1KQSO

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1kqsO02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1kqsO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1kqsO03
3CCLP 3CCQP 1YHQP 3CCRP 1VQ4P 3G6EP 3CMAP 1KD1Q 1VQNP 1VQKP 3CCVP 1Q81Q 1VQMP 1YJWP 1Q82Q 3CC4P 1M90Q 1K8AQ 1Q86Q 3CXCO 3G71P 3CPWO 1YJ9P 1K73Q 1M1KQ 1KQSO 1QVFO 1KC8Q 3I56P 3CCUP 1K9MQ 1S72P 1VQ5P 1JJ2O 3CC2P 1VQ9P 3CCEP 2OTLP 1NJIQ 2OTJP 1Q7YQ 1YITP 1YJNP 1YIJP 3CCMP 2QA4P 3CC7P 1YI2P 1W2BO 3I55P 1VQLP 1VQ7P 2QEXP 3CD6P 3CCSP 3CMEP 3CCJP 3OW2O 1N8RQ 1VQOP 1VQ8P 1VQPP 1VQ6P 3G4SP 1QVGO
chains in the Genus database with same CATH superfamily
4IFFA 4PD4D 1IK7A 1HBWA 2Q3IA 2NPSB 2E74D 2CGQA 2OYHB 2P9XA 3IFMA 1RO2A 3DTJA 3A0BH 2KLVA 1IO4A 1TU3F 1T2KC 1GD2E 1R5SA 2WSFJ 4HJGH 2EIAA 4R0MA 1R5LA 1JB0J 2FQ2A 4N78D 5KKZB 1P84H 3RBXA 1VQPP 1KFNA 1JO5A 1PEUA 1J2JB 2PGDA 1M90Q 1L0LD 1ACPA 4AUWA 3FX0A 2GUVA 3RK3D 2XT1A 1N73B 7CEIA 5APQA 3AEGC 3RK2B 1SFCC 1OVVA 1SFCA 2ZXEB 1FU1A 1FOSF 2YNYA 1SP4A 3AE6C 3CI9A 1MV8A 4UB8E 4U3FJ 2E75C 1QL2A 5KAFE 3SSUA 2ZFCA 3G6EP 1GDTA 2WSSH 4D6TG 1L0IA 1EZVI 2K88A 1VDFA 4GKGA 3CXHE 4BPFA 1VF5B 1BCCJ 3S9OA 1NOHA 2QJPB 3Q5PA 1GW3A 4EIJA 1NHLA 1U57A 1QVGO 3CCLP 1FOSE 3CCRP 3V6IA 1RE4A 1GXGA 3KZIH 4KHXA 4YXDC 2EG5A 3CCUP 3H1LE 3RK3C 3MGNA 1L0NG 1QGKB 2HLOA 3V2PA 2O01N 3NMDA 2M8NA 1BE3D 4WBAA 1BGYE 1P84E 4PD4E 1SQQG 1YYCA 4H0LD 4GOFA 2QVAA 4PV1D 2Y0EA 1RO0A 1NTKD 3OAKA 1ZRTD 1WT6A 1EQ7A 1X9VA 4HYTB 1ZW0A 2RMZA 3IF4A 4GR6A 1BSNA 3L35A 3D71A 2JJLA 1L0LE 2PRRA 1DX7A 1JEKA 1ZMEC 4F37A 1JY2N 2FQ0A 3CC2P 3CCEP 2IZ0A 1DEEG 1RF1B 5KLVK 4XFYA 2LIWA 3H1IG 1GU4A 1PGJA 1VL2A 3VMYA 5AW4B 3R4YA 1FAVA 3TDKA 3H32B 3CMAP 4I6MC 4H0LC 4M3LA 4I2LC 3MP7B 2FHSC 1H88A 3H1LJ 2GDYA 4PV1C 3L75D 3EJDA 1SQPK 2KS1B 2H7HA 2MR8A 1SQBG 1FZFA 4RKUJ 3GZLA 2KOOA 1JOCA 1NTZE 4D6TD 1BGYJ 5GTIE 2BHVA 2IPPA 3EWKA 4DG9A 1JMMA 4N3YB 5DCKA 2JU2A 2E5TA 3P05A 3ABVC 2K2QA 1VQ9P 1EZVD 2JO1A 2L4BA 4R4MA 2HODA 2L22A 1W2BO 1BE3E 2QJYB 3EQ2A 1BDCA 5CHXA 1XTCC 1L0LJ 5AVYB 2N1TB 1ZRTE 2RH0A 2PP6A 3H0DA 4HKGA 4WVZA 3V2QA 1EOQA 1SQQD 1YITP 5CCHD 3HRNA 1R8EA 2Z44A 2BCCE 1KILB 1MFZA 2NZ2A 2RN0A 2Z46A 2ITAA 1AQ5A 3HE5A 3L73E 3D6YA 1A8OA 2JEEA 5AVTB 2CG5B 1S5LE 2JAZA 4ZMDA 2HG5D 3RG6C 2WITA 2KODA 1IFJA 3L75E 1RQUA 3SFEC 4U0CA 4QMAA 4B86A 1GTWA 1BE3J 5CCHC 3WU2H 5CCHA 2NRGA 4YXWH 4L76A 4RJTA 2FQ1A 4U0DA 1SQBD 5AVSB 1NU1D 1NTKJ 2IYOA 2QM7A 2HPCA 4OGQB 2D2CB 3HE4A 1NYHA 1PV3A 4U3FG 3M0DC 3W68A 2BCCJ 1PGOA 3M0DA 1CW5A 2ZVOB 1GU5A 2L0QA 2OYIC 3HUSB 5H2FE 1IMQA 1BCCG 3EFGA 2OYIA 1K04A 1VPCA 2J59M 3Q1MA 3L72D 2MR7A 1KB9E 4GR2A 5TISH 1HY8A 1M1JC 2XU6A 4JYBA 3E2DA 2KORA 4XRQA 2GZJA 4IZ6A 4Y99B 3L75J 2JKVA 1OVRA 1SS1A 2WPQA 4W7ZA 2HR3A 2FAEA 1VQ5P 3L37A 3MGEA 2JDIH 4DJGA 2WSEJ 3AECC 3CLQA 1LGHB 3B8EB 3AE9C 4LLHA 3WU2E 2N9BA 1S9KE 5AVXB 5AW0B 1NAFA 4U0EA 1H0TB 1KORA 1GK4A 2O01J 3L71D 1JCDA 3GMAA 4XROA 1W2EA 1ZMBA 1QL1A 2OTLP 3AE8C 4DCKA 4K35A 2B89A 3GZMA 4UHPB 1BXIA 3LW5J 5KP6B 2JP3A 3CXHI 1Y8AA 3M9HA 1KV4A 2EHTA 2N6ZA 3JSVC 3V4WA 1LTJC 1DNYA 2V7QH 3L74E 3E1RA 1KQSO 3V2NA 4WY4D 1H8AA 2G3AA 1LP1B 3V5BA 3D70A 2K93A 1J1EC 2Q3EA 2K9JA 3FXEA 5TISE 1Y9BA 4KT0J 1IK9A 1EDLA 1NTME 3H1LG 2GZIA 4PD4I 1P84I 4H2XC 3CCVP 3HTKB 3P8CE 1NKNA 3L72E 1AYIA 5CCGA 4GT1A 4NPDA 1BGYG 1FDIA 4ASWA 3DS1A 3P8MC 3TSIA 2BEZF 3B4SA 3CL3D 3AE4C 2WVRA 4GDOA 5HGMA 5DJTB 3CD6P 1KQFB 1BCCD 3W67A 1OWAA 1G2CA 2M8PA 3G9RA 1SQXD 3TNUA 1KYOH 1QEXA 5KP8B 4HH2A 5AW6B 1QVFO 1HWTC 4L74A 4WY4C 2VLPA 1BSHA 2KOGA 4WY4A 1VQLP 1L0LG 2H8PD 2PEQA 3PLNA 1NU1J 4GIFA 4HB1A 2KUBA 2ZYGA 2QJKB 2JYGA 2K37A 2LKIA 3II6A 5I4TG 5KAIE 2FXPA 2GUSA 1D1DA 1URQD 2E5YA 2MD9A 2FFDB 1LT9A 1M6EX 1FZEA 2A45H 3FWLA 2ZT9D 1OW6A 