1KQSO

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1kqsO02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1kqsO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1kqsO03
3I55P 1K8AQ 2QA4P 1Q7YQ 3CCSP 2QEXP 3OW2O 1YITP 1S72P 1KQSO 1VQKP 1VQMP 1VQNP 1VQ9P 1YJNP 3CC7P 1W2BO 3CD6P 1YJWP 1Q86Q 3CCQP 1NJIQ 3G71P 1JJ2O 1YHQP 2OTLP 3CC2P 3CMAP 3CCLP 1YJ9P 3G6EP 1K73Q 1Q81Q 1YI2P 1VQ5P 3CCUP 2OTJP 1QVGO 1N8RQ 3CCJP 1Q82Q 1QVFO 3CXCO 1K9MQ 3CCRP 1M1KQ 1VQ4P 1VQLP 3CC4P 1M90Q 1VQ6P 3CMEP 3CPWO 1VQPP 3I56P 3CCEP 3G4SP 1VQ7P 3CCVP 1KD1Q 1KC8Q 1VQ8P 3CCMP 1YIJP 1VQOP
chains in the Genus database with same CATH superfamily
2LF4A 2WMMA 3KQGA 1VQNP 3VN0A 2YO3A 1BGYD 1H0TB 3V5BA 2C9LY 3WMM0 1OMIA 5BU8B 1P84H 1QL2A 2KNCB 2K9YA 3L70D 4EDFA 1HF9A 3SFDC 5AVSB 2R44A 4KHXA 3B5NC 2W83C 1GK6A 3CCSP 5CCGD 2P9XA 1EIAA 1KILD 3U59A 4QKOA 1S5LX 3V2PA 3P8MC 3D70A 2ZAEB 2KORA 2BHVA 1JO5A 4L76A 3V2RA 2BEQD 2JYLA 1PV3A 4PD4E 2JJLA 1BAJA 3WBHA 5KTBA 4IOIH 2YXQB 2QJYC 3M91A 1LT9B 3EJDA 3LIDA 2KG6A 3G1GA 4WBAA 1IK7A 3VTPC 3VMXA 4GODA 4DT0A 1QVFO 1AQ5A 5AVYB 2OYHB 3DS5A 4GR2A 3MIWA 3L73J 4TT3H 1KD1Q 2E76D 3CL3D 1YTZT 2V7QH 2FXMA 1LTJA 2K0XA 1IO4A 5CCHD 3B5IA 2BCCJ 1RE3A 1USDA 1KILB 3CI9A 3B5NB 2LXCB 1JMMA 2KI7B 4JYBA 4ZKUA 2GZEA 3T97A 2AVAA 2YKQA 1DH3A 2WTYA 1QGKB 2FFDB 1LTGC 3KHUA 3CCLP 1L0LJ 3H1IG 1LGHB 5APYA 1HY8A 3PP5A 2Z44A 1Y47A 4ZNCA 1GW4A 1URQD 2O01J 1K04A 1VQ6P 2E5TA 2IPPA 1N73C 3H1KE 1L4AC 1VQOP 2B89A 4K3AA 3L70E 2QA4P 5KP6B 3HD7A 4I7ZB 3HE4B 3L74E 1SQQG 1SLQA 2Y0CA 2KS1B 1OFCX 2A45G 1NU1D 2FYNC 5AW0B 3H1LE 2Q1KA 3LRYA 3BRTB 3SSUA 1LTSC 3QWOC 4XFYA 3NFQA 2A45I 1S3JA 1MKMA 2GM4A 2CPSA 1SQQE 1R5LA 1MUUA 1PGJA 1LT9C 2FYUJ 4GDOA 3WU2H 3L70G 2FXOA 4H44B 1RH5B 3CWBD 4DZOA 4U3FG 1H0TA 1PEOA 3G28A 1URQC 4LLHA 1L0IA 1SQVD 2XZ0D 2GA1A 3WUVA 2KOQA 3H1IJ 3DTJA 1KQGB 1DV5A 2WZ7A 4OWFA 2YNYA 1USEA 5GTIE 1DX7A 3BCCD 1SQPD 1M8OB 2DNWA 1NTZG 4H0LB 1E79H 3M9BA 1NTME 1FZAA 2Y0EA 1IUQA 3BRVB 2HG5D 1PPJE 1NTZJ 2XT1A 1KFNA 2WQYC 5EJDA 2IBZI 2ZYGA 1UJZA 3CCVP 1IFNA 1H88A 2IZ0A 1N86A 1N7LA 4JPZB 1N7SA 1PZQA 5KLVE 2SPZA 3UIAA 2XXMA 4U0BA 4IFDK 4IL6X 1GU4A 3VMZA 1GMJA 1CZQA 4L75A 1GL2A 1MV8A 3L74J 3RL0C 1P84D 5GTHH 1EZVD 3L75G 3MP7B 2DGYA 3HZQA 2L91A 4MRTC 1SQXJ 2IYOA 3GHGA 1DD3A 1LP1A 2IFMA 1S9KE 2KB7P 1K9MQ 2ZJSE 4Y99C 1VF5B 5HGLA 2QJYB 2QJPB 5AVTB 2K0DX 1FDIA 3ZDMA 1BCCE 2HPCB 1T8KA 1OW8A 3VMYA 1M6EX 2N1TC 3IN6A 2H7HA 1WRGA 4UHPB 2Y9YA 3NXSA 2CGQA 5DJUB 2BEZF 3G26A 2JWAA 1YITP 2M3EA 5KP7B 1GXHA 3TNUA 2PRRA 3AEFC 1X3OA 3GW6A 3CX5D 2B9BA 3CMAP 4I2LC 1FZGA 1JMBA 2ONTA 1ACPA 1ZN5A 3V2NA 2GDXA 2JP3A 3M9QA 5CMZA 5KLVG 1DNYA 2KSJA 5CJ4A 3AE8C 2O3JA 3G1IA 2IBZD 3L72D 3HUSB 1SQPK 2WSFH 4IFFA 2FFDC 2YIUB 2YMKA 5CZDB 4N78D 2FYNB 2VLOA 3H1IE 1OW7A 3HD7D 4RJTA 1KZUB 2LOLA 4BRYA 1AF8A 3G29A 1QX8A 1SQXE 1NTZK 4WB4A 1X22A 2FVAA 3HYBA 5AVVB 1G2CA 1OIPA 3CC4P 2VLPA 2RN0A 3M9HA 4QMAA 2W8ZA 4XA4A 3RGUA 4YXDC 3S9OA 2N6ZA 2VSQA 3P32A 5KJ7A 1VPCA 1IFIA 1BSNA 5KLIB 1R5SA 2K37A 4Y28J 4HH2A 3H1KJ 3GG2A 1JTHA 3L73E 1VQ8P 1VQKP 2QE7H 4H2XC 3B5ND 2QRXA 3Q5RA 3FWLA 1NQ4A 1WT6A 1CI6B 2E5YA 1K05A 1A02J 4D6TJ 2FVEA 1MFTA 3K5BA 1WMKA 1G1IA 2K94A 4EYYQ 2RMZA 4PD4D 3I56P 4HYTB 1L2PA 1SQQJ 1VQ7P 3IAOA 2JEEA 1FZFA 4PV1B 2XV5A 1LTJC 3VOPA 3VP8A 2WT7B 1BSHA 3O6QB 1E0HA 1AQTA 3GKLC 4C7NB 4B86A 1SQBJ 1KLPA 1PP9D 2Q6QA 1FZCA 1M1KQ 1SQBK 2E76C 3AE7C 2PP6A 1PEMA 3H25A 1ZMBA 1SQPE 1EDLA 4L74A 2E43A 1LWUB 3MGEA 2E75D 2WSFJ 3WU2E 1PEUA 2R3CA 4H2YC 3KZIH 2KOOA 4EOTA 5B66H 4UB8H 3EQ2A 1KQSO 1SQXK 5KLVJ 3C1LA 1X8YA 1SQPG 2Y0DA 1NO4A 2CWOA 2OTJP 1URQB 1SQVE 1CEIA 1PP9E 2HODB 3AE6C 3R2PA 4O9BA 2LXBA 5HGOA 3P8CE 2EG5A 1YIJP 5CCGA 1L0ND 1J1DC 2JB0A 3L71E 1Z6MA 1HQBA 1KILC 