 3CPWO 1VQKP 1KQSO 1VQOP 1VQ6P 3G6EP 1VQ9P 1M1KQ 3CCUP
chains in the Genus database with same CATH superfamily
3CMAP 3V6IA 2BCCJ 2I1JA 3LW5J 5KJ7C 4OWFA 1KMIZ 3ABVC 1J1DB 2YNYA 2RH0A 2WMMA 5KLVE 1A43A 1OW8A 1AVYA 1J1DC 3H1HD 5B5EE 3A0HH 1GU5A 2KLVA 2KSEA 2ZXEB 2B88A 3WU2H 3AE4C 3GHGA 1SQBJ 3CX5I 2XZ1C 2MY5A 1X9VA 3D70A 1NTMK 2E75D 1AJYA 2KGDA 1GL2B 1RF0A 3CXHE 5KLIB 4WB4A 2GM4A 2M3BA 4IFDK 5KLIC 3FWNA 2PAJA 1S2EA 2LXBA 3JC22 5HVCA 3G29A 1U7MA 1JMBA 2YIUB 3CXHD 2FHSC 5DCKA 1NVOA 1YI2P 1EDJA 4W80A 2QRXA 3MP7B 4JF7A 1QL2A 3BRVB 1MFTA 2KIKA 4O9BA 1L4AD 5HGLA 4PV1B 3AE1C 5HV8A 4IOIH 3HZQA 2WPTA 1L4AB 2LR2A 1KQSO 2YO2A 2JB0A 4PV1C 2JWDA 1L4AC 1QX8A 1P84E 2PEKA 2BEZF 3SWKA 4OGQB 1RQVA 3M1MA 2OGUA 4QMAA 2OARA 1N2DC 3CC2P 3L73G 3GF3A 2KGCA 1MZ9A 4C46A 5APWA 1L0NK 1PZQA 2HFED 5GTIH 2KI7B 3AE3C 4U3FE 1YTZI 2FXOA 3OA7A 1NU1G 3E2DA 4MRTC 2EFJA 1N7SB 3UIAA 2FQ1A 5CCHD 1N8RQ 1YIJP 3AE9C 1ZV8A 1N7SC 4U3FD 1NWQA 1M57D 2MVVA 3R4YA 2KOQA 2MJZA 2KOSA 2CPBA 2OYIC 3DS1A 3BCCJ 5CCHC 3D71A 1PGPA 4ZKPA 3QH9A 1MFZA 2KWLA 4C7NB 2AEFA 2R32A 2MKVA 2QM7A 2BASA 1NHLA 1M8OB 2ZVOB 4COCA 2I8DA 4JQ0D 5AW5B 3I55P 4EYYQ 2JR8A 3WUVA 1K73Q 1HGZA 2M8RA 1WMKA 2XV6A 5GTHE 4EOTA 2IPPA 2J58A 2OTKE 3HUSB 3G1GA 1MUUA 1FC2C 3USSA 1EMVA 4GR6A 4U0DA 5APVA 3HUSC 3L75E 1LT9A 1RY3A 3RL0g 1HJ0A 1S5LX 2N1TD 2Z45A 3C8VA 4BRYA 2N1TB 2ZYGA 3BRTB 3C1LA 1S9KD 1OW7A 2W6JH 2L91A 3TGUG 1FZAA 2N1TC 2DGYA 5CCGD 3EJEA 3U1AA 1HBWA 4U0AA 2YO3A 3VRLC 1OX3A 2WSCJ 1H89A 2UWJE 4XFZA 2K9JB 1CSBA 2QJPC 2FFDB 5CCGC 2FYUG 1YTZT 3IF4A 2GZFA 3AEEC 2K88A 1T2KD 1RF1B 4XA4A 1PEOA 4WWIA 1RF1C 2IDBA 5KLVG 1E5WA 3SWYA 4H0LB 1T2KC 5CJ0A 3VMYA 4TLFA 4NEOA 3H0DA 3G0VA 2FBWC 4H0LC 1PEQA 2AXTH 2WSSH 3CCLP 5KJ7A 2Z46A 2GZJA 2MD9A 1OVRA 2HG5D 2L22A 3AEFC 2K94A 3KZIH 3H1JE 5EFWB 2Y9ZA 2MVUA 2IBZD 4WBAA 3D6YA 3WMM0 4UB8E 2FXPA 4UB6H 5BU5A 2LOLA 3RG6C 2WSEH 3H1JD 3B4SA 3LMOA 1GXGA 3DS4A 1LTBC 1UIIA 3RGUA 1BE3E 2E5TA 2QG4A 3JCUE 3CCVP 1ZP0C 2M5AB 4U0EA 2Y0DA 2KSJA 4HB1A 3AE2C 2K0XA 1LWUB 5HGNA 3G6EP 1FJKA 1KQLA 4XE5B 1BE3D 2R44A 2L5GB 3H25A 1LWUC 3RK3E 1FZBA 5L8RJ 1SS1A 1KZUB 2P10A 2B87B 1UIXA 1HJBA 3LIDA 3CLQA 4U0FA 1JTHB 3L70E 4JYCA 1VKUA 1YJ9P 3RK3B 3U1CA 5K5GB 1KD1Q 1L4AA 3RK3C 1Q82Q 4U3FG 5EW5E 2KZIA 4AYCA 3L70D 1SQVJ 3QWOC 1CI6B 4HKGA 3EFGA 1EZVE 2JKVA 1GTWA 1FZGA 3L71D 2Q3EA 2KG8A 5KAIE 5B5EH 5KLVK 3W67A 2Z5IA 3II6A 5KAFE 2Y9YA 3M0AA 2R3CA 1L0NJ 2L4BA 1QVFO 1PP9J 1A8OA 3M06A 2K1AA 1HF9A 3CCEP 3CD6P 3L74J 1N7SA 3DS3A 2J5UA 3V2NA 1BGYE 2OYIA 4F37A 4L75A 1OVUA 3H1ID 3CXHH 5CCHA 1SQPJ 4YXWH 4ASWA 2B89A 2H43A 2XKMA 3F89A 2P58A 1BGYD 1MZ8A 3RBZA 2YKQA 3L75G 4R4LA 3GHGB 2HODB 1OZHA 4DCKA 4R4MA 3CCJP 2KODA 1VPCA 1JY3P 2IZ1A 2ZT9D 1JO5A 3B8EB 2ZT9B 1LP1B 3HUSA 3P8CE 2WSFH 1NTKJ 2ZT9C 1P84H 4UHPB 2KG6A 2E43A 4H2XC 3AEBC 3CX5E 4IL6E 1KFNA 1XTCC 2N1TA 3H32B 2POHA 3DS5A 1JY3N 4RESB 1FZFA 2QSIA 3IR9A 2WPQA 3HD7D 3JSVC 2CK3H 3V4WA 2IBZI 2PEMA 2KOPA 1U57A 2HYNA 1VQPP 5CCGA 2H89C 7CEIA 1HGVA 3HD7B 3G28A 2NZ2A 4JYBA 5APQA 2OYHB 4JPZB 1DEBA 3HD7C 2OYHC 1QLED 1JEKA 2PP6A 1RF1A 4A7PA 2YKPA 1PEMA 4L74A 3L73J 3V5BA 3B5IA 1VQMP 4HH2A 1RE3C 1NU1J 1BE3G 4GDOA 5GTHH 3A5TA 1CZQA 2Q6QA 3SWFA 3HYBA 1NTZJ 5CHXA 2O01J 2N50A 2QJYB 3SSUA 1YBKA 2IFNA 2LMLA 1SQQJ 1ZMEC 1JJ2O 2QJYC 1IFIA 1WRGA 1BAJA 2PEJA 3H1LE 2CG5B 4GT1A 1SQXD 3FXDA 1QL1A 3S1KA 1VF5D 5DJUB 4I7ZB 2WPSA 3CC4P 5APTA 4OH8B 3A0BE 3H1LD 2VLQA 2N6ZA 2M5AA 2WITA 3NY7B 3MUDC 4AUWA 2LXCB 3L70G 1VQLP 4I7ZC 2X2BA 1NTMG 1LWUA 1JY2P 1VF5C 1IFPA 2FYNB 2AEMA 1LT9B 1UJZA 2FYNC 3PH0A 2I1KA 2PNGA 5KP6B 1EZVG 2B87A 5KTBA 1KILD 2C9NY 1M90Q 3CL3D 2JO0A 1JTHA 1GZLA 4QKOA 3TGUJ 1NTZD 1JY2N 3VP9A 