1J1DB 2KGAA 1N7SD 3L72J 1MZ9A 2R5DA 3EJBA 3WUVA 2PENA 2C9NY 1HTLC 5AW1B 4H13B 2JB0A 2ZYDA 4H44D 3O6QA 1Z6MA 3G1IA 5GTHE 5EJDA 2YIUB 3DS3A 1EIAA 1SQVE 2PEMA 3Q2YA 1JUNA 4JF7A 2Q5UA 5JPAA 4RO0A 1M1KQ 1BE3G 3WMM0 4PH1A 3H1LD 2YKOA 1URQC 1DV5A 3CMEP 2V4HA 1URQA 1NTKG 2Q7CA 1VQ6P 1SQXE 1BGYD 1P84D 2ZT9C 3L71J 2WSCJ 2AFEA 3GG2A 2NPSD 1SVFA 1JCCA 1SFCB 1N7SC 3VP8A 4BXLA 2BCCG 5EW5E 1E0HA 1HJ0A 1N7SA 2EFJA 3JC22 4H44C 2QIWA 3C1LA 2Z4EA 3WUTA 5AVQB 4BPGA 3VTPC 2E74B 4OVNF 2K3RA 4OH8B 3GHGB 3RK2D 3VP9A 2AF8A 1RF0C 1YI2P 1FDOA 4PWVB 4ZKUA 3JCUH 1RF0A 2CWOA 3L75G 1E6JP 5KLIB 3G29A 3RK3B 2O1KA 2NPSC 2OYHC 3G26A 1S2EA 2NPSA 5HV8A 1FBMA 1CI6B 2OYHA 1ZNVA 4MRTC 1L2PA 1VF5D 2Z5IA 5KKZC 1EZVG 1NTZD 1SQXJ 1AQTA 3PRJA 1N86A 4W7YA 4LGDE 2WTYA 4JYCA 2M5AB 1N73C 3A0BE 1K30A 3FXDA 3RK2C 1KTMA 2JBGA 3VMXA 1L0NK 1KB9I 4O9BA 3USSA 2A06D 2P2UA 1Q81Q 3BVHA 1SQQK 1PPJE 2IYPA 2E42A 1HJBA 2LOLA 1VQ7P 3JCUE 3LMOA 1VF5C 2FACA 2G8YA 2C0WA 2QJPC 2BCCD 2KOQA 1QRJA 2IDBA 1OW8A 4PV1B 3NTEA 3H1HE 1M57D 2XXMA 2LXBA 3H47A 3F89A 4YPCA 3L73D 1T3JA 2KI7B 2WPTA 1OX3A 3H25A 1N8RQ 3VOPA 1RE3C 2N5HA 3CX5H 4WWIA 1WRGA 3IR9A 3KZIE 3QWOC 4K3AA 3AEEC 3VN0A 1NU1G 2FYUE 1OR5A 1YQ3C 1IC2A 1EMVA 2KGEA 1UNKA 1SQBK 4CA3A 1KFMA 5K5GB 3MD0A 2KNCB 4ASVA 3MUDC 5HGOA 2L9FA 1JY3O 2GZFA 3MUDA 1ZN5A 2OGUA 1M56D 4COPA 4H2WC 3P7KA 4Y28J 1SLQA 2A06E 2POHA 1VQ8P 3UIAA 3KDPB 4IPYA 3B5ND 2ZAEB 3L72G 2CPBA 2P58A 4XFJA 4A7PA 3H1HJ 3L4FA 2P7JA 1Q7YQ 2B88A 3O8ZA 1KB9D 3RGUA 3PP5A 2W6BA 3CX5E 1LT1A 4WYMA 2K9YA 1X0TA 1E79H 1FS0E 2XKMA 1HGZA 5CBNA 2IBZD 2XZRA 5KJ7D 1AVOA 2FYUJ 1RY3A 2PNGA 1NTZJ 2K5XA 3TYYA 2JQ4A 1GZLA 2VLQA 5BS1A 3L71G 4U7JA 2QJYC 1EXJA 3B5NC 1S9KD 1NVOA 3M0AA 2AFDA 3B5NA 3EFFK 5B66H 2P1JA 5HVCA 1NWQA 3L70E 3MZWB 3KHUA 3AEBC 1FZCB 3L36A 1WMKA 1LTSC 4I1LA 4MN4C 1ZXGA 3V2RA 1JM0A 5APVA 2XV5A 3H6PA 4RESB 1VQ4P 1BDDA 1YQ4C 4XFZA 1UIIA 1YTZI 3RL0D 4PXHB 4OGQD 3L74D 2D2CD 1SQPD 1XTGB 2KSEA 2M3BA 3WUUA 2FVEA 5KJ7C 3M1MA 1FJKA 1S3JA 3Q5SA 3Q5RA 5KJ7A 2FYZA 5BU8B 5AW7B 5AVWB 3DS4A 2UWJE 1KMIZ 4JBZA 1NTMD 4U0AA 2BEQD 2MY5A 3F5HA 1LWUB 1KC8Q 3L73J 2YXQB 2QM8A 1Q2NA 3P8CD 3D6ZA 3T97A 1GMJA 2JO0A 4C7NA 1SQXG 1L0NE 2JWDA 1KILE 2GYKA 2WT7A 2XDJA 2Q6QA 3HZQA 1M1JA 5AW9B 2FYNB 4N6JA 1USEA 5B66E 3L70J 2M3EA 1QLED 3RL0C 5AW5B 1AF8A 4OGQC 5AVZB 1HVVA 2IBZE 4IFMA 2D2CC 3R2PA 1IFIA 3KPEA 3KQGA 4EOTA 2ZVNB 2JR8A 2XV6A 4DZOA 1X3OA 2H89C 2KGCA 2LPKA 4ZKPA 3CXCO 1L0HA 3HUSC 2K9JB 2FXOA 3FWNA 2RKLA 2GDXA 5KLVE 2QSIA 2K92A 2FVFA 1PEMA 2AEJA 2XZ1C 4IL6H 3H1IE 2EHSA 1EDIA 1GL2B 1A43A 2C0XA 1PP9E 4Y99C 2MKVA 1LTJA 1SQPE 1FDMA 3TF5A 1U7JA 4U0BA 2W83C 2QA4P 1CZQA 5AW2B 5BU5A 1G2CB 3CWBE 1DD3A 2PEKA 3M9QA 1T3UA 3AE1C 3GLMA 2FY8A 2WPRA 4YTPC 3S1KA 1SQVD 1KQLA 2LL8A 3I56P 1KYOD 1L4AB 2KSJA 1H0TA 2KW2A 2IZ1A 1YHQP 1PPJG 3LIDA 3LRYA 1JTHA 2Q1KA 1OXZA 3U1AA 4QNBA 1ZR4A 3HD7B 2E76B 4H2YC 5KLVJ 1LT9B 4NEOA 4AYCA 1LP1A 2YMKA 4EDFA 1T6AA 2BASA 1Y47A 3H1HG 4IL6E 3DPHA 5CBOA 1L0LK 2J58A 1T8KA 5BS2A 1PP9J 2R5BA 2QRXA 3L74J 3O6QB 1SQPJ 2PEIA 2Z45A 3VYIA 1K05A 4TT3H 1EXIA 2VLNA 4JPZB 3CWBJ 3N4XA 3G1GA 2QNWA 2B87A 2YKQA 2K94A 2QG4A 1NTMJ 4QKOA 4I7ZC 1NKZB 1MFTA 2FYUG 3NXSA 3AEDC 2OARA 1GW4A 1NTZG 1ZOYC 4BRYA 1FZGA 2KG9A 1URQB 4XE5B 1YJNP 4IL6X 1IFNA 2LR2A 4GOEA 2CNRA 1OFCX 4H13D 5F2KA 2MVVA 1NTZK 3TGUD 2P10A 2ZT9B 3GF3A 2ZXXA 1ZP0C 4ZNCA 2QJKC 1KYOE 2AXTH 1FZAA 2YXRB 1S72P 2W8ZA 2FADA 4GODA 2A06G 3CC7P 2PEJA 4EI2A 2WPSA 2KGDA 1PL5A 4UB8H 4U3FE 1QX8A 2Z5HA 2GZEA 1J1DC 3CX5I 1NTKK 3AEFC 2V7QJ 4TLFA 2I8DA 1EDKA 1NQ4A 3CXHH 2KK7A 2R3CA 5DJUB 1PPJD 1CEIA 3GW6A 4H13C 2K0YA 2E75B 4JQ0D 2YIUC 3L73G 2XNXA 3H1KE 3RG2A 2FBWC 1JY2O 2PEOA 3BCCD 5B5EH 2N98A 2LTEA 3H1HD 2ZYAA 1NGMB 1X22A 3A0HH 2KZJA 4OWFA 