2Q3IA 2XNXA 3MUDC 3DS2A 3SWKA 2XNDH 3Q2YA 1NTKE 1BGYG 1NU1E 3BASA 3M06A 4U3FE 1RO0A 1VQPP 2ZYDA 2WSCH 1FZEA 3IF4A 5CCGC 1S4XA 1YBKA 3RK3C 1M1JA 5KAFE 1BCCJ 1JUNA 3D71A 4WY4A 2L22A 1MZ9A 1EZVG 1YJ9P 2PEKA 1VHNA 4JYCA 5AW8B 2YXRB 1IK9A 2H89C 1RE4C 2D2CC 3NY7B 4OGQC 2M8PA 1AFOA 5CCHA 1BE3D 1JY3N 3MTUE 3NMDA 1NTMD 2Z46A 2FQ2A 5KAIH 1JOCA 3SFEC 3D6ZA 2C0WA 2MR8A 3CX5E 1GL2B 1ZRTD 2P10A 1EZVI 1M90Q 1FBMA 5KP8B 3CWBG 4DCKA 4GOFA 5APTA 4WY4B 2K3RA 1ZR4A 2POHA 2FAEA 3CCQP 1IFJA 2AFEA 1L4AA 2JU1A 1J2JB 5AVZB 2ROQA 3A5TA 2LKMA 4KT0J 2GZIA 2N98A 2KGDA 5APSA 3QH9A 2KG8A 4CPGA 1KYOI 4MN4C 2ZXEB 2O1KA 1GD2E 2GZGA 1SQBG 2WPTA 4U0FA 2Q7CA 3LMOA 2KGCA 4U0CA 1NJIQ 1R8EA 1E6JP 1FJKA 2PEJA 3TDKA 1XTGB 4N3YB 1EXJA 1KB9I 3RK3B 4U3FD 3CXHE 2FHSC 2KYVA 2HODA 3S4RA 1LTTC 2KSEA 2L6EA 1FOSF 2ZVNB 2VRSA 2ZVOB 2EHTA 3L36A 2W27A 2ITAA 1GU5A 3R4YA 5AVUB 3L70J 2FADA 1PL5A 3HTKB 2PEIA 1PEQA 2M8NA 1JCDA 1JY3P 4I1LA 1LWUA 2QEXP 2O01H 2PAJA 3TNUB 5EFWB 3L37A 2HFED 4GOEA 1FJPA 2Q3EA 1UNKA 5CHXA 2OYIC 3CXCO 2AEJA 3AEGC 4HB1A 3CLQA 4ASVA 3FXDA 2QSIA 1KC8Q 2JQ4A 1NHLA 2Z4EA 5BVZA 1L0LE 1LTAC 4YPCA 2LKIA 2R3SA 1KMIZ 2PENA 3GZMA 1KORA 3L73D 3FWNA 2NPSD 2KP8A 4EIJA 1JY2O 4DJGA 5APVA 1KILA 3HUSC 4WWIA 3MZWB 3H47A 1RF1A 2JAZA 2M3BA 1Q86Q 1FE6A 1L0NK 1S1CX 1N2DC 1XTCC 2BCCD 1EDJA 2C0XA 2L9FA 2KS1A 1EQ7A 3HTKA 4BPFA 5DJTB 3KZIE 2E74D 5F2NA 1Q82Q 2CQ8A 3G3ZA 2G3AA 1Y9BA 3MD0A 3HD7B 3JC22 3W67A 1GL2C 2KUBA 1DIPA 1SVFA 3CXHD 1YHQP 3HD7C 4EI2A 1L0LD 1NOHA 3A0BE 1H89A 3PHLA 2P67A 3IFMA 1ZMEC 2RH0A 1BDCA 2JDIH 4IL6H 2MVUA 3PH0A 2NPSC 2L0QA 4AQRD 1M1JB 4JBZA 4KJMA 1P84E 5L8RJ 3TF5A 4XE5B 2GUVA 1AJYA 1L0LK 3HRNA 1JM0A 2GDYA 3RG6C 1LT1A 3TGUE 2IZ1A 1NU1J 2CG5B 2N1TD 2AFDA 1NTKJ 5TJHA 1LTIC 1BXIA 1T6AA 2P7JA 3GZLA 1L4AB 3OW2O 2FYUD 2PEOA 1FZCC 2JKVA 3CWBJ 5KLVK 1N73A 1URQA 3BCCG 3SWFA 2R32A 1U57A 1AVOA 4H13D 1SQVJ 3EFGA 1JEKA 1BCCG 5GTHE 1GW3A 1OVRA 2ZT9C 1OR5A 1EMVA 1SQPJ 1K8AQ 5APUA 2IYPA 3AE3C 2Q5UA 1YJNP 1EDIA 5M1BA 1PPJD 3AE1C 4WVZA 1S9KD 2JGPA 4BPHA 5B66E 3AE9C 4IPYA 3A0HE 1AUMA 5KAFH 2I1KA 4OH8B 1F80D 2OYOA 4U7JA 2FYUE 3H1HJ 1X9VA 5CJ0A 2N5HA 3H1JD 7CEIA 2OTLP 4NPDA 4RKUJ 1LWUC 3F89A 2PNGA 1ZNVA 3FGAD 3AE5C 1IJDB 2WWWA 1VF5D 1KQFB 3OAKA 3L75D 4GT1A 3BATA 3L4FA 2V7QJ 3L74D 2J58A 5AW6B 3GHGB 1UIIA 3TK1A 1AA0A 4PJ0H 1LP1B 1YJWP 2A06E 2M5RA 2VLQA 2WPVB 1GXGA 4UB8E 2IBZG 3EJEA 1RHZB 1RY3A 1G1JA 1KB9H 2PGDA 2OTKE 3Q1MA 1IMPA 4R4MA 3H1HG 1RE4A 5AW3B 3RG2A 5HGMA 2CK3H 3V4WA 5HGNA 4U0EA 3BCCE 3N4XA 2GZFA 3LW5J 1JY3O 4BXLA 1DEBA 1K30A 1KN7A 1KILE 2E75B 3ITKA 1D1DA 1BE3E 4U0AA 3CC7P 5CBNA 3B71A 5E79H 4OGQB 3H1LJ 1YTZI 2IFNA 1FU1A 2WSCJ 1FZCB 1NYHA 1M6NA 2EHSA 2E76B 4C7NA 4Z1MH 1JB0J 1KB9D 2KG9A 2NRGA 3C8VA 1NTKG 2WT7A 5AVXB 1CSBA 5B5EH 3KXDA 1T8ZA 2C9NY 2B88A 3T97B 5BU5A 4XROA 1PGPA 2NPSA 1IFMA 3FX0A 1EZVE 4RESB 4DG9A 1JY2P 2LIWA 3MUDA 1OX3A 2NZ2A 2K9JB 4YTPC 5AW2B 1VQ9P 1BDDA 1SP4A 3PLNA 4A7PA 2MKVA 3AEDC 2FY8A 3H6PA 1JJ2O 1M1JC 3RK3E 3Q3DA 2NO8A 1OVVA 2YIUC 2A06D 3L71J 4XFZA 1VQ4P 2ZT9B 1FOSE 5AW9B 4PD4H 2QVAA 2WSEJ 4I6MC 2WSSH 1GPJA 1VKUA 1RF1C 2M5AA 4PH1A 3O6QA 2P2UA 3GJNA 3GF7A 5BS2A 1BE3G 2EIAA 3U1AA 3H1KD 3V4QA 1G2CB 2HLOA 1HUCA 2QJKB 2P1JA 2O1JA 2N1TB 5APQA 4COPA 3B5NA 3C9IA 1CI6A 3TGUJ 1J1DB 1N8RQ 2OQQA 3KDPB 2KXPB 2KNCA 1LTJB 1NU1K 1ZLLA 2KR5A 3HE4A 3FXEA 3L71G 2O01N 1BGYE 3NTEA 4QNBA 2FXPA 2KK7A 3VRLC 4AYCA 2AXTH 2OYHA 5KJ7C 3HUSA 2M5AB 1YYCA 3P05A 1BGYJ 1LT9A 2J5UA 1N73B 1ZOYC 1SQBD 3P8CD 3CCJP 2LIUA 3GF3A 1L0NG 2FQ0A 4GIFA 1D7MA 5AW1B 3WUTA 4L73A 1GTWA 4PV1C 1Q2NA 2I8DA 2QNWA 5HVCA 2YO2A 2E74B 4Y99B 2AXTE 5HV8A 1YI2P 3CXHH 3W68A 4LGDE 1VL2A 5CBOA 1RE3C 2JYGA 2MJZA 1E5WA 2E75C 2NPSB 4PD4I 2YKPA 3H32A 1UIXA 1S72P 4HKGA 4PH0A 3LIEA 