3H6PA 1PGJA 2K9YA 2B9BA 4ZKUA 4IZ6A 2NPSD 2RKLA 2A45G 1KQFB 1CI6A 2EIAA 2NPSB 1GD2E 3L72J 2FYUJ 2Y0CA 1KLPA 1BGYG 2NPSC 3CE7A 5AW3B 2VRSA 4UB8H 2H8PD 1RO2A 3AE6C 2PEQA 4HKZH 3JCUH 1NQ4A 5I4TG 1K30A 3H1HE 3MTUE 1NOHA 3M9BA 1M7LA 2O1JA 2OQQA 2LKMA 2P1JA 4U0CA 2WPRA 3Q5SA 2YXRB 1QEXA 1VQ9P 1L0LJ 3Q2YA 1X22A 2HODA 1X79B 4PJ0E 2E75B 2N9YB 1LP1A 1Q2NA 2DW3A 1LTJB 2RMZA 3PP5A 4AQRD 2E75C 3PTZA 1FOSF 2DNWA 1LTJC 2WSFJ 2OTJP 5APYA 2BCCD 1BCCJ 5KAIH 3H32A 1MV8A 2MR7A 2GZIA 3HE4B 3L37A 1T8ZA 5KAFH 2FQ2A 4XFJA 4GODA 1DD4A 1SQBE 1K05A 2A45H 2GA1A 2BUOA 3PHLA 4KHXA 3MD0A 1L0LD 2Z4EA 3HD7A 1URQD 2OYHA 1LTIC 1JUNA 1SQBD 1URQB 1NYHA 1RNIA 5AVWB 4D6TJ 1YQ4C 1URQC 5BU8B 3B4QA 4N78E 1SVFA 1N73C 1RE3A 4Y99B 3H1KJ 3EFFK 2V7QJ 3G4SP 4Y99C 4XROA 3KQGA 4N78D 2L9FA 3HTKB 2OYIB 3MGEA 1DNYA 2PGDA 4L73A 1KYOI 1D7MA 1OWAA 3I5CA 2VLPA 1M1KQ 1RQUA 3S4RA 4OVNF 3CX5H 4IL6H 1H0TB 2R5BA 1LTTC 4YXDC 3L75J 3MUDA 4DZOA 2Z44A 1OXZA 2IFMA 3LIEA 4M0IA 4B86A 2Y0EA 1VDFA 2FKWB 2JP3A 3G71P 2JU2A 1S9KE 4LGDE 1IMQA 3E1IA 1IFJA 2CQ8A 1D1DA 2WZ7A 2K37A 3BCCE 2C9LY 4NPFX 1Z56A 1GW3A 4R0MA 2QEXP 1NO4A 3AE8C 3BCCD 2QJPB 1PV3A 1ZN5A 4CA3A 4GIFA 1KQGB 2XZRA 2NPSA 4PH0A 3H1HG 2BQ1E 2FVEA 1NH4A 2JBGA 3DPHA 2E1MA 2Q3IA 2JAZA 3MIWA 3Q5RA 3N4XA 2FVFA 3G3ZA 1YYCA 1EDKA 2QNWA 2A06E 2IBZE 2CGQA 3SFDC 3EWKA 4DG9A 1YJNP 3A0BH 1EXIA 4DT0A 1PEUA 2KUBA 1Y9BA 3TSIA 3NXSA 1KB9I 3K5BA 3ZDMA 2A06D 3H4EA 1EIAA 1DEEG 1LGHB 2JEEA 1IFMA 1VHNA 4PD4I 2M8NA 5JPAA 1A02J 1ZLLA 2HR3A 4H13D 1FS0E 5BVZA 4QNBA 2KZJA 1U7JA 2KYVA 4W7YA 2FY8A 1LNQA 1JY3O 2W83C 1G1IA 1AFOA 2EG5A 1T3UA 1NTMJ 3Q3DA 3KHUA 3OW2O 1SQBG 1LTJA 3CWBJ 2Q5UA 2WTYA 3B71A 2XDJA 1S4XA 2QA4P 3Q20A 2Q1KA 3NFQA 4EIJA 4ZMDA 2PEOA 1EXJA 2R5DA 3IFMA 3HE4A 1AA0A 3L71E 2L0QA 4IPYA 2CPSA 1IZNB 2KG9A 2G3AA 5F2KA 4EDFA 3GW6A 5AVYB 3VN0A 1LTSC 2M0BA 4M3LA 2FQ0A 5CZDB 1URQA 2RN0A 1N73A 1WT6A 1K04A 3H1IE 5AVUB 1H8AA 2JDIH 1N86A 3AEAC 1DX7A 2H7HA 3CWBD 5F2OA 3V4QA 3HTKA 3U43A 4PJ0H 2VLOA 3L35A 2KB7P 3M91A 3WUUA 2KOGA 5AW0B 3LW5H 1A02F 1RH5B 1Z6MA 4PH1A 1SQVD 2HLOA 1H0TA 4TT3H 5CBNA 5AW2B 1FAVA 1PP9E 2WT7B 1JY2O 3L74E 2N98A 2KK7A 1SQBK 1OMIA 2E5YA 1FE6A 3P7KA 2LIWA 1L0ND 5HGMA 1YJWP 2WQYC 1PP9D 5C39A 1VQOP 2WWWA 4WY4D 1SQPE 3L74D 4I2LC 5APSA 1RE4C 4WY4B 3D6ZA 3AE7C 2PEIA 4NPDA 1M6NA 1GW4A 4PXHB 2W90A 3RL0D 3GF7A 4WY4C 3MZWB 4Y28J 1S1CX 3BASA 5AW9B 1BSNA 1DH3A 2L6EA 1SQPD 3N7NA 3RL0B 2QJKB 3RL0C 2IBZG 5BS2A 2PFXA 2QJKC 1M6EX 1NTKE 3H1JG 1SLQA 3KPEA 3CCSP 4JBZA 4ASVA 5APUA 1QVGO 3RG2A 1NTKD 1HWTC 1PIXA 2ZYDA 2QE7H 2JYGA 1QRJA 3P32A 1ZRTE 2C0WA 1S5LE 2LKIA 2KGAA 1SQXE 4YPCA 4C7RA 1PGOA 2VSQA 1ZRTD 1ACPA 1W2EA 3VOPA 4XFXA 3L36A 2M5RA 2K92A 1QGKB 1NKZB 2YKOA 2WSEJ 4YTPC 2E76D 3MGNA 1VF5B 2ZVNB 5AVZB 2LIUA 1KYOE 2JQ4A 2M8PA 1FU1A 2JU1A 3L73D 1KILE 1IMPA 3L71G 3H47A 1E79H 1NTZE 1HY8A 1XTGB 1KYOD 2AXTE 1SQQE 3A3YB 5AW1B 2YMYA 1NU1D 3VP8A 5E79E 4PWVB 1JNMA 1K9MQ 1J1EC 1HQBA 1KILB 1SQQD 1KC8Q 1KILC 4EI2A 2HPCB 2E74D 2GDYA 3H1IG 1L0HA 1IK7A 2KW2A 3NMDA 3RK2D 3VMXA 2E74B 1ZXGA 3RK2B 3KDPB 3OJAB 3CCQP 3H1HJ 2E74C 3RK2C 2ROQA 3FX0A 1NJIQ 2XT1A 1M56D 5KLVJ 3CI9A 1EQ7A 2LL8A 2P9XA 3ITKA 1JM0A 3TGUE 1Q86Q 4COPA 1IUQA 2WPVB 1VQ7P 2BEQD 1CW5A 1JMMA 1PP9G 3SFEC 3GJNA 2YXQB 2R3SA 2JGPA 3TGUD 3CCRP 1ZW0A 3L74G 2KNCB 3EJBA 3L72E 2FYUE 2K0YA 4I6MC 1T8KA 3WBHA 3AEDC 4LLHA 2IYOA 3C9IA 2ONTA 1SQPG 3L72D 1Y47A 2FYUD 1KB9E 4KT0J 1OIPA 2WT7A 1RO0A 2BCCE 3O8ZA 3M9HA 4PD4E 5KLVD 1KB9D 1GL2D 3KYQA 1T6AA 1GMJA 5M1BA 2OYOA 1RE4A 2KS1B 2AF8A 1HTLC 2SPZA 1GU4A 1NTKG 2QIWA 4PD4D 4WY4A 1GL2C 3IN6A 1KN7A 3HRNA 1L0LE 5KKZB 3L4FA 2ZAEB 4U7JA 2NO8A 1SFCD 5KKZC 1PL5A 2V4HA 5EJDA 1FZCB 3EJDA 