1DEBA 2KG8A 3V4QA 2FKWB 5F2OA 5APSA 4PD4H 1FJPA 3L70G 3VMZA 4DOJA 1SQVJ 1KD1Q 2GA1A 1CSBA 2W27A 2AXTE 3H1JD 3GKLC 2KZIA 2ROQA 3IAOA 5HGNA 2XZ0D 4KJMA 3TGUE 1HF9A 2MF4A 3K5BA 2KR5A 2FYUD 1X8YA 1OIPA 3U59A 2Y0CA 1ZR2A 2KB7P 2YKPA 5APYA 3RL0g 2M8RA 1Q86Q 2E74C 1IZNB 4XFXA 3BRVB 2H43A 3GHGC 3CCMP 4C7RA 2WMMA 3B71A 5E79H 1N73A 2QEXP 3GHGA 1F80D 1MZ8A 2X2BA 4BPHA 1RE4C 4HKZH 1GXHA 2KG6A 5TJHA 3H1KJ 1VQKP 5APXA 3A3YB 1MUUA 5KLIC 2AEMA 2LIUA 1UJZA 2E1MA 3BATA 5B5EE 2K0DX 3SWYA 1OZHA 4BWNA 3MIWA 2CQ8A 3A0HE 2IBZI 3H4EA 2VLOA 5BVZA 1RNIA 3NTNA 2OYOA 3NY7B 2R3SA 1HUCA 5GTIH 2M5RA 1CI6A 3PHLA 2PY8A 3Q3DA 4R4LA 2M8LA 4H0LB 3B4QA 1S4XA 3BCCE 2IBZG 5EFWB 5CJ4A 3CX5D 1K9MQ 2JYLA 3LIEA 1A02F 1RHZB 1NH4A 3KYQA 4N78E 3TGUJ 1IMPA 2FXMA 2M5AA 5AVRB 2I1KA 1OMIA 4IOIH 2KWLA 4IFDK 5AW3B 1JY3P 3RK3E 2P67A 1G1IA 2N50A 1IFMA 5KLVG 3H1JE 1RE3A 2HODB 2JGPA 1JJ2O 2DNWA 3L70D 2KXPB 3SWKA 5E79E 4W80A 2QE7H 1VQOP 1LTBC 1PP9G 2OTKE 3L74G 1OVUA 1W5CE 1SQPG 1FE6A 1NU1K 3B5IA 1YJWP 3M9BA 1AUMA 3CWBG 3VRLC 2N5IA 2LKMA 4PH0A 3AE3C 1FR2A 1S5LH 1AVYA 1NTMG 3SFDC 5AVUB 1PEOA 1RF1C 2L5GB 4PJ0H 3PTZA 1RF1A 3HE5B 1NTMK 2HFED 3BCCJ 2Y9YA 3Q20A 1HH0A 1X79B 3CE7A 2N1TD 3H32A 2WSEH 2KOSA 3BASA 4XA4A 4U0FA 1FC2C 2CK3H 2Q9IA 1M74A 1NAYA 2KS1A 3B5NB 5CJ0A 1L0ND 1KQGB 1KILD 1KN7A 1VQNP 2YMYA 4LC1A 1NTKE 3NFQA 3H1JJ 1K8AQ 1EC5A 1IFDA 2O01H 2ERHA 2KNCA 4UB6H 4L75A 1LTGC 1PZQA 3TK1A 3LW5H 1LTIC 1A02J 1MKMA 1RH5B 2LMLA 4DT0A 3CCQP 2O3JA 4M0IA 2HPCB 3WBHA 2Y0DA 2W6JH 3HE4B 5H2FH 1M8OB 2N1TC 3AE7C 2N1TA 1KB9H 5KLVD 4PJ0E 2L6EA 3U1CA 2BUOA 2IFNA 1GPJA 2J5UA 1KILC 3M06A 3MHVA 2OYIB 3H1ID 3T97B 1LTAC 1KLPA 1K73Q 1KILA 3HYBA 3CPWO 4C7NB 4NPEA 3DS2A 1KYOI 1PP9D 1DD4A 2BQ1E 3MTUE 2WT7B 2GZGA 3GJNA 2PAJA 1SQVG 4D6TE 3M91A 3AEAC 1M1JB 1OW7A 3CCJP 2W90A 3CWBD 3S4RA 2E43A 1SQVK 2MVUA 1VQMP 3RL0B 1EZVE 1S5LX 5AW8B 3PJSK 1PGQA 2YO3A 1JY3N 4UB6E 1FZCC 1DH3A 1USDA 2R32A 5APUA 1AFOA 1FZCA 4WB4A 3C8VA 2KP8A 1PFIA 3AE2C 5HGLA 1SQXK 1HQBA 3SWFA 2Y9ZA 1GK6A 1SQQE 1YBKA 2A45I 1LNQA 2WPVB 1JNMA 1DIPA 1Q90D 3H1KG 2ZJSE 2A45G 2LF4A 3DS5A 1LTJB 5CZDB 2DW3A 5L8RJ 3G71P 1LWUC 1ZLLA 1LTTC 2OQQA 1LWUA 3RBZA 1J1EB 4D6TJ 3HUSA 5APTA 1EDJA 3CCSP 2CPSA 3A2AA 3G4SP 2WZ7A 5CMZA 5CCGD 1G1JA 1GL2D 2MJZA 2FYNC 2W6AA 1VHNA 3TGUG 1FZBA 2OTJP 4Z1MH 3BRTB 2KOPA 3P32A 1PIXA 1L0NJ 1S1CX 1JTHB 2HYNA 2FVAA 1N7LA 3TNUB 1SQBE 1NU1E 4NPFX 2YO2A 2WSCH 2KLUA 1SQQJ 5KAIH 2C9LY 3DS0A 4WY4B 2IFMA 1JMBA 1LJ2A 1L4AD 3E1IA 5M1BA 2WSFH 2IX7C 1H89A 1IUQA 1AJYA 2SPZA 4U3FD 5CCGC 4COCA 1GL2C 3A7OA 2H88C 1M6NA 3HD7D 1GL2A 1NJIQ 2E76D 2B87B 2R44A 2JWAA 1AA0A 3IN6A 3OJAB 2I1JA 5GTHH 1Z56A 3G28A 3BCCG 2VSQA 2KIKA 1IFPA 3G3ZA 4L73A 4I7ZB 3H1IJ 2DGYA 2O1JA 2AXCA 1PGPA 3GF7A 1UIXA 4BRYB 4CPGA 2AVAA 1NO4A 1Q82Q 1RQVA 3H1KD 2WQYC 5KTBA 1AV1A 2PFXA 3HTKA 5AVVB 1L4AC 1E5WA 3EJEA 3KXDA 3I55P 1L4AA 1BAJA 1ZV8A 3OW2O 3H1JG 1KZUB 1SQBJ 5F2NA 3FGAD 3L71E 2NO8A 1YTZT 3PH0A 3HD7C 3I5CA 1U7MA 2E76C 5APWA 2N9YB 3HD7A 2FYUK 1LT9C 2M0BA 2KYVA 2LXCB 4C46A 3OA7A 3A5TA 3QH9A 3ITKA 5C39A 1N7SB 3VMAA 3E7KA 2JU1A 2N6YA 2VRSA 3G21A 1T2KD 1YIJP 1PEQA 1HGVA 4H44B 2K1AA 3CXHD 4EYYQ 1D7MA 3C9IA 2K0XA 5KP7B 2L91A 1VKUA 5KAFH 1JY2P 2FFDC 2GM4A 2XNDH 3CC4P 3ZDMA 1YJ9P 2FFDA 2B9BA 1SFCD 1M7LA 2AEFA 3AE5C 3U43A 1IJDB 1N2DC 2GDWA 2ONTA 1BCCE 3G0VA 2WWWA 3N7NA 4AQRD 2E75D 1T8ZA
chains in the Genus database with same CATH topology