4D6TG 1W2BO 1S5LE 1LNQA 3EWKA 2MR7A 3L72E 2BQ1E 1QVGO 1L0HA 4XFXA 1EC5A 1PPJG 1PGOA 5H2FH 2FVFA 1HWTC 3G4SP 4H0LC 2PY8A 1NTMG 3A2AA 2BCCG 2UWJE 1FS0E 1L0NJ 1NTZE 1YQ3C 2AEFA 3JCUH 1T2KC 4M3LA 2E1MA 1IFPA 4H44C 2PEMA 4UB6H 4WYMA 1DEEG 1RQVA 4NEOA 4H13B 5EW5E 1SQXG 2FACA 1BCCD 3H1JE 2QIWA 3RL0g 3HE5A 2WVRA 2QJKC 4LC1A 1NAYA 4TLFA 1AV1A 3JCUE 2GDWA 2WPRA 5KJ7D 1KYOD 3DS3A 4H44D 1KYOH 3I55P 2JBGA 3A7OA 1X79B 4IFMA 2K0YA 1SS1A 1AYIA 3G0VA 3N7NA 1NTMJ 2KZJA 3H0DA 1U7MA 1ZXGA 5F2OA 1K73Q 2N6YA 1HBWA 2IX7C 1QRJA 1S5LH 3H1JG 4H0LD 3CE7A 2AF8A 2JO1A 1J1EC 2FYUG 5BS1A 3OJAB 1NU1G 1NWQA 1PFIA 1VQMP 1VDFA 2LPKA 4N78E 5KAIE 3G71P 2KLVA 3E1IA 1SFCB 2KIKA 4JF7A 3H1ID 2KOGA 3BCCJ 3RK2C 2W6BA 1GL2D 1SQVG 2M0BA 1HJBA 1NTZD 1VF5C 4COCA 3RL0B 5B5EE 3G6EP 2FBWC 1KV4A 1OVUA 2W6JH 1RNIA 1L0LG 3CCEP 3GHGC 1H8AA 1ZR2A 4U3FJ 2V4HA 3Q5PA 1HVVA 2PFXA 1DD4A 5F2KA 4C46A 4BPGA 3CC2P 5E79E 3L74G 1MZ8A 1Y8AA 2GYKA 2K92A 2FYZA 2P58A 3WUUA 2DW3A 2KODA 3II6A 3PJSK 4C7RA 5GTIH 2Z5IA 2BCCE 1NTMK 2WPQA 1PIXA 4AUWA 4R0MA 3RK3D 2KOPA 4H13C 1L0NE 1EOQA 1SQXD 1CW5A 2B87B 2LL8A 1NTKK 3CCUP 1IMQA 2JR8A 2JWDA 2K88A 3CD6P 2M8RA 1A8OA 3A0HH 2YMYA 1KFMA 2D2CB 4BWNA 1FZBA 3TGUG 4OVNF 1T2KD 3E7KA 3L73G 3H4EA 3B8EB 3U1CA 1GK4A 2KGAA 4H2WC 2FFDA 1NKZB 4PJ0E 1EXIA 4U0DA 4NPFX 3DPHA 5H2FE 2L4BA 1J1EB 1KQLA 2A45H 3CX5I 2CNRA 3SWYA 3AEBC 3G9RA 1RF1B 2OYIA 3E2DA 3I5CA 4GR6A 1ZP0C 2L5GB 3B4QA 5JPAA 3AE2C 2LMLA 2XZ1C 4PXHB 4ZKPA 3AE4C 2KW2A 2N5IA 2FYUK 1QL1A 5AVQB 4XFJA 3L72J 3RK2D 1QLED 3BVHA 2QG4A 1SFCD 1HTLC 1HGVA 1FDMA 1X0TA 3Q5SA 5CCHC 1Q81Q 3RBZA 2JO0A 2LTEA 3MGNA 4WY4D 1RO2A 3EFFK 2XDJA 2R5DA 2Y9ZA 3V2QA 4IL6E 1NH4A 3S1KA 2ZT9D 4W80A 2AEMA 5KKZB 1GDTA 2Q9IA 5AVWB 3AECC 2GZJA 3DS4A 2X2BA 3U43A 1JNMA 2MVVA 4D6TE 2Z5HA 1NTKD 3KYQA 4M0IA 1T3UA 4R4LA 1A43A 3USSA 2YKOA 3PTZA 3H1LG 2K5XA 2PEQA 3D6YA 4DOJA 1JCCA 1Q90D 5KLIC 2KGEA 3IR9A 2G8YA 2E42A 2D2CD 1GZLA 1NVOA 2GUSA 2B87A 1KYOE 3H32B 2K1AA 2MD9A 2OYIB 3V6IA 2KWLA 1S2EA 2N1TA 1ZRTE 1FAVA 4PWVB 1M7LA 4D6TD 4W7YA 4NPEA 3VYIA 1M74A 3EJBA 1IZNB 3H1HD 1SQQD 1JY2N 5APXA 3RBXA 4UB6E 2XV6A 1N7SD 2BASA 1EDKA 3HE5B 1OZHA 1W5CE 3H1JJ 3O8ZA 2IDBA 2WPSA 1IFDA 3NTNA 1M56D 3L75E 4ASWA 1PP9J 1NAFA 2QM8A 3L75J 3VMAA 3TSIA 2A06G 2OGUA 5AVRB 3TYYA 2R5BA 2J59M 3M1MA 1MFZA 1OXZA 2H43A 1QEXA 1PGQA 2EFJA 3M0DC 2ZFCA 1VQ5P 2E74C 2W90A 3F5HA 5AW7B 2FQ1A 3CCRP 4RO0A 3E1RA 4BRYB 3CMEP 4OGQD 3CCMP 3H1HE 2CPBA 3A3YB 5K5GB 2VLNA 5I4TG 5KLVD 5APWA 4PV1D 1HGZA 3PRJA 1P84I 3M0DA 5KKZC 3GLMA 3RK2B 1NKNA 3CXHI 2H88C 3AEAC 2ZYAA 4F37A 2K2QA 1N7SC 1PP9G 1OW6A 3LW5H 3GMAA 2LR2A 2N9YB 2RKLA 4JQ0D 5DCKA 1FDOA 3A0BH 3P7KA 3H1LD 2BUOA 2HYNA 5C39A 1HH0A 4W7ZA 1RF0C 4YXWH 1RQUA 2OYHC 1U7JA 1T3JA 2MF4A 1SFCA 5AW4B 4CA3A 2N50A 2QM7A 2K93A 2HPCA 3H1KG 4XRQA 2H8PD 1SQVK 1L4AD 1ZW0A 1FR2A 1FC2C 1SQBE 1M57D 1RF0A 2XKMA 2FKWB 4ZMDA 2W6AA 4K35A 1IC2A 3OA7A 1ZV8A 1BE3J 1LJ2A 4WY4C 2WITA 4HKZH 3MHVA 3B4SA 1Z56A 3RL0D 2MY5A 1OWAA 2N9BA 1SFCC 3Q20A 2JU2A 4IZ6A 3L35A 1KTMA 3L71D 3G21A 2XZRA 2WSEH 4GKGA 1HJ0A 2IBZE 1Q7YQ 3JSVC 3DS0A 3M0AA 2HR3A 5TISH 1TU3F 3CX5H 4I7ZC 2ERHA 3CWBE 2QJPC 3KPEA 3DS1A 3VP9A 2M8LA 1N7SB 1A02F 1VQLP 3L72G 3CPWO 3ABVC 1YQ4C 2XU6A 1W2EA 1SQQK 1NGMB 2KOSA 2ZXXA 4N6JA 3AEEC 2I1JA 5AW5B 2KZIA 2K9JA 1AVYA 5TISE 3TGUD 4HJGH 1KB9E 1LTBC 1JTHB 2AXCA 2OARA 2Z45A 2KLUA
chains in the Genus database with same CATH topology