3F5HA 4U3FJ 4U0BA 4HYTB 1SFCB 4N6JA 1FZCC 4RO0A 4PV1D 2YIUC 3NTEA 4LC1A 1VQ8P 1SFCC 4XRQA 1EDIA 1SQVK 1SQXG 1LTAC 1N73B 1JCDA 2O1KA 4OGQD 1LT1A 1H88A 2KXPB 3H1LG 1Q81Q 1BCCE 1Q7YQ 1G2CB 1UNKA 2CWOA 1MKMA 3FWLA 4OGQC 5H2FE 1Q90D 2GDWA 1P84D 3CXCO 1BCCD 1AF8A 3O6QB 2W6BA 1N7SD 3AECC 3G26A 2ZXXA 1IK9A 4IL6X 5TISE 3KXDA 2VLNA 2CNRA 3DS2A 4XFYA 1NGMB 1NTZG 4H2WC 3E1RA 2AXCA 3R2PA 2K2QA 4D6TE 2KLUA 1SQPK 1SQQG 1FBMA 4Z1MH 3PJSK 1M1JB 1DD3A 3H1KE 4K3AA 1VL2A 1KV4A 2Q7CA 1M1JC 4D6TD 2LF4A 5F2NA 2N9BA 3BVHA 2JJLA 3H1KD 2Q9IA 3M0DC 1NKNA 1JCCA 3Q5PA 2ERHA 1E0HA 3AEGC 1NTKK 5CBOA 3B5ND 1GXHA 2BHVA 3TNUB 2XU6A 3LRYA 2FXMA 1FR2A 1KILA 3B5NB 3VMAA 2XNDH 1FDOA 3B5NC 2GYKA 2XV5A 2HPCA 1Y8AA 1W2BO 4GKGA 1S5LH 2IX7C 3M9QA 3CMEP 3L75D 2XXMA 1IFNA 3G9RA 5CJ4A 5AW4B 4HJGH 1SQXK 1PFIA 3H1JJ 3I56P 4WVZA 1EOQA 5DJTB 3GKLC 2P2UA 3L72G 3PLNA 2JWAA 2FFDC 1FDMA 1PPJE 1BE3J 4KJMA 4H0LD 1KYOH 3TDKA 1GK6A 3CC7P 1NU1K 1HH0A 2PENA 1L0IA 1PPJD 1R5LA 2BCCG 1PGQA 2O01H 2FACA 2KNCA 3GMAA 1NTZK 5E79H 5B66E 1YHQP 1SQQK 3Q1MA 4I1LA 2W6AA 1KORA 1L2PA 4H13B 3G1IA 3CXHI 4H13C 3L70J 1USEA 2D2CD 1S72P 1L0LG 1K8AQ 2OTLP 4ZNCA 3VMZA 2D2CB 4W7ZA 1X3OA 2ZJSE 1OVVA 3BATA 3L71J 2D2CC 3HE5B 2O3JA 1ZMBA 2GZEA 1IFDA 3OAKA 5AVTB 4CPGA 4GOEA 2P7JA 1GL2A 2KS1A 5AW6B 5AW7B 2C0XA 2P67A 5APXA 4DJGA 3G21A 3AE5C 3TF5A 1R8EA 3A0HE 2PY8A 2NRGA 1P84I 1R5SA 3A2AA 1FZCA 1IJDB 1F80D 1BCCG 1M74A 3V2PA 3H1IJ 1SFCA 3WU2E 3RBXA 1W5CE 3RK3D 1AUMA 1NAFA 1NTME 3P05A 1ZR4A 1GDTA 4RJTA 2Z5HA 3P8MC 3V2RA 1YITP 1FDIA 1BGYJ 3CWBE 2O01N 5KP8B 3PRJA 3T97B 1NTMD 2FYUK 5HGOA 3S9OA 1BXIA 1EDLA 4N3YB 1FZEA 1G2CA 2IZ0A 3TYYA 1NAYA 3GZLA 1RHZB 4D6TG 1KB9H 3CCUP 2YMKA 2AEJA 1EZVD 1SQVE 3H1KG 2JO1A 3FGAD 3O6QA 1HUCA 4PD4H 2GUVA 4IFFA 1GK4A 2G8YA 5AVVB 2KP8A 3TK1A 3BCCG 2WVRA 4BPFA 1L0NE 4BPGA 1M1JA 2PRRA 1CEIA 1L0LK 2EHSA 5GTIE 1T3JA 2K3RA 2MR8A 3E7KA 4C7NA 2J59M 3M0DA 1VQKP 2KR5A 3DS0A 3GHGC 1AQTA 1VQ6P 3WUTA 1FJPA 2FYZA 1RF0C 3TNUA 5AVXB 1JB0J 1IC2A 2AVAA 4WYMA 3B5NA 2IYPA 1AVOA 4IFMA 1G1JA 2E42A 2A06G 2M3EA 5H2FH 2K93A 1AQ5A 2JYLA 3P8CD 4H2YC 1PPJG 1BSHA 1YQ3C 2W27A 5AW8B 4K35A 3CX5D 5TISH 1ZR2A 1BDDA 1SQXJ 4GR2A 3W68A 2KOOA 2K9JA 1LTGC 2FFDA 2K0DX 1BDCA 3H1LJ 5AVSB 4RKUJ 2M8LA 1KTMA 2FAEA 5BS1A 3MHVA 2K5XA 1VQ4P 2V7QH 2LTEA 2QM8A 1ZNVA 3IAOA 3CCMP 3VYIA 3GG2A 3FXEA 1OW6A 1J2JB 1KFMA 2XZ0D 1S3JA 2FVAA 4NPEA 2GDXA 1EC5A 3L73E 2GUSA 2N5IA 3EQ2A 1USDA 3U59A 2H88C 2FADA 1HVVA 2E76B 1SP4A 1NU1E 1X8YA 1JOCA 2E76C 3CPWO 2AFEA 1N7LA 2MF4A 3HE5A 1J1EB 5TJHA 2ITAA 3KZIE 2ZFCA 2LPKA 1AYIA 3GZMA 3GLMA 4MN4C 4BWNA 3A7OA 2QVAA 3CWBG 1DV5A 4DOJA 5KP7B 1OR5A 4UB6E 1EZVI 1LT9C 1X0TA 5AVRB 4H44D 4BRYB 1TU3F 5CMZA 1ZOYC 1VQ5P 4L76A 4H44B 3NTNA 2WSCH 1VQNP 5AVQB 3DTJA 2EHTA 1AV1A 2W8ZA 4H44C 2N5HA 2ZYAA 4BPHA 1SQVG 3V2QA 3VTPC 2A45I 4BXLA 3T97A 1FOSE 5B66H 2KGEA 2XNXA 2N6YA 1LJ2A 2AFDA 1DIPA 1IO4A 1E6JP 1L0NG 4GOFA 2GZGA 5KJ7D 2KORA 1GPJA 1OFCX
chains in the Genus database with same CATH topology
3CMAP 2QEXP 2PEOA 2BUOA 2EIAA 2LF4A 3E2DA 5F2NA 1S72P 2PEIA 2EFJA 1K8AQ 2OTLP 1M6NA 1PEMA 3H0DA 3G0VA 1K9MQ 1N8RQ 1YIJP 1QVFO 1PEQA 2L6EA 3CCLP 1A8OA 2Z46A 3B5IA 4IPYA 1VQMP 1A43A 4PH0A 2BQ1E 1RO2A 1ZMBA 1RNIA 3CCEP 3CD6P 1KC8Q 3DS1A 3DS3A 3DPHA 5F2KA 2BHVA 2PEQA 3CPWO 2E1MA 1VQKP 3DS0A 5BS2A 3LRYA 1VQ6P 1M6EX 5I4TG 1K30A 4U0BA 3HYBA 3G4SP 3G21A 3RG6C 4XROA 2PY8A 1W2BO 3CCQP 3NTEA 4WYMA 3DS4A 1JJ2O 1VQ8P 4COCA 3CCSP 4XRQA 3I55P 1YJNP 3MGEA 1BAJA 2PEJA 4U0CA 1K73Q 3CCVP 3CMEP 1QVGO 1PEUA 5F2OA 1M74A 2XV6A 1NJIQ 4U0EA 2XT1A 1AUMA 2XXMA 3CCJP 2KODA 3P05A 2JYLA 3G1GA 5HGNA 3H4EA 3G6EP 1VQ9P 2JYGA 1EIAA 1M1KQ 1QRJA 2P9XA 1YITP 4GR6A 4U0DA 3CC4P 1Q81Q 3G29A 1Q86Q 1VQ5P 3I56P 5DCKA 1Q7YQ 1EOQA 4COPA 1VQLP 1VQNP 1IUQA 2M8NA 1YI2P 5JPAA 2Z45A 1VQ7P 3DTJA 2CWOA 4PH1A 4GR2A 2Z44A 5HGOA 5HGLA 4QNBA 4M0IA 4U0FA 3CXCO 3HZQA 3CCRP 2DGYA 1KQSO 4XFXA 2M8LA 3G26A 3CCUP 3G71P 1YJ9P 2EG5A 3WBHA 4U0AA 3DS5A 5BS1A 3CC7P 3VRLC 1VQ4P 4XFZA 2PEKA 2PENA 1M90Q 1KD1Q 2OTJP 2JO0A 3DS2A 4XFYA 3OW2O 3M1MA 1Q82Q 1D1DA 2ONTA 2OARA 3CC2P 3CCMP 2M8PA 2PEMA 1E6JP 1YHQP 2QA4P 1VQPP 5HGMA 1YJWP 3H47A 3G28A 1RO0A 3Q20A 1VQOP 1PEOA 3G1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 P;  1YJ9 P;  3CMA P;  2QEX P;  1YIT P;  3CC7 P;  3CC4 P;  1Q81 Q;  1S72 P;  1Q86 Q;  1VQ5 P;  3G4S P;  3I56 P;  1K8A Q;  1KD1 Q;  1M90 Q;  1VQ4 P;  2OTL P;  1Q7Y Q;  2OTJ P;  1VQL P;  1VQN P;  3OW2 O;  1YI2 P;  1Q82 Q;  1K9M Q;  1W2B O;  3CCQ P;  1YIJ P;  1N8R Q;  1VQ7 P;  1JJ2 O;  1VQ8 P;  3CC2 P;  3CCS P;  1QVF O;  3CCM P;  3I55 P;  3CCL P;  1YJN P;  1VQM P;  1K73 Q;  3CCV P;  3CME P;  1YHQ P;  1QVG O;  2QA4 P;  3CCE P;  1VQP P;  3CD6 P;  1KC8 Q;  1NJI Q;  3CXC O;  1YJW P;  3CCJ P;  3CCR P;  3CPW O;  1VQK P;  1KQS O;  1VQO P;  1VQ6 P;  3G6E P;  1VQ9 P;  1M1K Q;  3CCU P; 
#chains in the Genus database with same CATH topology
 3CMA P;  3V6I A;  2BCC J;  2I1J A;  3LW5 J;  5KJ7 C;  4OWF A;  1KMI Z;  3ABV C;  1J1D B;  2YNY A;  2RH0 A;  2WMM A;  5KLV E;  1A43 A;  1OW8 A;  1AVY A;  1J1D C;  3H1H D;  5B5E E;  3A0H H;  1GU5 A;  2KLV A;  2KSE A;  2ZXE B;  2B88 A;  3WU2 H;  3AE4 C;  3GHG A;  1SQB J;  3CX5 I;  2XZ1 C;  2MY5 A;  1X9V A;  3D70 A;  1NTM K;  2E75 D;  1AJY A;  2KGD A;  1GL2 B;  1RF0 A;  3CXH E;  5KLI B;  4WB4 A;  2GM4 A;  2M3B A;  4IFD K;  5KLI C;  3FWN A;  2PAJ A;  1S2E A;  2LXB A;  3JC2 2;  5HVC A;  3G29 A;  1U7M A;  1JMB A;  2YIU B;  3CXH D;  2FHS C;  5DCK A;  1NVO A;  1YI2 P;  1EDJ A;  4W80 A;  2QRX A;  3MP7 B;  4JF7 A;  1QL2 A;  3BRV B;  1MFT A;  2KIK A;  4O9B A;  1L4A D;  5HGL A;  4PV1 B;  3AE1 C;  5HV8 A;  4IOI H;  3HZQ A;  2WPT A;  1L4A B;  2LR2 A;  1KQS O;  2YO2 A;  2JB0 A;  4PV1 C;  2JWD A;  1L4A C;  1QX8 A;  1P84 E;  2PEK A;  2BEZ F;  3SWK A;  4OGQ B;  1RQV A;  3M1M A;  2OGU A;  4QMA A;  2OAR A;  1N2D C;  3CC2 P;  3L73 G;  3GF3 A;  2KGC A;  1MZ9 A;  4C46 A;  5APW A;  1L0N K;  1PZQ A;  2HFE D;  5GTI H;  2KI7 B;  3AE3 C;  4U3F E;  1YTZ I;  2FXO A;  3OA7 A;  1NU1 G;  3E2D A;  4MRT C;  2EFJ A;  1N7S B;  3UIA A;  2FQ1 A;  5CCH D;  1N8R Q;  1YIJ P;  3AE9 C;  1ZV8 A;  1N7S C;  4U3F D;  1NWQ A;  1M57 D;  2MVV A;  3R4Y A;  2KOQ A;  2MJZ A;  2KOS A;  2CPB A;  2OYI C;  3DS1 A;  3BCC J;  5CCH C;  3D71 A;  1PGP A;  4ZKP A;  3QH9 A;  1MFZ A;  2KWL A;  4C7N B;  2AEF A;  2R32 A;  2MKV A;  2QM7 A;  2BAS A;  1NHL A;  1M8O B;  2ZVO B;  4COC A;  2I8D A;  4JQ0 D;  5AW5 B;  3I55 P;  4EYY Q;  2JR8 A;  3WUV A;  1K73 Q;  1HGZ A;  2M8R A;  1WMK A;  2XV6 A;  5GTH E;  4EOT A;  2IPP A;  2J58 A;  2OTK E;  3HUS B;  3G1G A;  1MUU A;  1FC2 C;  3USS A;  1EMV A;  4GR6 A;  4U0D A;  5APV A;  3HUS C;  3L75 E;  1LT9 A;  1RY3 A;  3RL0 g;  1HJ0 A;  1S5L X;  2N1T D;  2Z45 A;  3C8V A;  4BRY A;  2N1T B;  2ZYG A;  3BRT B;  3C1L A;  1S9K D;  1OW7 A;  2W6J H;  2L91 A;  3TGU G;  1FZA A;  2N1T C;  2DGY A;  5CCG D;  3EJE A;  3U1A A;  1HBW A;  4U0A A;  2YO3 A;  3VRL C;  1OX3 A;  2WSC J;  1H89 A;  2UWJ E;  4XFZ A;  2K9J B;  1CSB A;  2QJP C;  2FFD B;  5CCG C;  2FYU G;  1YTZ T;  3IF4 A;  2GZF A;  3AEE C;  2K88 A;  1T2K D;  1RF1 B;  4XA4 A;  1PEO A;  4WWI A;  1RF1 C;  2IDB A;  5KLV G;  1E5W A;  3SWY A;  4H0L B;  1T2K C;  5CJ0 A;  3VMY A;  4TLF A;  4NEO A;  3H0D A;  3G0V A;  2FBW C;  4H0L C;  1PEQ A;  2AXT H;  2WSS H;  3CCL P;  5KJ7 A;  2Z46 