1KQSO

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1kqsO02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1kqsO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1kqsO03
1Q81Q 1VQ9P 1YITP 1VQ7P 1VQOP 3CPWO 3I55P 1VQNP 3G4SP 1VQPP 3G6EP 3OW2O 1VQ4P 3CCSP 3CC4P 1VQ5P 3I56P 2QEXP 1Q86Q 2QA4P 3CCQP 1YIJP 1M1KQ 1QVFO 1KQSO 1YHQP 1YJ9P 1W2BO 1VQ8P 1KC8Q 1YJNP 2OTJP 1KD1Q 3CMAP 1S72P 3CCRP 1NJIQ 3CC7P 3G71P 3CCMP 1JJ2O 3CD6P 1K73Q 1K8AQ 1M90Q 1N8RQ 1K9MQ 3CCJP 1VQLP 3CCUP 1Q7YQ 3CC2P 1VQ6P 3CCEP 1VQKP 3CMEP 1YJWP 1QVGO 3CCLP 1Q82Q 2OTLP 3CXCO 3CCVP 1VQMP 1YI2P
chains in the Genus database with same CATH superfamily
1G2CB 3H1HE 4XFZA 1JY2O 2WSEH 3Q5PA 2NZ2A 3H47A 1SQQD 1USDA 3N4XA 3CCRP 3WU2E 1PGJA 1NGMB 1L0LK 4ASWA 3VMZA 1GD2E 3V2QA 2OYHC 1K04A 2GYKA 3MTUE 2N1TA 2Q3EA 4PD4D 1M1KQ 2FQ1A 2K9YA 2JWAA 1LTJC 2DW3A 2OTJP 2R5DA 4I1LA 3CMAP 1RHZB 1BE3D 3U1AA 1A02F 4IPYA 2Q7CA 2L91A 1AQ5A 2PY8A 5GTIE 1NU1G 5KAFH 1NU1K 1VQNP 4PD4H 4C7NB 2Q1KA 3B5NC 2O01J 3DS4A 2FYZA 4JYCA 1KB9E 1T3JA 2QE7H 3BVHA 1AUMA 2AXTH 4YXWH 3L74D 1SQXE 3BCCJ 3B5ND 3B4QA 3AE6C 1RNIA 2KGAA 4IL6H 2E75C 2ZJSE 2W6JH 1SQVD 1T6AA 3KXDA 4JBZA 2GM4A 3HTKB 1SQPG 1IJDB 1SQPK 4I7ZB 2K37A 4TT3H 2QSIA 3M0AA 2MR7A 3GG2A 3FWNA 3HRNA 1KFMA 3WU2H 1ZXGA 2QEXP 4H13B 1MV8A 3CCQP 2N1TC 4EDFA 3TDKA 4LLHA 3N7NA 1GW3A 2E43A 3CCMP 1M57D 4GOFA 4ZNCA 2D2CB 3AECC 3AE5C 2N6YA 1Q81Q 2N1TD 1KQGB 1L0HA 1PPJE 2KWLA 1L0NE 5DJUB 4OVNF 2ZT9C 1SFCA 1KYOE 3TGUJ 1H8AA 2K9JB 3HUSB 5GTIH 3CD6P 3KPEA 2NRGA 3TK1A 1PEUA 4I6MC 2ZVOB 3M1MA 4B86A 3D6YA 2ZT9D 1PEQA 1E79H 1KB9H 4WY4B 2B9BA 2N5IA 2ONTA 5B5EH 2W27A 3BCCE 5F2KA 3KDPB 1JM0A 2ZXEB 3L4FA 3M0DA 2JYGA 2FXOA 2O1KA 4C46A 1S9KD 1JCDA 5M1BA 3CC4P 