3G1IA 2LF4A 3NTEA 4QNBA 2XV6A 3VRLC 2L6EA 1VQNP 3P05A 4XRQA 5F2KA 2OTLP 1YHQP 3CC2P 4XROA 3CCLP 1YJ9P 2PEKA 1Q81Q 2JO0A 2XXMA 2Z44A 4U0BA 3CCJP 1RO2A 3DS3A 1M1KQ 1VQ6P 2PEIA 1PEQA 2KODA 2M8NA 2M8PA 1VQOP 3I55P 2QA4P 3CCSP 2QEXP 3G29A 3M1MA 1VQ9P 2DGYA 1PEMA 3G0VA 2P9XA 1ZMBA 1YJWP 1EIAA 3RG6C 3HZQA 2EFJA 2Z46A 3DS4A 3H0DA 1JJ2O 1EOQA 3Q20A 5F2OA 1K73Q 2BHVA 1QRJA 3MGEA 1VQ5P 3HYBA 3CCUP 1YI2P 4XFZA 1PEUA 3G21A 3CXCO 4M0IA 1K9MQ 2JYLA 2JYGA 3LRYA 3CCRP 1VQ4P 3CC4P 1M90Q 1BAJA 3CMEP 3WBHA 4XFYA 5BS1A 1A43A 3CD6P 1KC8Q 3CCMP 1A8OA 1Q7YQ 3DS0A 3OW2O 5HGLA 1S72P 1KQSO 5I4TG 1VQMP 2PEOA 2PEQA 4PH0A 1W2BO 3CCQP 3DS1A 3G1GA 5HGMA 3G71P 4PH1A 3H4EA 2BQ1E 2M8LA 5HGNA 3G28A 1PEOA 2CWOA 4U0EA 5BS2A 1QVGO 2OTJP 2EIAA 4U0DA 1QVFO 2PENA 4XFXA 1M6EX 3DS5A 4GR2A 1VQLP 3DPHA 3DTJA 3CPWO 5HGOA 3G4SP 1VQ8P 2EG5A 2PY8A 3G26A 1K30A 1KD1Q 1VQKP 1YIJP 1K8AQ 1YITP 1D1DA 4U0AA 3H47A 4U0FA 1YJNP 3CC7P 5DCKA 1Q86Q 3B5IA 4COPA 4U0CA 1IUQA 1NJIQ 3E2DA 2BUOA 1E6JP 4GR6A 4COCA 2PEJA 3CMAP 2E1MA 2XT1A 3DS2A 3G6EP 5JPAA 4IPYA 1N8RQ 2ONTA 5F2NA 1M74A 1AUMA 1Q82Q 2PEMA 1RO0A 1RNIA 1M6NA 4WYMA 1VQPP 3I56P 3CCEP 2OARA 2Z45A 1VQ7P 3CCVP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 P;  1K8A Q;  2QA4 P;  1Q7Y Q;  3CCS P;  2QEX P;  3OW2 O;  1YIT P;  1S72 P;  1KQS O;  1VQK P;  1VQM P;  1VQN P;  1VQ9 P;  1YJN P;  3CC7 P;  1W2B O;  3CD6 P;  1YJW P;  1Q86 Q;  3CCQ P;  1NJI Q;  3G71 P;  1JJ2 O;  1YHQ P;  2OTL P;  3CC2 P;  3CMA P;  3CCL P;  1YJ9 P;  3G6E P;  1K73 Q;  1Q81 Q;  1YI2 P;  1VQ5 P;  3CCU P;  2OTJ P;  1QVG O;  1N8R Q;  3CCJ P;  1Q82 Q;  1QVF O;  3CXC O;  1K9M Q;  3CCR P;  1M1K Q;  1VQ4 P;  1VQL P;  3CC4 P;  1M90 Q;  1VQ6 P;  3CME P;  3CPW O;  1VQP P;  3I56 P;  3CCE P;  3G4S P;  1VQ7 P;  3CCV P;  1KD1 Q;  1KC8 Q;  1VQ8 P;  3CCM P;  1YIJ P;  1VQO P; 
#chains in the Genus database with same CATH topology
 2LF4 A;  2WMM A;  3KQG A;  1VQN P;  3VN0 A;  2YO3 A;  1BGY D;  1H0T B;  3V5B A;  2C9L Y;  3WMM 0;  1OMI A;  5BU8 B;  1P84 H;  1QL2 A;  2KNC B;  2K9Y A;  3L70 D;  4EDF A;  1HF9 A;  3SFD C;  5AVS B;  2R44 A;  4KHX A;  3B5N C;  2W83 C;  1GK6 A;  3CCS P;  5CCG D;  2P9X A;  1EIA A;  1KIL D;  3U59 A;  4QKO A;  1S5L X;  3V2P A;  3P8M C;  3D70 A;  2ZAE B;  2KOR A;  2BHV A;  1JO5 A;  4L76 A;  3V2R A;  2BEQ D;  2JYL A;  1PV3 A;  4PD4 E;  2JJL A;  1BAJ A;  3WBH A;  5KTB A;  4IOI H;  2YXQ B;  2QJY C;  3M91 A;  1LT9 B;  3EJD A;  3LID A;  2KG6 A;  3G1G A;  4WBA A;  1IK7 A;  3VTP C;  3VMX A;  4GOD A;  4DT0 A;  1QVF O;  1AQ5 A;  5AVY B;  2OYH B;  3DS5 A;  4GR2 A;  3MIW A;  3L73 J;  4TT3 H;  1KD1 Q;  2E76 D;  3CL3 D;  1YTZ T;  2V7Q H;  2FXM A;  1LTJ A;  2K0X A;  1IO4 A;  5CCH D;  3B5I A;  2BCC J;  1RE3 A;  1USD A;  1KIL B;  3CI9 A;  3B5N B;  2LXC B;  1JMM A;  2KI7 B;  4JYB A;  4ZKU A;  2GZE A;  3T97 A;  2AVA A;  2YKQ A;  1DH3 A;  2WTY A;  1QGK B;  2FFD B;  1LTG C;  3KHU A;  3CCL P;  1L0L J;  3H1I G;  1LGH B;  5APY A;  1HY8 A;  3PP5 A;  2Z44 A;  1Y47 A;  4ZNC A;  1GW4 A;  1URQ D;  2O01 J;  1K04 A;  1VQ6 P;  2E5T A;  2IPP A;  1N73 C;  3H1K E;  1L4A C;  1VQO P;  2B89 A;  4K3A A;  3L70 E;  2QA4 P;  5KP6 B;  3HD7 A;  4I7Z B;  3HE4 B;  3L74 E;  1SQQ G;  1SLQ A;  2Y0C A;  2KS1 B;  1OFC X;  2A45 G;  1NU1 D;  2FYN C;  5AW0 B;  3H1L E;  2Q1K A;  3LRY A;  3BRT B;  3SSU A;  1LTS C;  3QWO C;  4XFY A;  3NFQ A;  2A45 I;  1S3J A;  1MKM A;  2GM4 A;  2CPS A;  1SQQ E;  1R5L A;  1MUU A;  1PGJ A;  1LT9 C;  2FYU J;  4GDO A;  3WU2 H;  3L70 G;  2FXO A;  4H44 B;  1RH5 B;  3CWB D;  4DZO A;  4U3F G;  1H0T A;  1PEO A;  3G28 A;  1URQ C;  4LLH A;  1L0I A;  1SQV D;  2XZ0 D;  2GA1 A;  3WUV A;  2KOQ A;  3H1I J;  3DTJ A;  1KQG B;  1DV5 A;  2WZ7 A;  4OWF A;  2YNY A;  1USE A;  5GTI E;  1DX7 A;  3BCC D;  1SQP D;  1M8O B;  2DNW A;  1NTZ G;  4H0L B;  1E79 H;  3M9B A;  1NTM E;  1FZA A;  2Y0E A;  1IUQ A;  3BRV B;  2HG5 D;  1PPJ E;  1NTZ J;  2XT1 A;  1KFN A;  2WQY C;  5EJD A;  2IBZ I;  2ZYG A;  1UJZ A;  3CCV P;  1IFN A;  1H88 A;  2IZ0 A;  1N86 A;  1N7L A;  4JPZ B;  1N7S A;  1PZQ A;  5KLV E;  2SPZ A;  3UIA A;  2XXM A;  4U0B A;  4IFD K;  4IL6 X;  1GU4 A;  3VMZ A;  1GMJ A;  1CZQ A;  4L75 A;  1GL2 A;  1MV8 A;  3L74 J;  3RL0 C;  1P84 D;  5GTH H;  1EZV D;  3L75 G;  3MP7 B;  2DGY A;  3HZQ A;  2L91 A;  4MRT C;  1SQX J;  2IYO A;  3GHG A;  1DD3 A;  1LP1 A;  2IFM A;  1S9K E;  2KB7 P;  1K9M Q;  2ZJS E;  4Y99 C;  1VF5 B;  5HGL A;  2QJY B;  2QJP B;  5AVT B;  2K0D X;  1FDI A;  3ZDM A;  1BCC E;  2HPC B;  1T8K A;  1OW8 A;  3VMY A;  1M6E X;  2N1T C;  3IN6 A;  2H7H A;  1WRG A;  4UHP B;  2Y9Y A;  3NXS A;  2CGQ A;  5DJU B;  2BEZ F;  3G26 A;  2JWA A;  1YIT P;  2M3E A;  5KP7 B;  1GXH A;  3TNU A;  2PRR A;  3AEF C;  1X3O A;  3GW6 A;  3CX5 D;  2B9B A;  3CMA P;  4I2L C;  1FZG A;  1JMB A;  2ONT A;  1ACP A;  1ZN5 A;  3V2N A;  2GDX A;  2JP3 A;  3M9Q A;  5CMZ A;  5KLV G;  1DNY A;  2KSJ A;  5CJ4 A;  3AE8 C;  2O3J A;  3G1I A;  2IBZ D;  3L72 D;  3HUS B;  1SQP K;  2WSF H;  4IFF A;  2FFD C;  2YIU B;  2YMK A;  5CZD B;  4N78 D;  2FYN B;  2VLO A;  3H1I E;  1OW7 A;  3HD7 D;  4RJT A;  1KZU B;  2LOL A;  4BRY A;  1AF8 A;  3G29 A;  1QX8 A;  1SQX E;  1NTZ K;  4WB4 A;  1X22 A;  2FVA A;  3HYB A;  5AVV B;  1G2C A;  1OIP A;  3CC4 P;  2VLP A;  2RN0 A;  3M9H A;  4QMA A;  2W8Z A;  4XA4 A;  3RGU A;  4YXD C;  3S9O A;  2N6Z A;  2VSQ A;  3P32 A;  5KJ7 A;  1VPC A;  1IFI A;  1BSN A;  5KLI B;  1R5S A;  2K37 A;  4Y28 J;  4HH2 A;  3H1K J;  3GG2 A;  1JTH A;  3L73 E;  1VQ8 P;  1VQK P;  2QE7 H;  4H2X C;  3B5N D;  2QRX A;  3Q5R A;  3FWL A;  1NQ4 A;  1WT6 A;  1CI6 B;  2E5Y A;  1K05 A;  1A02 J;  4D6T J;  2FVE A;  1MFT A;  3K5B A;  1WMK A;  1G1I A;  2K94 A;  4EYY Q;  2RMZ A;  4PD4 D;  3I56 P;  4HYT B;  1L2P A;  1SQQ J;  1VQ7 P;  3IAO A;  2JEE A;  1FZF A;  4PV1 B;  2XV5 A;  1LTJ C;  3VOP A;  3VP8 A;  2WT7 B;  1BSH A;  3O6Q B;  1E0H A;  1AQT A;  3GKL C;  4C7N B;  4B86 A;  1SQB J;  1KLP A;  1PP9 D;  2Q6Q A;  1FZC A;  1M1K Q;  1SQB K;  2E76 C;  3AE7 C;  2PP6 A;  1PEM A;  3H25 A;  1ZMB A;  1SQP E;  1EDL A;  4L74 A;  2E43 A;  1LWU B;  3MGE A;  2E75 D;  2WSF J;  3WU2 E;  1PEU A;  2R3C A;  4H2Y C;  3KZI H;  2KOO A;  4EOT A;  5B66 H;  4UB8 H;  3EQ2 A;  1KQS O;  1SQX K;  5KLV J;  3C1L A;  1X8Y A;  1SQP G;  2Y0D A;  1NO4 A;  2CWO A;  2OTJ P;  1URQ B;  1SQV E;  1CEI A;  1PP9 E;  2HOD B;  3AE6 C;  3R2P A;  4O9B A;  2LXB A;  5HGO A;  3P8C E;  2EG5 A;  1YIJ P;  5CCG A;  1L0N D;  1J1D C;  2JB0 A;  3L71 E;  1Z6M A;  1HQB A;  1KIL C;  2Q3I A;  2XNX A;  3MUD C;  3DS2 A;  3SWK A;  2XND H;  3Q2Y A;  1NTK E;  1BGY G;  1NU1 E;  3BAS A;  3M06 A;  4U3F E;  1RO0 A;  1VQP P;  2ZYD A;  2WSC H;  1FZE A;  3IF4 A;  5CCG C;  1S4X A;  1YBK A;  3RK3 C;  1M1J A;  5KAF E;  1BCC J;  1JUN A;  3D71 A;  4WY4 A;  2L22 A;  1MZ9 A;  1EZV G;  1YJ9 P;  2PEK A;  1VHN A;  4JYC A;  5AW8 B;  2YXR B;  1IK9 A;  2H89 C;  1RE4 C;  2D2C C;  3NY7 B;  4OGQ C;  2M8P A;  1AFO A;  5CCH A;  1BE3 D;  1JY3 N;  3MTU E;  3NMD A;  1NTM D;  2Z46 A;  2FQ2 A;  5KAI H;  1JOC A;  3SFE C;  3D6Z A;  2C0W A;  2MR8 A;  3CX5 E;  1GL2 B;  1ZRT D;  2P10 A;  1EZV I;  1M90 Q;  1FBM A;  5KP8 B;  3CWB G;  4DCK A;  4GOF A;  5APT A;  4WY4 B;  2K3R A;  1ZR4 A;  2POH A;  2FAE A;  3CCQ P;  1IFJ A;  2AFE A;  1L4A A;  2JU1 A;  1J2J B;  5AVZ B;  2ROQ A;  3A5T A;  2LKM A;  4KT0 J;  2GZI A;  2N98 A;  2KGD A;  5APS A;  3QH9 A;  2KG8 A;  4CPG A;  1KYO I;  4MN4 C;  2ZXE B;  2O1K A;  1GD2 E;  2GZG A;  1SQB G;  2WPT A;  4U0F A;  2Q7C A;  3LMO A;  2KGC A;  4U0C A;  1NJI Q;  1R8E A;  1E6J P;  1FJK A;  2PEJ A;  3TDK A;  1XTG B;  4N3Y B;  1EXJ A;  1KB9 I;  3RK3 B;  4U3F D;  3CXH E;  2FHS C;  2KYV A;  2HOD A;  3S4R A;  1LTT C;  2KSE A;  2L6E A;  1FOS F;  2ZVN B;  2VRS A;  2ZVO B;  2EHT A;  3L36 A;  2W27 A;  2ITA A;  1GU5 