3CCQP 4M0IA 2DGYA 1VQ4P 1KD1Q 3CCVP 3WBHA 4XFZA 1A43A 1Q82Q 5HGOA 5JPAA 3G71P 1M1KQ 3H0DA 1RO0A 1JJ2O 2OARA 2P9XA 1EOQA 4PH1A 1RO2A 3DTJA 1K30A 1YITP 4U0BA 4COPA 1YJNP 2EIAA 5HGNA 2QA4P 3DS1A 3I55P 2Z44A 4GR2A 5F2KA 3CCSP 1BAJA 2PEKA 3CMEP 3M1MA 3OW2O 2L6EA 5HGMA 1VQOP 2BUOA 1VQ8P 3E2DA 4IPYA 1VQPP 3CD6P 1VQ6P 3G4SP 4GR6A 5F2NA 2M8PA 4XRQA 3DS4A 3B5IA 1PEUA 1Q81Q 2Z46A 4U0AA 1YJWP 1M90Q 1Q86Q 1K73Q 3HYBA 3CPWO 1AUMA 1KC8Q 3I56P 2XT1A 1QVFO 1S72P 4XFXA 3VRLC 1VQ5P 3DS2A 3CC2P 3CCEP 1A8OA 3MGEA 2OTJP 4PH0A 1Q7YQ 2BQ1E 2JO0A 3CCMP 3CC7P 4XFYA 2EFJA 2PEJA 1VQLP 1VQ7P 2QEXP 1PEOA 2PEQA 3CCJP 3RG6C 2KODA 3HZQA 1YHQP 1QRJA 3G6EP 3CMAP 1VQKP 3LRYA 2JYGA 1VQMP 3Q20A 4U0EA 4WYMA 3NTEA 2XXMA 2E1MA 3DS0A 3H47A 5I4TG 4QNBA 4U0CA 4XROA 1ZMBA 2OTLP 3G21A 1YIJP 1D1DA 1PEQA 1YI2P 3H4EA 4U0FA 1RNIA 1M74A 2CWOA 1N8RQ 5BS1A 1E6JP 2BHVA 2XV6A 2PY8A 5HGLA 1QVGO 3CCLP 1IUQA 2M8LA 1M6EX 3DPHA 3CCRP 1VQNP 4U0DA 5DCKA 3CC4P 3G29A 5BS2A 2PEOA 4COCA 3CXCO 1K8AQ 1YJ9P 3P05A 1M6NA 1KQSO 1K9MQ 2EG5A 3CCUP 2JYLA 2PEIA 2Z45A 1VQ9P 2PENA 1NJIQ 3G26A 1W2BO 2ONTA 3G1GA 3G1IA 3G28A 5F2OA 3G0VA 2M8NA 2LF4A 1PEMA 3DS3A 1EIAA 3DS5A 2PEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL P;  3CCQ P;  1YHQ P;  3CCR P;  1VQ4 P;  3G6E P;  3CMA P;  1KD1 Q;  1VQN P;  1VQK P;  3CCV P;  1Q81 Q;  1VQM P;  1YJW P;  1Q82 Q;  3CC4 P;  1M90 Q;  1K8A Q;  1Q86 Q;  3CXC O;  3G71 P;  3CPW O;  1YJ9 P;  1K73 Q;  1M1K Q;  1KQS O;  1QVF O;  1KC8 Q;  3I56 P;  3CCU P;  1K9M Q;  1S72 P;  1VQ5 P;  1JJ2 O;  3CC2 P;  1VQ9 P;  3CCE P;  2OTL P;  1NJI Q;  2OTJ P;  1Q7Y Q;  1YIT P;  1YJN P;  1YIJ P;  3CCM P;  2QA4 P;  3CC7 P;  1YI2 P;  1W2B O;  3I55 P;  1VQL P;  1VQ7 P;  2QEX P;  3CD6 P;  3CCS P;  3CME P;  3CCJ P;  3OW2 O;  1N8R Q;  1VQO P;  1VQ8 P;  1VQP P;  1VQ6 P;  3G4S P;  1QVG O; 
#chains in the Genus database with same CATH topology
 4IFF A;  4PD4 D;  1IK7 A;  1HBW A;  2Q3I A;  2NPS B;  2E74 D;  2CGQ A;  2OYH B;  2P9X A;  3IFM A;  1RO2 A;  3DTJ A;  3A0B H;  2KLV A;  1IO4 A;  1TU3 F;  1T2K C;  1GD2 E;  1R5S A;  2WSF J;  4HJG H;  2EIA A;  4R0M A;  1R5L A;  1JB0 J;  2FQ2 A;  4N78 D;  5KKZ B;  1P84 H;  3RBX A;  1VQP P;  1KFN A;  1JO5 A;  1PEU A;  1J2J B;  2PGD A;  1M90 Q;  1L0L D;  1ACP A;  4AUW A;  3FX0 A;  2GUV A;  3RK3 D;  2XT1 A;  1N73 B;  7CEI A;  5APQ A;  3AEG C;  3RK2 B;  1SFC C;  1OVV A;  1SFC A;  2ZXE B;  1FU1 A;  1FOS F;  2YNY A;  1SP4 A;  3AE6 C;  3CI9 A;  1MV8 A;  4UB8 E;  4U3F J;  2E75 C;  1QL2 A;  5KAF E;  3SSU A;  2ZFC A;  3G6E P;  1GDT A;  2WSS H;  4D6T G;  1L0I A;  1EZV I;  2K88 A;  1VDF A;  4GKG A;  3CXH E;  4BPF A;  1VF5 B;  1BCC J;  3S9O A;  1NOH A;  2QJP B;  3Q5P A;  1GW3 A;  4EIJ A;  1NHL A;  1U57 A;  1QVG O;  3CCL P;  1FOS E;  3CCR P;  3V6I A;  1RE4 A;  1GXG A;  3KZI H;  4KHX A;  4YXD C;  2EG5 A;  3CCU P;  3H1L E;  3RK3 C;  3MGN A;  1L0N G;  1QGK B;  2HLO A;  3V2P A;  2O01 N;  3NMD A;  2M8N A;  1BE3 D;  4WBA A;  1BGY E;  1P84 E;  4PD4 E;  1SQQ G;  1YYC A;  4H0L D;  4GOF A;  2QVA A;  4PV1 D;  2Y0E A;  1RO0 A;  1NTK D;  3OAK A;  1ZRT D;  1WT6 A;  1EQ7 A;  1X9V A;  4HYT B;  1ZW0 A;  2RMZ A;  3IF4 A;  4GR6 A;  1BSN A;  3L35 A;  3D71 A;  2JJL A;  1L0L E;  2PRR A;  1DX7 A;  1JEK A;  1ZME C;  4F37 A;  1JY2 N;  2FQ0 A;  3CC2 P;  3CCE P;  2IZ0 A;  1DEE G;  1RF1 B;  5KLV K;  4XFY A;  2LIW A;  3H1I G;  1GU4 A;  1PGJ A;  1VL2 A;  3VMY A;  5AW4 B;  3R4Y A;  1FAV A;  3TDK A;  3H32 B;  3CMA P;  4I6M C;  4H0L C;  4M3L A;  4I2L C;  3MP7 B;  2FHS C;  1H88 A;  3H1L J;  2GDY A;  4PV1 C;  3L75 D;  3EJD A;  1SQP K;  2KS1 B;  2H7H A;  2MR8 A;  1SQB G;  1FZF A;  4RKU J;  3GZL A;  2KOO A;  1JOC A;  1NTZ E;  4D6T D;  1BGY J;  5GTI E;  2BHV A;  2IPP A;  3EWK A;  4DG9 A;  1JMM A;  4N3Y B;  5DCK A;  2JU2 A;  2E5T A;  3P05 A;  3ABV C;  2K2Q A;  1VQ9 P;  1EZV D;  2JO1 A;  2L4B A;  4R4M A;  2HOD A;  2L22 A;  1W2B O;  1BE3 E;  2QJY B;  3EQ2 A;  1BDC A;  5CHX A;  1XTC C;  1L0L J;  5AVY B;  2N1T B;  1ZRT E;  2RH0 A;  2PP6 A;  3H0D A;  4HKG A;  4WVZ A;  3V2Q A;  1EOQ A;  1SQQ D;  1YIT P;  5CCH D;  3HRN A;  1R8E A;  2Z44 A;  2BCC E;  1KIL B;  1MFZ A;  2NZ2 A;  2RN0 A;  2Z46 A;  2ITA A;  1AQ5 A;  3HE5 A;  3L73 E;  3D6Y A;  1A8O A;  2JEE A;  5AVT B;  2CG5 B;  1S5L E;  2JAZ A;  4ZMD A;  2HG5 D;  3RG6 C;  2WIT A;  2KOD A;  1IFJ A;  3L75 E;  1RQU A;  3SFE C;  4U0C A;  4QMA A;  4B86 A;  1GTW A;  1BE3 J;  5CCH C;  3WU2 H;  5CCH A;  2NRG A;  4YXW H;  4L76 A;  4RJT A;  2FQ1 A;  4U0D A;  1SQB D;  5AVS B;  1NU1 D;  1NTK J;  2IYO A;  2QM7 A;  2HPC A;  4OGQ B;  2D2C B;  3HE4 A;  1NYH A;  1PV3 A;  4U3F G;  3M0D C;  3W68 A;  2BCC J;  1PGO A;  3M0D A;  1CW5 A;  2ZVO B;  1GU5 A;  2L0Q A;  2OYI C;  3HUS B;  5H2F E;  1IMQ A;  1BCC G;  3EFG A;  2OYI A;  1K04 A;  1VPC A;  2J59 M;  3Q1M A;  3L72 D;  2MR7 A;  1KB9 E;  4GR2 A;  5TIS H;  1HY8 A;  1M1J C;  2XU6 A;  4JYB A;  3E2D A;  2KOR A;  4XRQ A;  2GZJ A;  4IZ6 A;  4Y99 B;  3L75 J;  2JKV A;  1OVR A;  1SS1 A;  2WPQ A;  4W7Z A;  2HR3 A;  2FAE A;  1VQ5 P;  3L37 A;  3MGE A;  2JDI H;  4DJG A;  2WSE J;  3AEC C;  3CLQ A;  1LGH B;  3B8E B;  3AE9 C;  4LLH A;  3WU2 E;  2N9B A;  1S9K E;  5AVX B;  5AW0 B;  1NAF A;  4U0E A;  1H0T B;  1KOR A;  1GK4 A;  2O01 J;  3L71 D;  1JCD A;  3GMA A;  4XRO A;  1W2E A;  1ZMB A;  1QL1 A;  2OTL P;  3AE8 C;  4DCK A;  4K35 A;  2B89 A;  3GZM A;  4UHP B;  1BXI A;  3LW5 J;  5KP6 B;  2JP3 A;  3CXH I;  1Y8A A;  3M9H A;  1KV4 A;  2EHT A;  2N6Z A;  3JSV C;  3V4W A;  1LTJ C;  1DNY A;  2V7Q H;  3L74 E;  3E1R A;  1KQS O;  3V2N A;  4WY4 D;  1H8A A;  2G3A A;  1LP1 B;  3V5B A;  3D70 A;  2K93 A;  1J1E C;  2Q3E A;  2K9J A;  3FXE A;  5TIS E;  1Y9B A;  4KT0 J;  1IK9 A;  1EDL A;  1NTM E;  3H1L G;  2GZI A;  4PD4 I;  1P84 I;  4H2X C;  3CCV P;  3HTK B;  3P8C E;  1NKN A;  3L72 E;  1AYI A;  5CCG A;  4GT1 A;  4NPD A;  1BGY G;  1FDI A;  4ASW A;  3DS1 A;  3P8M C;  3TSI A;  2BEZ F;  3B4S A;  3CL3 D;  3AE4 C;  2WVR A;  4GDO A;  5HGM A;  5DJT B;  3CD6 P;  1KQF B;  1BCC D;  3W67 A;  1OWA A;  1G2C A;  2M8P A;  3G9R A;  1SQX D;  3TNU A;  1KYO H;  1QEX A;  5KP8 B;  4HH2 A;  5AW6 B;  1QVF O;  1HWT C;  4L74 A;  4WY4 C;  2VLP A;  1BSH A;  2KOG A;  4WY4 A;  1VQL P;  1L0L G;  2H8P D;  2PEQ A;  3PLN A;  1NU1 J;  4GIF A;  4HB1 A;  2KUB A;  2ZYG A;  2QJK B;  2JYG A;  2K37 A;  2LKI A;  3II6 A;  5I4T G;  5KAI E;  2FXP A;  2GUS A;  1D1D A;  1URQ D;  2E5Y A;  2MD9 A;  2FFD B;  1LT9 A;  1M6E X;  1FZE A;  2A45 H;  3FWL A;  2ZT9 D;  1OW6 A;  1J1D B;  2KGA A;  1N7S D;  3L72 J;  1MZ9 A;  2R5D A;  3EJB A;  3WUV A;  2PEN A;  2C9N Y;  1HTL C;  5AW1 B;  4H13 B;  2JB0 A;  2ZYD A;  4H44 D;  3O6Q A;  1Z6M A;  3G1I A;  5GTH E;  5EJD A;  2YIU B;  3DS3 A;  1EIA A;  1SQV E;  2PEM A;  3Q2Y A;  1JUN A;  4JF7 A;  2Q5U A;  5JPA A;  4RO0 A;  1M1K Q;  1BE3 G;  3WMM 0;  4PH1 A;  3H1L D;  2YKO A;  1URQ C;  1DV5 A;  3CME P;  2V4H A;  1URQ A;  1NTK G;  2Q7C A;  1VQ6 P;  1SQX E;  1BGY D;  1P84 D;  2ZT9 C;  3L71 J;  2WSC J;  2AFE A;  3GG2 A;  2NPS D;  1SVF A;  1JCC A;  1SFC B;  1N7S C;  3VP8 A;  4BXL A;  2BCC G;  5EW5 E;  1E0H A;  1HJ0 A;  1N7S A;  2EFJ A;  3JC2 2;  4H44 C;  2QIW A;  3C1L A;  2Z4E A;  3WUT A;  5AVQ B;  4BPG A;  3VTP C;  2E74 B;  4OVN F;  2K3R A;  4OH8 B;  3GHG B;  3RK2 D;  3VP9 A;  2AF8 A;  1RF0 C;  1YI2 P;  1FDO A;  4PWV B;  4ZKU A;  3JCU H;  1RF0 A;  2CWO A;  3L75 G;  1E6J P;  5KLI B;  3G29 A;  3RK3 B;  2O1K A;  2NPS C;  2OYH C;  3G26 A;  1S2E A;  2NPS A;  5HV8 A;  1FBM A;  1CI6 B;  2OYH A;  1ZNV A;  4MRT C;  1L2P A;  1VF5 D;  2Z5I A;  5KKZ C;  1EZV G;  1NTZ D;  1SQX J;  1AQT A;  3PRJ A;  1N86 A;  4W7Y A;  4LGD E;  2WTY A;  4JYC A;  2M5A B;  1N73 C;  3A0B E;  1K30 A;  3FXD A;  3RK2 C;  1KTM A;  2JBG A;  3VMX A;  1L0N K;  1KB9 I;  4O9B A;  3USS A;  2A06 