A;  2GZJ A;  2MD9 A;  1OVR A;  2HG5 D;  2L22 A;  3AEF C;  2K94 A;  3KZI H;  3H1J E;  5EFW B;  2Y9Z A;  2MVU A;  2IBZ D;  4WBA A;  3D6Y A;  3WMM 0;  4UB8 E;  2FXP A;  4UB6 H;  5BU5 A;  2LOL A;  3RG6 C;  2WSE H;  3H1J D;  3B4S A;  3LMO A;  1GXG A;  3DS4 A;  1LTB C;  1UII A;  3RGU A;  1BE3 E;  2E5T A;  2QG4 A;  3JCU E;  3CCV P;  1ZP0 C;  2M5A B;  4U0E A;  2Y0D A;  2KSJ A;  4HB1 A;  3AE2 C;  2K0X A;  1LWU B;  5HGN A;  3G6E P;  1FJK A;  1KQL A;  4XE5 B;  1BE3 D;  2R44 A;  2L5G B;  3H25 A;  1LWU C;  3RK3 E;  1FZB A;  5L8R J;  1SS1 A;  1KZU B;  2P10 A;  2B87 B;  1UIX A;  1HJB A;  3LID A;  3CLQ A;  4U0F A;  1JTH B;  3L70 E;  4JYC A;  1VKU A;  1YJ9 P;  3RK3 B;  3U1C A;  5K5G B;  1KD1 Q;  1L4A A;  3RK3 C;  1Q82 Q;  4U3F G;  5EW5 E;  2KZI A;  4AYC A;  3L70 D;  1SQV J;  3QWO C;  1CI6 B;  4HKG A;  3EFG A;  1EZV E;  2JKV A;  1GTW A;  1FZG A;  3L71 D;  2Q3E A;  2KG8 A;  5KAI E;  5B5E H;  5KLV K;  3W67 A;  2Z5I A;  3II6 A;  5KAF E;  2Y9Y A;  3M0A A;  2R3C A;  1L0N J;  2L4B A;  1QVF O;  1PP9 J;  1A8O A;  3M06 A;  2K1A A;  1HF9 A;  3CCE P;  3CD6 P;  3L74 J;  1N7S A;  3DS3 A;  2J5U A;  3V2N A;  1BGY E;  2OYI A;  4F37 A;  4L75 A;  1OVU A;  3H1I D;  3CXH H;  5CCH A;  1SQP J;  4YXW H;  4ASW A;  2B89 A;  2H43 A;  2XKM A;  3F89 A;  2P58 A;  1BGY D;  1MZ8 A;  3RBZ A;  2YKQ A;  3L75 G;  4R4L A;  3GHG B;  2HOD B;  1OZH A;  4DCK A;  4R4M A;  3CCJ P;  2KOD A;  1VPC A;  1JY3 P;  2IZ1 A;  2ZT9 D;  1JO5 A;  3B8E B;  2ZT9 B;  1LP1 B;  3HUS A;  3P8C E;  2WSF H;  1NTK J;  2ZT9 C;  1P84 H;  4UHP B;  2KG6 A;  2E43 A;  4H2X C;  3AEB C;  3CX5 E;  4IL6 E;  1KFN A;  1XTC C;  2N1T A;  3H32 B;  2POH A;  3DS5 A;  1JY3 N;  4RES B;  1FZF A;  2QSI A;  3IR9 A;  2WPQ A;  3HD7 D;  3JSV C;  2CK3 H;  3V4W A;  2IBZ I;  2PEM A;  2KOP A;  1U57 A;  2HYN A;  1VQP P;  5CCG A;  2H89 C;  7CEI A;  1HGV A;  3HD7 B;  3G28 A;  2NZ2 A;  4JYB A;  5APQ A;  2OYH B;  4JPZ B;  1DEB A;  3HD7 C;  2OYH C;  1QLE D;  1JEK A;  2PP6 A;  1RF1 A;  4A7P A;  2YKP A;  1PEM A;  4L74 A;  3L73 J;  3V5B A;  3B5I A;  1VQM P;  4HH2 A;  1RE3 C;  1NU1 J;  1BE3 G;  4GDO A;  5GTH H;  3A5T A;  1CZQ A;  2Q6Q A;  3SWF A;  3HYB A;  1NTZ J;  5CHX A;  2O01 J;  2N50 A;  2QJY B;  3SSU A;  1YBK A;  2IFN A;  2LML A;  1SQQ J;  1ZME C;  1JJ2 O;  2QJY C;  1IFI A;  1WRG A;  1BAJ A;  2PEJ A;  3H1L E;  2CG5 B;  4GT1 A;  1SQX D;  3FXD A;  1QL1 A;  3S1K A;  1VF5 D;  5DJU B;  4I7Z B;  2WPS A;  3CC4 P;  5APT A;  4OH8 B;  3A0B E;  3H1L D;  2VLQ A;  2N6Z A;  2M5A A;  2WIT A;  3NY7 B;  3MUD C;  4AUW A;  2LXC B;  3L70 G;  1VQL P;  4I7Z C;  2X2B A;  1NTM G;  1LWU A;  1JY2 P;  1VF5 C;  1IFP A;  2FYN B;  2AEM A;  1LT9 B;  1UJZ A;  2FYN C;  3PH0 A;  2I1K A;  2PNG A;  5KP6 B;  1EZV G;  2B87 A;  5KTB A;  1KIL D;  2C9N Y;  1M90 Q;  3CL3 D;  2JO0 A;  1JTH A;  1GZL A;  4QKO A;  3TGU J;  1NTZ D;  1JY2 N;  3VP9 A;  3H6P A;  1PGJ A;  2K9Y A;  2B9B A;  4ZKU A;  4IZ6 A;  2NPS D;  2RKL A;  2A45 G;  1KQF B;  1CI6 A;  2EIA A;  2NPS B;  1GD2 E;  3L72 J;  2FYU J;  2Y0C A;  1KLP A;  1BGY G;  2NPS C;  3CE7 A;  5AW3 B;  2VRS A;  4UB8 H;  2H8P D;  1RO2 A;  3AE6 C;  2PEQ A;  4HKZ H;  3JCU H;  1NQ4 A;  5I4T G;  1K30 A;  3H1H E;  3MTU E;  1NOH A;  3M9B A;  1M7L A;  2O1J A;  2OQQ A;  2LKM A;  2P1J A;  4U0C A;  2WPR A;  3Q5S A;  2YXR B;  1QEX A;  1VQ9 P;  1L0L J;  3Q2Y A;  1X22 A;  2HOD A;  1X79 B;  4PJ0 E;  2E75 B;  2N9Y B;  1LP1 A;  1Q2N A;  2DW3 A;  1LTJ B;  2RMZ A;  3PP5 A;  4AQR D;  2E75 C;  3PTZ A;  1FOS F;  2DNW A;  1LTJ C;  2WSF J;  2OTJ P;  5APY A;  2BCC D;  1BCC J;  5KAI H;  3H32 A;  1MV8 A;  2MR7 A;  2GZI A;  3HE4 B;  3L37 A;  1T8Z A;  5KAF H;  