A;  3R4Y A;  5AVU B;  3L70 J;  2FAD A;  1PL5 A;  3HTK B;  2PEI A;  1PEQ A;  2M8N A;  1JCD A;  1JY3 P;  4I1L A;  1LWU A;  2QEX P;  2O01 H;  2PAJ A;  3TNU B;  5EFW B;  3L37 A;  2HFE D;  4GOE A;  1FJP A;  2Q3E A;  1UNK A;  5CHX A;  2OYI C;  3CXC O;  2AEJ A;  3AEG C;  4HB1 A;  3CLQ A;  4ASV A;  3FXD A;  2QSI A;  1KC8 Q;  2JQ4 A;  1NHL A;  2Z4E A;  5BVZ A;  1L0L E;  1LTA C;  4YPC A;  2LKI A;  2R3S A;  1KMI Z;  2PEN A;  3GZM A;  1KOR A;  3L73 D;  3FWN A;  2NPS D;  2KP8 A;  4EIJ A;  1JY2 O;  4DJG A;  5APV A;  1KIL A;  3HUS C;  4WWI A;  3MZW B;  3H47 A;  1RF1 A;  2JAZ A;  2M3B A;  1Q86 Q;  1FE6 A;  1L0N K;  1S1C X;  1N2D C;  1XTC C;  2BCC D;  1EDJ A;  2C0X A;  2L9F A;  2KS1 A;  1EQ7 A;  3HTK A;  4BPF A;  5DJT B;  3KZI E;  2E74 D;  5F2N A;  1Q82 Q;  2CQ8 A;  3G3Z A;  2G3A A;  1Y9B A;  3MD0 A;  3HD7 B;  3JC2 2;  3W67 A;  1GL2 C;  2KUB A;  1DIP A;  1SVF A;  3CXH D;  1YHQ P;  3HD7 C;  4EI2 A;  1L0L D;  1NOH A;  3A0B E;  1H89 A;  3PHL A;  2P67 A;  3IFM A;  1ZME C;  2RH0 A;  1BDC A;  2JDI H;  4IL6 H;  2MVU A;  3PH0 A;  2NPS C;  2L0Q A;  4AQR D;  1M1J B;  4JBZ A;  4KJM A;  1P84 E;  5L8R J;  3TF5 A;  4XE5 B;  2GUV A;  1AJY A;  1L0L K;  3HRN A;  1JM0 A;  2GDY A;  3RG6 C;  1LT1 A;  3TGU E;  2IZ1 A;  1NU1 J;  2CG5 B;  2N1T D;  2AFD A;  1NTK J;  5TJH A;  1LTI C;  1BXI A;  1T6A A;  2P7J A;  3GZL A;  1L4A B;  3OW2 O;  2FYU D;  2PEO A;  1FZC C;  2JKV A;  3CWB J;  5KLV K;  1N73 A;  1URQ A;  3BCC G;  3SWF A;  2R32 A;  1U57 A;  1AVO A;  4H13 D;  1SQV J;  3EFG A;  1JEK A;  1BCC G;  5GTH E;  1GW3 A;  1OVR A;  2ZT9 C;  1OR5 A;  1EMV A;  1SQP J;  1K8A Q;  5APU A;  2IYP A;  3AE3 C;  2Q5U A;  1YJN P;  1EDI A;  5M1B A;  1PPJ D;  3AE1 C;  4WVZ A;  1S9K D;  2JGP A;  4BPH A;  5B66 E;  3AE9 C;  4IPY A;  3A0H E;  1AUM A;  5KAF H;  2I1K A;  4OH8 B;  1F80 D;  2OYO A;  4U7J A;  2FYU E;  3H1H J;  1X9V A;  5CJ0 A;  2N5H A;  3H1J D;  7CEI A;  2OTL P;  4NPD A;  4RKU J;  1LWU C;  3F89 A;  2PNG A;  1ZNV A;  3FGA D;  3AE5 C;  1IJD B;  2WWW A;  1VF5 D;  1KQF B;  3OAK A;  3L75 D;  4GT1 A;  3BAT A;  3L4F A;  2V7Q J;  3L74 D;  2J58 A;  5AW6 B;  3GHG B;  1UII A;  3TK1 A;  1AA0 A;  4PJ0 H;  1LP1 B;  1YJW P;  2A06 E;  2M5R A;  2VLQ A;  2WPV B;  1GXG A;  4UB8 E;  2IBZ G;  3EJE A;  1RHZ B;  1RY3 A;  1G1J A;  1KB9 H;  2PGD A;  2OTK E;  3Q1M A;  1IMP A;  4R4M A;  3H1H G;  1RE4 A;  5AW3 B;  3RG2 A;  5HGM A;  2CK3 H;  3V4W A;  5HGN A;  4U0E A;  3BCC E;  3N4X A;  2GZF A;  3LW5 J;  1JY3 O;  4BXL A;  1DEB A;  1K30 A;  1KN7 A;  1KIL E;  2E75 B;  3ITK A;  1D1D A;  1BE3 E;  4U0A A;  3CC7 P;  5CBN A;  3B71 A;  5E79 H;  4OGQ B;  3H1L J;  1YTZ I;  2IFN A;  1FU1 A;  2WSC J;  1FZC B;  1NYH A;  1M6N A;  2EHS A;  2E76 B;  4C7N A;  4Z1M H;  1JB0 J;  1KB9 D;  2KG9 A;  2NRG A;  3C8V A;  1NTK G;  2WT7 A;  5AVX B;  1CSB A;  5B5E H;  3KXD A;  1T8Z A;  2C9N Y;  2B88 A;  3T97 B;  5BU5 A;  4XRO A;  1PGP A;  2NPS A;  1IFM A;  3FX0 A;  1EZV E;  4RES B;  4DG9 A;  1JY2 P;  2LIW A;  3MUD A;  1OX3 A;  2NZ2 A;  2K9J B;  4YTP C;  5AW2 B;  1VQ9 P;  1BDD A;  1SP4 A;  3PLN A;  4A7P A;  2MKV A;  3AED C;  2FY8 A;  3H6P A;  1JJ2 O;  1M1J C;  3RK3 E;  3Q3D A;  2NO8 A;  1OVV A;  2YIU C;  2A06 D;  3L71 J;  4XFZ A;  1VQ4 P;  2ZT9 B;  1FOS E;  5AW9 B;  4PD4 H;  2QVA A;  2WSE J;  4I6M C;  2WSS H;  1GPJ A;  1VKU A;  1RF1 C;  2M5A A;  4PH1 A;  3O6Q A;  2P2U A;  3GJN A;  3GF7 A;  5BS2 A;  1BE3 G;  2EIA A;  3U1A A;  3H1K D;  3V4Q A;  1G2C B;  2HLO A;  1HUC A;  2QJK B;  2P1J A;  2O1J A;  2N1T B;  5APQ A;  4COP A;  3B5N A;  3C9I A;  1CI6 A;  3TGU J;  1J1D B;  1N8R Q;  2OQQ A;  3KDP B;  2KXP B;  2KNC A;  1LTJ B;  1NU1 K;  1ZLL A;  2KR5 A;  3HE4 A;  3FXE A;  3L71 G;  2O01 N;  1BGY E;  3NTE