D;  2P2U A;  1Q81 Q;  3BVH A;  1SQQ K;  1PPJ E;  2IYP A;  2E42 A;  1HJB A;  2LOL A;  1VQ7 P;  3JCU E;  3LMO A;  1VF5 C;  2FAC A;  2G8Y A;  2C0W A;  2QJP C;  2BCC D;  2KOQ A;  1QRJ A;  2IDB A;  1OW8 A;  4PV1 B;  3NTE A;  3H1H E;  1M57 D;  2XXM A;  2LXB A;  3H47 A;  3F89 A;  4YPC A;  3L73 D;  1T3J A;  2KI7 B;  2WPT A;  1OX3 A;  3H25 A;  1N8R Q;  3VOP A;  1RE3 C;  2N5H A;  3CX5 H;  4WWI A;  1WRG A;  3IR9 A;  3KZI E;  3QWO C;  4K3A A;  3AEE C;  3VN0 A;  1NU1 G;  2FYU E;  1OR5 A;  1YQ3 C;  1IC2 A;  1EMV A;  2KGE A;  1UNK A;  1SQB K;  4CA3 A;  1KFM A;  5K5G B;  3MD0 A;  2KNC B;  4ASV A;  3MUD C;  5HGO A;  2L9F A;  1JY3 O;  2GZF A;  3MUD A;  1ZN5 A;  2OGU A;  1M56 D;  4COP A;  4H2W C;  3P7K A;  4Y28 J;  1SLQ A;  2A06 E;  2POH A;  1VQ8 P;  3UIA A;  3KDP B;  4IPY A;  3B5N D;  2ZAE B;  3L72 G;  2CPB A;  2P58 A;  4XFJ A;  4A7P A;  3H1H J;  3L4F A;  2P7J A;  1Q7Y Q;  2B88 A;  3O8Z A;  1KB9 D;  3RGU A;  3PP5 A;  2W6B A;  3CX5 E;  1LT1 A;  4WYM A;  2K9Y A;  1X0T A;  1E79 H;  1FS0 E;  2XKM A;  1HGZ A;  5CBN A;  2IBZ D;  2XZR A;  5KJ7 D;  1AVO A;  2FYU J;  1RY3 A;  2PNG A;  1NTZ J;  2K5X A;  3TYY A;  2JQ4 A;  1GZL A;  2VLQ A;  5BS1 A;  3L71 G;  4U7J A;  2QJY C;  1EXJ A;  3B5N C;  1S9K D;  1NVO A;  3M0A A;  2AFD A;  3B5N A;  3EFF K;  5B66 H;  2P1J A;  5HVC A;  1NWQ A;  3L70 E;  3MZW B;  3KHU A;  3AEB C;  1FZC B;  3L36 A;  1WMK A;  1LTS C;  4I1L A;  4MN4 C;  1ZXG A;  3V2R A;  1JM0 A;  5APV A;  2XV5 A;  3H6P A;  4RES B;  1VQ4 P;  1BDD A;  1YQ4 C;  4XFZ A;  1UII A;  1YTZ I;  3RL0 D;  4PXH B;  4OGQ D;  3L74 D;  2D2C D;  1SQP D;  1XTG B;  2KSE A;  2M3B A;  3WUU A;  2FVE A;  5KJ7 C;  3M1M A;  1FJK A;  1S3J A;  3Q5S A;  3Q5R A;  5KJ7 A;  2FYZ A;  5BU8 B;  5AW7 B;  5AVW B;  3DS4 A;  2UWJ E;  1KMI Z;  4JBZ A;  1NTM D;  4U0A A;  2BEQ D;  2MY5 A;  3F5H A;  1LWU B;  1KC8 Q;  3L73 J;  2YXQ B;  2QM8 A;  1Q2N A;  3P8C D;  3D6Z A;  3T97 A;  1GMJ A;  2JO0 A;  4C7N A;  1SQX G;  1L0N E;  2JWD A;  1KIL E;  2GYK A;  2WT7 A;  2XDJ A;  2Q6Q A;  3HZQ A;  1M1J A;  5AW9 B;  2FYN B;  4N6J A;  1USE A;  5B66 E;  3L70 J;  2M3E A;  1QLE D;  3RL0 C;  5AW5 B;  1AF8 A;  4OGQ C;  5AVZ B;  1HVV A;  2IBZ E;  4IFM A;  2D2C C;  3R2P A;  1IFI A;  3KPE A;  3KQG A;  4EOT A;  2ZVN B;  2JR8 A;  2XV6 A;  4DZO A;  1X3O A;  2H89 C;  2KGC A;  2LPK A;  4ZKP A;  3CXC O;  1L0H A;  3HUS C;  2K9J B;  2FXO A;  3FWN A;  2RKL A;  2GDX A;  5KLV E;  2QSI A;  2K92 A;  2FVF A;  1PEM A;  2AEJ A;  2XZ1 C;  4IL6 H;  3H1I E;  2EHS A;  1EDI A;  1GL2 B;  1A43 A;  2C0X A;  1PP9 E;  4Y99 C;  2MKV A;  1LTJ A;  1SQP E;  1FDM A;  3TF5 A;  1U7J A;  4U0B A;  2W83 C;  2QA4 P;  1CZQ A;  5AW2 B;  5BU5 A;  1G2C B;  3CWB E;  1DD3 A;  2PEK A;  3M9Q A;  1T3U A;  3AE1 C;  3GLM A;  2FY8 A;  2WPR A;  4YTP C;  3S1K A;  1SQV D;  1KQL A;  2LL8 A;  3I56 P;  1KYO D;  1L4A B;  2KSJ A;  1H0T A;  2KW2 A;  2IZ1 A;  1YHQ P;  1PPJ G;  3LID A;  3LRY A;  1JTH A;  2Q1K A;  1OXZ A;  3U1A A;  4QNB A;  1ZR4 A;  3HD7 B;  2E76 B;  4H2Y C;  5KLV J;  1LT9 B;  4NEO A;  4AYC A;  1LP1 A;  2YMK A;  4EDF A;  1T6A A;  2BAS A;  1Y47 A;  3H1H G;  4IL6 E;  3DPH A;  5CBO A;  1L0L K;  2J58 A;  1T8K A;  5BS2 A;  1PP9 J;  2R5B A;  2QRX A;  3L74 J;  3O6Q B;  1SQP J;  2PEI A;  2Z45 A;  3VYI A;  1K05 A;  4TT3 H;  1EXI A;  2VLN A;  4JPZ B;  3CWB J;  3N4X A;  3G1G A;  2QNW A;  2B87 A;  2YKQ A;  2K94 A;  2QG4 A;  1NTM J;  4QKO A;  4I7Z C;  1NKZ B;  1MFT A;  2FYU G;  3NXS A;  3AED C;  2OAR A;  1GW4 A;  1NTZ G;  1ZOY C;  4BRY A;  1FZG A;  2KG9 A;  1URQ B;  4XE5 B;  1YJN P;  4IL6 X;  1IFN A;  2LR2 A;  4GOE A;  2CNR A;  1OFC X;  4H13 D;  5F2K A;  2MVV A;  1NTZ K;  3TGU D;  2P10 A;  2ZT9 B;  3GF3 A;  2ZXX A;  1ZP0 C;  4ZNC