2FQ2 A;  4XFJ A;  4GOD A;  1DD4 A;  1SQB E;  1K05 A;  2A45 H;  2GA1 A;  2BUO A;  3PHL A;  4KHX A;  3MD0 A;  1L0L D;  2Z4E A;  3HD7 A;  1URQ D;  2OYH A;  1LTI C;  1JUN A;  1SQB D;  1URQ B;  1NYH A;  1RNI A;  5AVW B;  4D6T J;  1YQ4 C;  1URQ C;  5BU8 B;  3B4Q A;  4N78 E;  1SVF A;  1N73 C;  1RE3 A;  4Y99 B;  3H1K J;  3EFF K;  2V7Q J;  3G4S P;  4Y99 C;  4XRO A;  3KQG A;  4N78 D;  2L9F A;  3HTK B;  2OYI B;  3MGE A;  1DNY A;  2PGD A;  4L73 A;  1KYO I;  1D7M A;  1OWA A;  3I5C A;  2VLP A;  1M1K Q;  1RQU A;  3S4R A;  4OVN F;  3CX5 H;  4IL6 H;  1H0T B;  2R5B A;  1LTT C;  4YXD C;  3L75 J;  3MUD A;  4DZO A;  2Z44 A;  1OXZ A;  2IFM A;  3LIE A;  4M0I A;  4B86 A;  2Y0E A;  1VDF A;  2FKW B;  2JP3 A;  3G71 P;  2JU2 A;  1S9K E;  4LGD E;  1IMQ A;  3E1I A;  1IFJ A;  2CQ8 A;  1D1D A;  2WZ7 A;  2K37 A;  3BCC E;  2C9L Y;  4NPF X;  1Z56 A;  1GW3 A;  4R0M A;  2QEX P;  1NO4 A;  3AE8 C;  3BCC D;  2QJP B;  1PV3 A;  1ZN5 A;  4CA3 A;  4GIF A;  1KQG B;  2XZR A;  2NPS A;  4PH0 A;  3H1H G;  2BQ1 E;  2FVE A;  1NH4 A;  2JBG A;  3DPH A;  2E1M A;  2Q3I A;  2JAZ A;  3MIW A;  3Q5R A;  3N4X A;  2FVF A;  3G3Z A;  1YYC A;  1EDK A;  2QNW A;  2A06 E;  2IBZ E;  2CGQ A;  3SFD C;  3EWK A;  4DG9 A;  1YJN P;  3A0B H;  1EXI A;  4DT0 A;  1PEU A;  2KUB A;  1Y9B A;  3TSI A;  3NXS A;  1KB9 I;  3K5B A;  3ZDM A;  2A06 D;  3H4E A;  1EIA A;  1DEE G;  1LGH B;  2JEE A;  1IFM A;  1VHN A;  4PD4 I;  2M8N A;  5JPA A;  1A02 J;  1ZLL A;  2HR3 A;  4H13 D;  1FS0 E;  5BVZ A;  4QNB A;  2KZJ A;  1U7J A;  2KYV A;  4W7Y A;  2FY8 A;  1LNQ A;  1JY3 O;  2W83 C;  1G1I A;  1AFO A;  2EG5 A;  1T3U A;  1NTM J;  3Q3D A;  3KHU A;  3OW2 O;  1SQB G;  1LTJ A;  3CWB J;  2Q5U A;  2WTY A;  3B71 A;  2XDJ A;  1S4X A;  2QA4 P;  3Q20 A;  2Q1K A;  3NFQ A;  4EIJ A;  4ZMD A;  2PEO A;  1EXJ A;  2R5D A;  3IFM A;  3HE4 A;  1AA0 A;  3L71 E;  2L0Q A;  4IPY A;  2CPS A;  1IZN B;  2KG9 A;  2G3A A;  5F2K A;  4EDF A;  3GW6 A;  5AVY B;  3VN0 A;  1LTS C;  2M0B A;  4M3L A;  2FQ0 A;  5CZD B;  1URQ A;  2RN0 A;  1N73 A;  1WT6 A;  1K04 A;  3H1I E;  5AVU B;  1H8A A;  2JDI H;  1N86 A;  3AEA C;  1DX7 A;  2H7H A;  3CWB D;  5F2O A;  3V4Q A;  3HTK A;  3U43 A;  4PJ0 H;  2VLO A;  3L35 A;  2KB7 P;  3M91 A;  3WUU A;  2KOG A;  5AW0 B;  3LW5 H;  1A02 F;  1RH5 B;  1Z6M A;  4PH1 A;  1SQV D;  2HLO A;  1H0T A;  4TT3 H;  5CBN A;  5AW2 B;  1FAV A;  1PP9 E;  2WT7 B;  1JY2 O;  3L74 E;  2N98 A;  2KK7 A;  1SQB K;  1OMI A;  2E5Y A;  1FE6 A;  3P7K A;  2LIW A;  1L0N D;  5HGM A;  1YJW P;  2WQY C;  1PP9 D;  5C39 A;  1VQO P;  2WWW A;  4WY4 D;  1SQP E;  3L74 D;  4I2L C;  5APS A;  1RE4 C;  4WY4 B;  3D6Z A;  3AE7 C;  2PEI A;  4NPD A;  1M6N A;  1GW4 A;  4PXH B;  2W90 A;  3RL0 D;  3GF7 A;  4WY4 C;  3MZW B;  4Y28 J;  1S1C X;  3BAS A;  5AW9 B;  1BSN A;  1DH3 A;  2L6E A;  1SQP D;  3N7N A;  3RL0 B;  2QJK B;  3RL0 C;  2IBZ G;  5BS2 A;  2PFX A;  2QJK C;  1M6E X;  1NTK E;  3H1J G;  1SLQ A;  3KPE A;  3CCS P;  4JBZ A;  4ASV A;  5APU A;  1QVG O;  3RG2 A;  1NTK D;  1HWT C;  1PIX A;  2ZYD A;  2QE7 H;  2JYG A;  1QRJ A;  3P32 A;  1ZRT E;  2C0W A;  1S5L E;  2LKI A;  2KGA A;  1SQX E;  4YPC A;  4C7R A;  1PGO A;  2VSQ A;  1ZRT D;  1ACP A;  1W2E A;  3VOP A;  4XFX A;  3L36 A;  2M5R A;  2K92 A;  1QGK B;  1NKZ B;  2YKO A;  2WSE J;  4YTP C;  2E76 D;  3MGN A;  1VF5 B;  2ZVN B;  5AVZ B;  2LIU A;  1KYO E;  2JQ4 A;  2M8P A;  1FU1 A;  2JU1 A;  3L73 D;  1KIL E;  1IMP A;  3L71 G;  3H47 A;  1E79 H;  1NTZ E;  1HY8 A;  1XTG B;  1KYO D;  2AXT E;  1SQQ E;  3A3Y B;  5AW1 B;  2YMY A;  1NU1 D;  3VP8 A;  5E79 E;  4PWV B;  1JNM A;  1K9M Q;  1J1E C;  1HQB A;  1KIL B;  1SQQ D;  1KC8 Q;  1KIL C;  4EI2 A;  