A;  4QNB A;  2FXP A;  2KK7 A;  3VRL C;  4AYC A;  2AXT H;  2OYH A;  5KJ7 C;  3HUS A;  2M5A B;  1YYC A;  3P05 A;  1BGY J;  1LT9 A;  2J5U A;  1N73 B;  1ZOY C;  1SQB D;  3P8C D;  3CCJ P;  2LIU A;  3GF3 A;  1L0N G;  2FQ0 A;  4GIF A;  1D7M A;  5AW1 B;  3WUT A;  4L73 A;  1GTW A;  4PV1 C;  1Q2N A;  2I8D A;  2QNW A;  5HVC A;  2YO2 A;  2E74 B;  4Y99 B;  2AXT E;  5HV8 A;  1YI2 P;  3CXH H;  3W68 A;  4LGD E;  1VL2 A;  5CBO A;  1RE3 C;  2JYG A;  2MJZ A;  1E5W A;  2E75 C;  2NPS B;  4PD4 I;  2YKP A;  3H32 A;  1UIX A;  1S72 P;  4HKG A;  4PH0 A;  3LIE A;  4D6T G;  1W2B O;  1S5L E;  1LNQ A;  3EWK A;  2MR7 A;  3L72 E;  2BQ1 E;  1QVG O;  1L0H A;  4XFX A;  1EC5 A;  1PPJ G;  1PGO A;  5H2F H;  2FVF A;  1HWT C;  3G4S P;  4H0L C;  2PY8 A;  1NTM G;  3A2A A;  2BCC G;  2UWJ E;  1FS0 E;  1L0N J;  1NTZ E;  1YQ3 C;  2AEF A;  3JCU H;  1T2K C;  4M3L A;  2E1M A;  1IFP A;  4H44 C;  2PEM A;  4UB6 H;  4WYM A;  1DEE G;  1RQV A;  4NEO A;  4H13 B;  5EW5 E;  1SQX G;  2FAC A;  1BCC D;  3H1J E;  2QIW A;  3RL0 g;  3HE5 A;  2WVR A;  2QJK C;  4LC1 A;  1NAY A;  4TLF A;  1AV1 A;  3JCU E;  2GDW A;  2WPR A;  5KJ7 D;  1KYO D;  3DS3 A;  4H44 D;  1KYO H;  3I55 P;  2JBG A;  3A7O A;  1X79 B;  4IFM A;  2K0Y A;  1SS1 A;  1AYI A;  3G0V A;  3N7N A;  1NTM J;  2KZJ A;  3H0D A;  1U7M A;  1ZXG A;  5F2O A;  1K73 Q;  2N6Y A;  1HBW A;  2IX7 C;  1QRJ A;  1S5L H;  3H1J G;  4H0L D;  3CE7 A;  2AF8 A;  2JO1 A;  1J1E C;  2FYU G;  5BS1 A;  3OJA B;  1NU1 G;  1NWQ A;  1PFI A;  1VQM P;  1VDF A;  2LPK A;  4N78 E;  5KAI E;  3G71 P;  2KLV A;  3E1I A;  1SFC B;  2KIK A;  4JF7 A;  3H1I D;  2KOG A;  3BCC J;  3RK2 C;  2W6B A;  1GL2 D;  1SQV G;  2M0B A;  1HJB A;  1NTZ D;  1VF5 C;  4COC A;  3RL0 B;  5B5E E;  3G6E P;  2FBW C;  1KV4 A;  1OVU A;  2W6J H;  1RNI A;  1L0L G;  3CCE P;  3GHG C;  1H8A A;  1ZR2 A;  4U3F J;  2V4H A;  3Q5P A;  1HVV A;  2PFX A;  1DD4 A;  5F2K A;  4C46 A;  4BPG A;  3CC2 P;  5E79 E;  3L74 G;  1MZ8 A;  1Y8A A;  2GYK A;  2K92 A;  2FYZ A;  2P58 A;  3WUU A;  2DW3 A;  2KOD A;  3II6 A;  3PJS K;  4C7R A;  5GTI H;  2Z5I A;  2BCC E;  1NTM K;  2WPQ A;  1PIX A;  4AUW A;  4R0M A;  3RK3 D;  2KOP A;  4H13 C;  1L0N E;  1EOQ A;  1SQX D;  1CW5 A;  2B87 B;  2LL8 A;  1NTK K;  3CCU P;  1IMQ A;  2JR8 A;  2JWD A;  2K88 A;  3CD6 P;  2M8R A;  1A8O A;  3A0H H;  2YMY A;  1KFM A;  2D2C B;  4BWN A;  1FZB A;  3TGU G;  4OVN F;  1T2K D;  3E7K A;  3L73 G;  3H4E A;  3B8E B;  3U1C A;  1GK4 A;  2KGA A;  4H2W C;  2FFD A;  1NKZ B;  4PJ0 E;  1EXI A;  4U0D A;  4NPF X;  3DPH A;  5H2F E;  2L4B A;  1J1E B;  1KQL A;  2A45 H;  3CX5 I;  2CNR A;  3SWY A;  3AEB C;  3G9R A;  1RF1 B;  2OYI A;  3E2D A;  3I5C A;  4GR6 A;  1ZP0 C;  2L5G B;  3B4Q A;  5JPA A;  3AE2 C;  2LML A;  2XZ1 C;  4PXH B;  4ZKP A;  3AE4 C;  2KW2 A;  2N5I A;  2FYU K;  1QL1 A;  5AVQ B;  4XFJ A;  3L72 J;  3RK2 D;  1QLE D;  3BVH A;  2QG4 A;  1SFC D;  1HTL C;  1HGV A;  1FDM A;  1X0T A;  3Q5S A;  5CCH C;  1Q81 Q;  3RBZ A;  2JO0 A;  2LTE A;  3MGN A;  4WY4 D;  1RO2 A;  3EFF K;  2XDJ A;  2R5D A;  2Y9Z A;  3V2Q A;  4IL6 E;  1NH4 A;  3S1K A;  2ZT9 D;  4W80 A;  2AEM A;  5KKZ B;  1GDT A;  2Q9I A;  5AVW B;  3AEC C;  2GZJ A;  3DS4 A;  2X2B A;  3U43 A;  1JNM A;  2MVV A;  4D6T E;  2Z5H A;  1NTK D;  3KYQ A;  4M0I A;  1T3U A;  4R4L A;  1A43 A;  3USS A;  2YKO A;  3PTZ A;  3H1L G;  2K5X A;  2PEQ A;  3D6Y A;  4DOJ A;  1JCC A;  1Q90 D;  5KLI C;  2KGE A;  3IR9 A;  2G8Y A;  2E42 A;  2D2C D;  1GZL A;  1NVO A;  2GUS A;  2B87 A;  1KYO E;  3H32 B;  2K1A A;  2MD9 A;  2OYI B;  3V6I A;  2KWL A;  1S2E A;  2N1T A;  1ZRT E;  1FAV A;  4PWV B;  1M7L A;  4D6T D;  4W7Y A;  4NPE A;  3VYI A;  1M74 A;  3EJB A;  1IZN B;  3H1H D;  1SQQ D;  1JY2 N;  5APX A;  3RBX A;  4UB6 E;  