A;  2QJK C;  1KYO E;  2AXT H;  1FZA A;  2YXR B;  1S72 P;  2W8Z A;  2FAD A;  4GOD A;  2A06 G;  3CC7 P;  2PEJ A;  4EI2 A;  2WPS A;  2KGD A;  1PL5 A;  4UB8 H;  4U3F E;  1QX8 A;  2Z5H A;  2GZE A;  1J1D C;  3CX5 I;  1NTK K;  3AEF C;  2V7Q J;  4TLF A;  2I8D A;  1EDK A;  1NQ4 A;  3CXH H;  2KK7 A;  2R3C A;  5DJU B;  1PPJ D;  1CEI A;  3GW6 A;  4H13 C;  2K0Y A;  2E75 B;  4JQ0 D;  2YIU C;  3L73 G;  2XNX A;  3H1K E;  3RG2 A;  2FBW C;  1JY2 O;  2PEO A;  3BCC D;  5B5E H;  2N98 A;  2LTE A;  3H1H D;  2ZYA A;  1NGM B;  1X22 A;  3A0H H;  2KZJ A;  4OWF A;  1DEB A;  2KG8 A;  3V4Q A;  2FKW B;  5F2O A;  5APS A;  4PD4 H;  1FJP A;  3L70 G;  3VMZ A;  4DOJ A;  1SQV J;  1KD1 Q;  2GA1 A;  1CSB A;  2W27 A;  2AXT E;  3H1J D;  3GKL C;  2KZI A;  2ROQ A;  3IAO A;  5HGN A;  2XZ0 D;  4KJM A;  3TGU E;  1HF9 A;  2MF4 A;  3K5B A;  2KR5 A;  2FYU D;  1X8Y A;  1OIP A;  3U59 A;  2Y0C A;  1ZR2 A;  2KB7 P;  2YKP A;  5APY A;  3RL0 g;  2M8R A;  1Q86 Q;  2E74 C;  1IZN B;  4XFX A;  3BRV B;  2H43 A;  3GHG C;  3CCM P;  4C7R A;  2WMM A;  3B71 A;  5E79 H;  1N73 A;  2QEX P;  3GHG A;  1F80 D;  1MZ8 A;  2X2B A;  4BPH A;  1RE4 C;  4HKZ H;  1GXH A;  2KG6 A;  5TJH A;  3H1K J;  1VQK P;  5APX A;  3A3Y B;  1MUU A;  5KLI C;  2AEM A;  2LIU A;  1UJZ A;  2E1M A;  3BAT A;  5B5E E;  2K0D X;  3SWY A;  1OZH A;  4BWN A;  3MIW A;  2CQ8 A;  3A0H E;  2IBZ I;  3H4E A;  2VLO A;  5BVZ A;  1RNI A;  3NTN A;  2OYO A;  3NY7 B;  2R3S A;  1HUC A;  5GTI H;  2M5R A;  1CI6 A;  3PHL A;  2PY8 A;  3Q3D A;  4R4L A;  2M8L A;  4H0L B;  3B4Q A;  1S4X A;  3BCC E;  2IBZ G;  5EFW B;  5CJ4 A;  3CX5 D;  1K9M Q;  2JYL A;  3LIE A;  1A02 F;  1RHZ B;  1NH4 A;  3KYQ A;  4N78 E;  3TGU J;  1IMP A;  2FXM A;  2M5A A;  5AVR B;  2I1K A;  1OMI A;  4IOI H;  2KWL A;  4IFD K;  5AW3 B;  1JY3 P;  3RK3 E;  2P67 A;  1G1I A;  2N50 A;  1IFM A;  5KLV G;  3H1J E;  1RE3 A;  2HOD B;  2JGP A;  1JJ2 O;  2DNW A;  3L70 D;  2KXP B;  3SWK A;  5E79 E;  4W80 A;  2QE7 H;  1VQO P;  1LTB C;  1PP9 G;  2OTK E;  3L74 G;  1OVU A;  1W5C E;  1SQP G;  1FE6 A;  1NU1 K;  3B5I A;  1YJW P;  3M9B A;  1AUM A;  3CWB G;  3VRL C;  2N5I A;  2LKM A;  4PH0 A;  3AE3 C;  1FR2 A;  1S5L H;  1AVY A;  1NTM G;  3SFD C;  5AVU B;  1PEO A;  1RF1 C;  2L5G B;  4PJ0 H;  3PTZ A;  1RF1 A;  3HE5 B;  1NTM K;  2HFE D;  3BCC J;  2Y9Y A;  3Q20 A;  1HH0 A;  1X79 B;  3CE7 A;  2N1T D;  3H32 A;  2WSE H;  2KOS A;  3BAS A;  4XA4 A;  4U0F A;  1FC2 C;  2CK3 H;  2Q9I A;  1M74 A;  1NAY A;  2KS1 A;  3B5N B;  5CJ0 A;  1L0N D;  1KQG B;  1KIL D;  1KN7 A;  1VQN P;  2YMY A;  4LC1 A;  1NTK E;  3NFQ A;  3H1J J;  1K8A Q;  1EC5 A;  1IFD A;  2O01 H;  2ERH A;  2KNC A;  4UB6 H;  4L75 A;  1LTG C;  1PZQ A;  3TK1 A;  3LW5 H;  1LTI C;  1A02 J;  1MKM A;  1RH5 B;  2LML A;  4DT0 A;  3CCQ P;  2O3J A;  4M0I A;  2HPC B;  3WBH A;  2Y0D A;  2W6J H;  3HE4 B;  5H2F H;  1M8O B;  2N1T C;  3AE7 C;  2N1T A;  1KB9 H;  5KLV D;  4PJ0 E;  2L6E A;  3U1C A;  2BUO A;  2IFN A;  1GPJ A;  2J5U A;  1KIL C;  3M06 A;  3MHV A;  2OYI B;  3H1I D;  3T97 B;  1LTA C;  1KLP A;  1K73 Q;  1KIL A;  3HYB A;  3CPW O;  4C7N B;  4NPE A;  3DS2 A;  1KYO I;  1PP9 D;  1DD4 A;  2BQ1 E;  3MTU E;  2WT7 B;  2GZG A;  3GJN A;  2PAJ A;  1SQV G;  4D6T E;  3M91 A;  3AEA C;  1M1J B;  1OW7 A;  3CCJ P;  2W90 A;  3CWB D;  3S4R A;  2E43 A;  1SQV K;  2MVU A;  1VQM P;  3RL0 B;  1EZV E;  1S5L X;  5AW8 B;  3PJS K;  1PGQ A;  2YO3 A;  1JY3 N;  4UB6 E;  1FZC C;  1DH3 A;  1USD A;  2R32 A;  5APU A;  1AFO A;  1FZC A;  4WB4 A;  3C8V A;  2KP8 A;  1PFI A;  3AE2 C;  5HGL A;  1SQX K;  1HQB A;  3SWF A;  2Y9Z A;  1GK6 A;  1SQQ E;  1YBK A;  2A45 I;  1LNQ A;  2WPV B;  1JNM A;  1DIP A;  1Q90 D;  3H1K G;  2ZJS E;  2A45 G;  2LF4 A;  3DS5 A;  1LTJ B;  5CZD