2HPC B;  2E74 D;  2GDY A;  3H1I G;  1L0H A;  1IK7 A;  2KW2 A;  3NMD A;  3RK2 D;  3VMX A;  2E74 B;  1ZXG A;  3RK2 B;  3KDP B;  3OJA B;  3CCQ P;  3H1H J;  2E74 C;  3RK2 C;  2ROQ A;  3FX0 A;  1NJI Q;  2XT1 A;  1M56 D;  5KLV J;  3CI9 A;  1EQ7 A;  2LL8 A;  2P9X A;  3ITK A;  1JM0 A;  3TGU E;  1Q86 Q;  4COP A;  1IUQ A;  2WPV B;  1VQ7 P;  2BEQ D;  1CW5 A;  1JMM A;  1PP9 G;  3SFE C;  3GJN A;  2YXQ B;  2R3S A;  2JGP A;  3TGU D;  3CCR P;  1ZW0 A;  3L74 G;  2KNC B;  3EJB A;  3L72 E;  2FYU E;  2K0Y A;  4I6M C;  1T8K A;  3WBH A;  3AED C;  4LLH A;  2IYO A;  3C9I A;  2ONT A;  1SQP G;  3L72 D;  1Y47 A;  2FYU D;  1KB9 E;  4KT0 J;  1OIP A;  2WT7 A;  1RO0 A;  2BCC E;  3O8Z A;  3M9H A;  4PD4 E;  5KLV D;  1KB9 D;  1GL2 D;  3KYQ A;  1T6A A;  1GMJ A;  5M1B A;  2OYO A;  1RE4 A;  2KS1 B;  2AF8 A;  1HTL C;  2SPZ A;  1GU4 A;  1NTK G;  2QIW A;  4PD4 D;  4WY4 A;  1GL2 C;  3IN6 A;  1KN7 A;  3HRN A;  1L0L E;  5KKZ B;  3L4F A;  2ZAE B;  4U7J A;  2NO8 A;  1SFC D;  5KKZ C;  1PL5 A;  2V4H A;  5EJD A;  1FZC B;  3EJD A;  3F5H A;  4U3F J;  4U0B A;  4HYT B;  1SFC B;  4N6J A;  1FZC C;  4RO0 A;  4PV1 D;  2YIU C;  3NTE A;  4LC1 A;  1VQ8 P;  1SFC C;  4XRQ A;  1EDI A;  1SQV K;  1SQX G;  1LTA C;  1N73 B;  1JCD A;  2O1K A;  4OGQ D;  1LT1 A;  1H88 A;  2KXP B;  3H1L G;  1Q81 Q;  1BCC E;  1Q7Y Q;  1G2C B;  1UNK A;  2CWO A;  1MKM A;  3FWL A;  4OGQ C;  5H2F E;  1Q90 D;  2GDW A;  1P84 D;  3CXC O;  1BCC D;  1AF8 A;  3O6Q B;  2W6B A;  1N7S D;  3AEC C;  3G26 A;  2ZXX A;  1IK9 A;  4IL6 X;  5TIS E;  3KXD A;  2VLN A;  2CNR A;  3DS2 A;  4XFY A;  1NGM B;  1NTZ G;  4H2W C;  3E1R A;  2AXC A;  3R2P A;  2K2Q A;  4D6T E;  2KLU A;  1SQP K;  1SQQ G;  1FBM A;  4Z1M H;  3PJS K;  1M1J B;  1DD3 A;  3H1K E;  4K3A A;  1VL2 A;  1KV4 A;  2Q7C A;  1M1J C;  4D6T D;  2LF4 A;  5F2N A;  2N9B A;  3BVH A;  2JJL A;  3H1K D;  2Q9I A;  3M0D C;  1NKN A;  1JCC A;  3Q5P A;  2ERH A;  1E0H A;  3AEG C;  1NTK K;  5CBO A;  3B5N D;  1GXH A;  2BHV A;  3TNU B;  2XU6 A;  3LRY A;  2FXM A;  1FR2 A;  1KIL A;  3B5N B;  3VMA A;  2XND H;  1FDO A;  3B5N C;  2GYK A;  2XV5 A;  2HPC A;  1Y8A A;  1W2B O;  4GKG A;  1S5L H;  2IX7 C;  3M9Q A;  3CME P;  3L75 D;  2XXM A;  1IFN A;  3G9R A;  5CJ4 A;  5AW4 B;  4HJG H;  1SQX K;  1PFI A;  3H1J J;  3I56 P;  4WVZ A;  1EOQ A;  5DJT B;  3GKL C;  2P2U A;  3L72 G;  3PLN A;  2JWA A;  2FFD C;  1FDM A;  1PPJ E;  1BE3 J;  4KJM A;  4H0L D;  1KYO H;  3TDK A;  1GK6 A;  3CC7 P;  1NU1 K;  1HH0 A;  2PEN A;  1L0I A;  1PPJ D;  1R5L A;  2BCC G;  1PGQ A;  2O01 H;  2FAC A;  2KNC A;  3GMA A;  1NTZ K;  5E79 H;  5B66 E;  1YHQ P;  1SQQ K;  3Q1M A;  4I1L A;  2W6A A;  1KOR A;  1L2P A;  4H13 B;  3G1I A;  3CXH I;  4H13 C;  3L70 J;  1USE A;  2D2C D;  1S72 P;  1L0L G;  1K8A Q;  2OTL P;  4ZNC A;  3VMZ A;  2D2C B;  4W7Z A;  1X3O A;  2ZJS E;  1OVV A;  3BAT A;  3L71 J;  2D2C C;  3HE5 B;  2O3J A;  1ZMB A;  2GZE A;  1IFD A;  3OAK A;  5AVT B;  4CPG A;  4GOE A;  2P7J A;  1GL2 A;  2KS1 A;  5AW6 B;  5AW7 B;  2C0X A;  2P67 A;  5APX A;  4DJG A;  3G21 A;  3AE5 C;  3TF5 A;  1R8E A;  3A0H E;  2PY8 A;  2NRG A;  1P84 I;  1R5S A;  3A2A A;  1FZC A;  1IJD B;  1F80 D;  1BCC G;  1M74 A;  3V2P A;  3H1I J;  1SFC A;  3WU2 E;  3RBX A;  1W5C E;  3RK3 D;  1AUM A;  1NAF A;  1NTM E;  3P05 A;  1ZR4 A;  1GDT A;  4RJT A;  2Z5H A;  3P8M C;  3V2R A;  1YIT P;  1FDI A;  1BGY J;  3CWB E;  2O01 N;  5KP8 B;  3PRJ A;  3T97 B;  1NTM D;  2FYU K;  5HGO A;  3S9O A;  1BXI A;  1EDL A;  4N3Y B;  1FZE A;  1G2C A;  2IZ0 A;  3TYY A;  1NAY A;  3GZL A;  1RHZ B;  4D6T G;  1KB9 H;  3CCU P;  2YMK A;  2AEJ A;  1EZV D;  1SQV E;  3H1K G;  2JO1 A;  3FGA D;  3O6Q A;  1HUC A;  