2XV6 A;  1N7S D;  2BAS A;  1EDK A;  3HE5 B;  1OZH A;  1W5C E;  3H1J J;  3O8Z A;  2IDB A;  2WPS A;  1IFD A;  3NTN A;  1M56 D;  3L75 E;  4ASW A;  1PP9 J;  1NAF A;  2QM8 A;  3L75 J;  3VMA A;  3TSI A;  2A06 G;  2OGU A;  5AVR B;  3TYY A;  2R5B A;  2J59 M;  3M1M A;  1MFZ A;  1OXZ A;  2H43 A;  1QEX A;  1PGQ A;  2EFJ A;  3M0D C;  2ZFC A;  1VQ5 P;  2E74 C;  2W90 A;  3F5H A;  5AW7 B;  2FQ1 A;  3CCR P;  4RO0 A;  3E1R A;  4BRY B;  3CME P;  4OGQ D;  3CCM P;  3H1H E;  2CPB A;  3A3Y B;  5K5G B;  2VLN A;  5I4T G;  5KLV D;  5APW A;  4PV1 D;  1HGZ A;  3PRJ A;  1P84 I;  3M0D A;  5KKZ C;  3GLM A;  3RK2 B;  1NKN A;  3CXH I;  2H88 C;  3AEA C;  2ZYA A;  4F37 A;  2K2Q A;  1N7S C;  1PP9 G;  1OW6 A;  3LW5 H;  3GMA A;  2LR2 A;  2N9Y B;  2RKL A;  4JQ0 D;  5DCK A;  1FDO A;  3A0B H;  3P7K A;  3H1L D;  2BUO A;  2HYN A;  5C39 A;  1HH0 A;  4W7Z A;  1RF0 C;  4YXW H;  1RQU A;  2OYH C;  1U7J A;  1T3J A;  2MF4 A;  1SFC A;  5AW4 B;  4CA3 A;  2N50 A;  2QM7 A;  2K93 A;  2HPC A;  3H1K G;  4XRQ A;  2H8P D;  1SQV K;  1L4A D;  1ZW0 A;  1FR2 A;  1FC2 C;  1SQB E;  1M57 D;  1RF0 A;  2XKM A;  2FKW B;  4ZMD A;  2W6A A;  4K35 A;  1IC2 A;  3OA7 A;  1ZV8 A;  1BE3 J;  1LJ2 A;  4WY4 C;  2WIT A;  4HKZ H;  3MHV A;  3B4S A;  1Z56 A;  3RL0 D;  2MY5 A;  1OWA A;  2N9B A;  1SFC C;  3Q20 A;  2JU2 A;  4IZ6 A;  3L35 A;  1KTM A;  3L71 D;  3G21 A;  2XZR A;  2WSE H;  4GKG A;  1HJ0 A;  2IBZ E;  1Q7Y Q;  3JSV C;  3DS0 A;  3M0A A;  2HR3 A;  5TIS H;  1TU3 F;  3CX5 H;  4I7Z C;  2ERH A;  3CWB E;  2QJP C;  3KPE A;  3DS1 A;  3VP9 A;  2M8L A;  1N7S B;  1A02 F;  1VQL P;  3L72 G;  3CPW O;  3ABV C;  1YQ4 C;  2XU6 A;  1W2E A;  1SQQ K;  1NGM B;  2KOS A;  2ZXX A;  4N6J A;  3AEE C;  2I1J A;  5AW5 B;  2KZI A;  2K9J A;  1AVY A;  5TIS E;  3TGU D;  4HJG H;  1KB9 E;  1LTB C;  1JTH B;  2AXC A;  2OAR A;  2Z45 A;  2KLU A; 
#chains in the Genus database with same CATH homology
 3G1I A;  2LF4 A;  3NTE A;  4QNB A;  2XV6 A;  3VRL C;  2L6E A;  1VQN P;  3P05 A;  4XRQ A;  5F2K A;  2OTL P;  1YHQ P;  3CC2 P;  4XRO A;  3CCL P;  1YJ9 P;  2PEK A;  1Q81 Q;  2JO0 A;  2XXM A;  2Z44 A;  4U0B A;  3CCJ P;  1RO2 A;  3DS3 A;  1M1K Q;  1VQ6 P;  2PEI A;  1PEQ A;  2KOD A;  2M8N A;  2M8P A;  1VQO P;  3I55 P;  2QA4 P;  3CCS P;  2QEX P;  3G29 A;  3M1M A;  1VQ9 P;  2DGY A;  1PEM A;  3G0V A;  2P9X A;  1ZMB A;  1YJW P;  1EIA A;  3RG6 C;  3HZQ A;  2EFJ A;  2Z46 A;  3DS4 A;  3H0D A;  1JJ2 O;  1EOQ A;  3Q20 A;  5F2O A;  1K73 Q;  2BHV A;  1QRJ A;  3MGE A;  1VQ5 P;  3HYB A;  3CCU P;  1YI2 P;  4XFZ A;  1PEU A;  3G21 A;  3CXC O;  4M0I A;  1K9M Q;  2JYL A;  2JYG A;  3LRY A;  3CCR P;  1VQ4 P;  3CC4 P;  1M90 Q;  1BAJ A;  3CME P;  3WBH A;  4XFY A;  5BS1 A;  1A43 A;  3CD6 P;  1KC8 Q;  3CCM P;  1A8O A;  1Q7Y Q;  3DS0 A;  3OW2 O;  5HGL A;  1S72 P;  1KQS O;  5I4T G;  1VQM P;  2PEO A;  2PEQ A;  4PH0 A;  1W2B O;  3CCQ P;  3DS1 A;  3G1G A;  5HGM A;  3G71 P;  4PH1 A;  3H4E A;  2BQ1 E;  2M8L A;  5HGN A;  3G28 A;  1PEO A;  2CWO A;  4U0E A;  5BS2 A;  1QVG O;  2OTJ P;  2EIA A;  4U0D A;  1QVF O;  2PEN A;  4XFX A;  1M6E X;  3DS5 A;  4GR2 A;  1VQL P;  3DPH A;  3DTJ A;  3CPW O;  5HGO A;  3G4S P;  1VQ8 P;  2EG5 A;  2PY8 A;  3G26 A;  1K30 A;  1KD1 Q;  1VQK P;  1YIJ P;  1K8A Q;  1YIT P;  1D1D A;  4U0A A;  3H47 A;  4U0F A;  1YJN P;  3CC7 P;  5DCK A;  1Q86 Q;  3B5I A;  4COP A;  4U0C A;  1IUQ A;  1NJI Q;  3E2D A;  2BUO A;  1E6J P;  4GR6 A;  4COC A;  2PEJ A;  3CMA P;  2E1M A;  2XT1 A;  3DS2 A;  3G6E P;  5JPA A;  4IPY A;  1N8R Q;  2ONT A;  5F2N A;  1M74 A;  1AUM A;  1Q82 Q;  2PEM A;  1RO0 A;  1RNI A;  1M6N A;  4WYM A;  1VQP P;  3I56 P;  3CCE P;  2OAR A;  2Z45 A;  1VQ7 P;  3CCV P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...