B;  2DW3 A;  5L8R J;  3G71 P;  1LWU C;  1ZLL A;  1LTT C;  2OQQ A;  1LWU A;  3RBZ A;  1J1E B;  4D6T J;  3HUS A;  5APT A;  1EDJ A;  3CCS P;  2CPS A;  3A2A A;  3G4S P;  2WZ7 A;  5CMZ A;  5CCG D;  1G1J A;  1GL2 D;  2MJZ A;  2FYN C;  2W6A A;  1VHN A;  3TGU G;  1FZB A;  2OTJ P;  4Z1M H;  3BRT B;  2KOP A;  3P32 A;  1PIX A;  1L0N J;  1S1C X;  1JTH B;  2HYN A;  2FVA A;  1N7L A;  3TNU B;  1SQB E;  1NU1 E;  4NPF X;  2YO2 A;  2WSC H;  2KLU A;  1SQQ J;  5KAI H;  2C9L Y;  3DS0 A;  4WY4 B;  2IFM A;  1JMB A;  1LJ2 A;  1L4A D;  3E1I A;  5M1B A;  2WSF H;  2IX7 C;  1H89 A;  1IUQ A;  1AJY A;  2SPZ A;  4U3F D;  5CCG C;  4COC A;  1GL2 C;  3A7O A;  2H88 C;  1M6N A;  3HD7 D;  1GL2 A;  1NJI Q;  2E76 D;  2B87 B;  2R44 A;  2JWA A;  1AA0 A;  3IN6 A;  3OJA B;  2I1J A;  5GTH H;  1Z56 A;  3G28 A;  3BCC G;  2VSQ A;  2KIK A;  1IFP A;  3G3Z A;  4L73 A;  4I7Z B;  3H1I J;  2DGY A;  2O1J A;  2AXC A;  1PGP A;  3GF7 A;  1UIX A;  4BRY B;  4CPG A;  2AVA A;  1NO4 A;  1Q82 Q;  1RQV A;  3H1K D;  2WQY C;  5KTB A;  1AV1 A;  2PFX A;  3HTK A;  5AVV B;  1L4A C;  1E5W A;  3EJE A;  3KXD A;  3I55 P;  1L4A A;  1BAJ A;  1ZV8 A;  3OW2 O;  3H1J G;  1KZU B;  1SQB J;  5F2N A;  3FGA D;  3L71 E;  2NO8 A;  1YTZ T;  3PH0 A;  3HD7 C;  3I5C A;  1U7M A;  2E76 C;  5APW A;  2N9Y B;  3HD7 A;  2FYU K;  1LT9 C;  2M0B A;  2KYV A;  2LXC B;  4C46 A;  3OA7 A;  3A5T A;  3QH9 A;  3ITK A;  5C39 A;  1N7S B;  3VMA A;  3E7K A;  2JU1 A;  2N6Y A;  2VRS A;  3G21 A;  1T2K D;  1YIJ P;  1PEQ A;  1HGV A;  4H44 B;  2K1A A;  3CXH D;  4EYY Q;  1D7M A;  3C9I A;  2K0X A;  5KP7 B;  2L91 A;  1VKU A;  5KAF H;  1JY2 P;  2FFD C;  2GM4 A;  2XND H;  3CC4 P;  3ZDM A;  1YJ9 P;  2FFD A;  2B9B A;  1SFC D;  1M7L A;  2AEF A;  3AE5 C;  3U43 A;  1IJD B;  1N2D C;  2GDW A;  2ONT A;  1BCC E;  3G0V A;  2WWW A;  3N7N A;  4AQR D;  2E75 D;  1T8Z A; 
#chains in the Genus database with same CATH homology
 3CCQ P;  4M0I A;  2DGY A;  1VQ4 P;  1KD1 Q;  3CCV P;  3WBH A;  4XFZ A;  1A43 A;  1Q82 Q;  5HGO A;  5JPA A;  3G71 P;  1M1K Q;  3H0D A;  1RO0 A;  1JJ2 O;  2OAR A;  2P9X A;  1EOQ A;  4PH1 A;  1RO2 A;  3DTJ A;  1K30 A;  1YIT P;  4U0B A;  4COP A;  1YJN P;  2EIA A;  5HGN A;  2QA4 P;  3DS1 A;  3I55 P;  2Z44 A;  4GR2 A;  5F2K A;  3CCS P;  1BAJ A;  2PEK A;  3CME P;  3M1M A;  3OW2 O;  2L6E A;  5HGM A;  1VQO P;  2BUO A;  1VQ8 P;  3E2D A;  4IPY A;  1VQP P;  3CD6 P;  1VQ6 P;  3G4S P;  4GR6 A;  5F2N A;  2M8P A;  4XRQ A;  3DS4 A;  3B5I A;  1PEU A;  1Q81 Q;  2Z46 A;  4U0A A;  1YJW P;  1M90 Q;  1Q86 Q;  1K73 Q;  3HYB A;  3CPW O;  1AUM A;  1KC8 Q;  3I56 P;  2XT1 A;  1QVF O;  1S72 P;  4XFX A;  3VRL C;  1VQ5 P;  3DS2 A;  3CC2 P;  3CCE P;  1A8O A;  3MGE A;  2OTJ P;  4PH0 A;  1Q7Y Q;  2BQ1 E;  2JO0 A;  3CCM P;  3CC7 P;  4XFY A;  2EFJ A;  2PEJ A;  1VQL P;  1VQ7 P;  2QEX P;  1PEO A;  2PEQ A;  3CCJ P;  3RG6 C;  2KOD A;  3HZQ A;  1YHQ P;  1QRJ A;  3G6E P;  3CMA P;  1VQK P;  3LRY A;  2JYG A;  1VQM P;  3Q20 A;  4U0E A;  4WYM A;  3NTE A;  2XXM A;  2E1M A;  3DS0 A;  3H47 A;  5I4T G;  4QNB A;  4U0C A;  4XRO A;  1ZMB A;  2OTL P;  3G21 A;  1YIJ P;  1D1D A;  1PEQ A;  1YI2 P;  3H4E A;  4U0F A;  1RNI A;  1M74 A;  2CWO A;  1N8R Q;  5BS1 A;  1E6J P;  2BHV A;  2XV6 A;  2PY8 A;  5HGL A;  1QVG O;  3CCL P;  1IUQ A;  2M8L A;  1M6E X;  3DPH A;  3CCR P;  1VQN P;  4U0D A;  5DCK A;  3CC4 P;  3G29 A;  5BS2 A;  2PEO A;  4COC A;  3CXC O;  1K8A Q;  1YJ9 P;  3P05 A;  1M6N A;  1KQS O;  1K9M Q;  2EG5 A;  3CCU P;  2JYL A;  2PEI A;  2Z45 A;  1VQ9 P;  2PEN A;  1NJI Q;  3G26 A;  1W2B O;  2ONT A;  3G1G A;  3G1I A;  3G28 A;  5F2O A;  3G0V A;  2M8N A;  2LF4 A;  1PEM A;  3DS3 A;  1EIA A;  3DS5 A;  2PEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...