4PD4 H;  2GUV A;  4IFF A;  1GK4 A;  2G8Y A;  5AVV B;  2KP8 A;  3TK1 A;  3BCC G;  2WVR A;  4BPF A;  1L0N E;  4BPG A;  1M1J A;  2PRR A;  1CEI A;  1L0L K;  2EHS A;  5GTI E;  1T3J A;  2K3R A;  2MR8 A;  3E7K A;  4C7N A;  2J59 M;  3M0D A;  1VQK P;  2KR5 A;  3DS0 A;  3GHG C;  1AQT A;  1VQ6 P;  3WUT A;  1FJP A;  2FYZ A;  1RF0 C;  3TNU A;  5AVX B;  1JB0 J;  1IC2 A;  2AVA A;  4WYM A;  3B5N A;  2IYP A;  1AVO A;  4IFM A;  1G1J A;  2E42 A;  2A06 G;  2M3E A;  5H2F H;  2K93 A;  1AQ5 A;  2JYL A;  3P8C D;  4H2Y C;  1PPJ G;  1BSH A;  1YQ3 C;  2W27 A;  5AW8 B;  4K35 A;  3CX5 D;  5TIS H;  1ZR2 A;  1BDD A;  1SQX J;  4GR2 A;  3W68 A;  2KOO A;  2K9J A;  1LTG C;  2FFD A;  2K0D X;  1BDC A;  3H1L J;  5AVS B;  4RKU J;  2M8L A;  1KTM A;  2FAE A;  5BS1 A;  3MHV A;  2K5X A;  1VQ4 P;  2V7Q H;  2LTE A;  2QM8 A;  1ZNV A;  3IAO A;  3CCM P;  3VYI A;  3GG2 A;  3FXE A;  1OW6 A;  1J2J B;  1KFM A;  2XZ0 D;  1S3J A;  2FVA A;  4NPE A;  2GDX A;  1EC5 A;  3L73 E;  2GUS A;  2N5I A;  3EQ2 A;  1USD A;  3U59 A;  2H88 C;  2FAD A;  1HVV A;  2E76 B;  1SP4 A;  1NU1 E;  1X8Y A;  1JOC A;  2E76 C;  3CPW O;  2AFE A;  1N7L A;  2MF4 A;  3HE5 A;  1J1E B;  5TJH A;  2ITA A;  3KZI E;  2ZFC A;  2LPK A;  1AYI A;  3GZM A;  3GLM A;  4MN4 C;  4BWN A;  3A7O A;  2QVA A;  3CWB G;  1DV5 A;  4DOJ A;  5KP7 B;  1OR5 A;  4UB6 E;  1EZV I;  1LT9 C;  1X0T A;  5AVR B;  4H44 D;  4BRY B;  1TU3 F;  5CMZ A;  1ZOY C;  1VQ5 P;  4L76 A;  4H44 B;  3NTN A;  2WSC H;  1VQN P;  5AVQ B;  3DTJ A;  2EHT A;  1AV1 A;  2W8Z A;  4H44 C;  2N5H A;  2ZYA A;  4BPH A;  1SQV G;  3V2Q A;  3VTP C;  2A45 I;  4BXL A;  3T97 A;  1FOS E;  5B66 H;  2KGE A;  2XNX A;  2N6Y A;  1LJ2 A;  2AFD A;  1DIP A;  1IO4 A;  1E6J P;  1L0N G;  4GOF A;  2GZG A;  5KJ7 D;  2KOR A;  1GPJ A;  1OFC X; 
#chains in the Genus database with same CATH homology
 3CMA P;  2QEX P;  2PEO A;  2BUO A;  2EIA A;  2LF4 A;  3E2D A;  5F2N A;  1S72 P;  2PEI A;  2EFJ A;  1K8A Q;  2OTL P;  1M6N A;  1PEM A;  3H0D A;  3G0V A;  1K9M Q;  1N8R Q;  1YIJ P;  1QVF O;  1PEQ A;  2L6E A;  3CCL P;  1A8O A;  2Z46 A;  3B5I A;  4IPY A;  1VQM P;  1A43 A;  4PH0 A;  2BQ1 E;  1RO2 A;  1ZMB A;  1RNI A;  3CCE P;  3CD6 P;  1KC8 Q;  3DS1 A;  3DS3 A;  3DPH A;  5F2K A;  2BHV A;  2PEQ A;  3CPW O;  2E1M A;  1VQK P;  3DS0 A;  5BS2 A;  3LRY A;  1VQ6 P;  1M6E X;  5I4T G;  1K30 A;  4U0B A;  3HYB A;  3G4S P;  3G21 A;  3RG6 C;  4XRO A;  2PY8 A;  1W2B O;  3CCQ P;  3NTE A;  4WYM A;  3DS4 A;  1JJ2 O;  1VQ8 P;  4COC A;  3CCS P;  4XRQ A;  3I55 P;  1YJN P;  3MGE A;  1BAJ A;  2PEJ A;  4U0C A;  1K73 Q;  3CCV P;  3CME P;  1QVG O;  1PEU A;  5F2O A;  1M74 A;  2XV6 A;  1NJI Q;  4U0E A;  2XT1 A;  1AUM A;  2XXM A;  3CCJ P;  2KOD A;  3P05 A;  2JYL A;  3G1G A;  5HGN A;  3H4E A;  3G6E P;  1VQ9 P;  2JYG A;  1EIA A;  1M1K Q;  1QRJ A;  2P9X A;  1YIT P;  4GR6 A;  4U0D A;  3CC4 P;  1Q81 Q;  3G29 A;  1Q86 Q;  1VQ5 P;  3I56 P;  5DCK A;  1Q7Y Q;  1EOQ A;  4COP A;  1VQL P;  1VQN P;  1IUQ A;  2M8N A;  1YI2 P;  5JPA A;  2Z45 A;  1VQ7 P;  3DTJ A;  2CWO A;  4PH1 A;  4GR2 A;  2Z44 A;  5HGO A;  5HGL A;  4QNB A;  4M0I A;  4U0F A;  3CXC O;  3HZQ A;  3CCR P;  2DGY A;  1KQS O;  4XFX A;  2M8L A;  3G26 A;  3CCU P;  3G71 P;  1YJ9 P;  2EG5 A;  3WBH A;  4U0A A;  3DS5 A;  5BS1 A;  3CC7 P;  3VRL C;  1VQ4 P;  4XFZ A;  2PEK A;  2PEN A;  1M90 Q;  1KD1 Q;  2OTJ P;  2JO0 A;  3DS2 A;  4XFY A;  3OW2 O;  3M1M A;  1Q82 Q;  1D1D A;  2ONT A;  2OAR A;  3CC2 P;  3CCM P;  2M8P A;  2PEM A;  1E6J P;  1YHQ P;  2QA4 P;  1VQP P;  5HGM A;  1YJW P;  3H47 A;  3G28 A;  1RO0 A;  3Q20 A;  1VQO P;  1PEO A;  3G1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...