2IBZD 3B8EB 2QM8A 1LP1B 3H32A 4YPCA 2DGYA 2KOOA 3H1JG 2KYVA 3O8ZA 1HJ0A 2BCCJ 3H1KD 2JWDA 5AVUB 1L0LJ 1M74A 2GUSA 1A02J 2B87B 2CPSA 2M5AA 2FBWC 3PLNA 1NTME 5APVA 2WT7B 3KQGA 3RK2B 2W83C 1GTWA 1SFCC 2HPCB 1NOHA 3L71G 3AEAC 4RJTA 1T3UA 1SQBE 2AEMA 3IF4A 4PD4I 3CPWO 2QJKB 1S1CX 1SFCD 1VPCA 1MKMA 2M8NA 1MUUA 3H6PA 1EOQA 4BPHA 2MF4A 5CCGC 1QGKB 2ROQA 3BRVB 2KW2A 4K3AA 4M0IA 1EDLA 2C9LY 2FYNB 5KKZC 1EZVE 2K0XA 3M0DC 3NTEA 5BVZA 1DEEG 4XE5B 5AVZB 1ZMEC 1HTLC 1N2DC 2IZ1A 5CCGD 3C9IA 1RH5B 4GR2A 5KJ7A 3Q2YA 2J58A 2KS1A 2W6AA 3H1HG 3U43A 1KILE 5KLVJ 1BDDA 2K0DX 2PRRA 2KG9A 3EFGA 1JTHA 4GKGA 2H8PD 2QRXA 2ZYGA 2HFED 3JCUE 2IYPA 3CWBD 5AW2B 1CW5A 4Y99B 1BGYJ 1ZW0A 2NPSB 3D70A 3M9HA 4M3LA 1M7LA 4R4LA 2OYIB 4IFMA 5JPAA 2ZVNB 1LWUA 2WSSH 5HGMA 1NU1E 2WSFJ 5CBNA 4K35A 2PEMA 1EZVD 4H44B 2R5BA 3CC7P 3LW5H 3DS3A 3RG6C 4H2XC 3L36A 1KB9I 3I55P 1H0TB 2KXPB 2GDWA 4W7YA 2XNXA 2FYUG 1NTKK 4CA3A 4GODA 4R4MA 1FAVA 5L8RJ 5KJ7C 3WMM0 1PP9J 1N7SA 2UWJE 3L72D 1UNKA 1NWQA 2K3RA 3FXDA 1QX8A 1VF5B 1M1JA 1SQPE 1S5LX 4PH1A 5KJ7D 1KORA 2A06G 2CWOA 2P9XA 4D6TJ 1HQBA 3RL0B 3SWYA 2IX7C 1OZHA 3MHVA 1PFIA 3SWKA 2JO0A 1G1IA 1XTCC 4U7JA 3JCUH 2FVEA 2IBZI 3E1IA 3GF7A 2WSCH 1LWUC 2QG4A 1OMIA 1OWAA 1IUQA 1JJ2O 1KYOI 2M3BA 2OTKE 1K8AQ 2XT1A 5BU5A 4ASVA 2R3SA 4JQ0D 1PPJG 1PZQA 5AVSB 1BCCJ 1KV4A 2HG5D 4DG9A 1URQB 1GPJA 1GL2B 2LKIA 2JEEA 3G3ZA 2E74C 2JP3A 1IFJA 1PIXA 2H43A 5AVTB 5AW4B 1IFPA 1T2KC 1LT1A 1SQQJ 4Y28J 4XROA 3KYQA 1Z56A 2K92A 2IPPA 3TSIA 2V7QJ 1LTAC 4U3FD 1VKUA 1N7SC 1XTGB 4C7NA 2RN0A 2E74D 3VP9A 3BCCG 3HE5B 2AFDA 2LOLA 2K88A 1Z6MA 3A7OA 1CZQA 4EI2A 1HY8A 3WUVA 3BATA 2DNWA 1N7SD 5AW1B 3ZDMA 2G8YA 2HLOA 3H1JE 5F2OA 3PHLA 3GHGB 3E1RA 2VLNA 3T97B 2R44A 1YIJP 3V5BA 4PXHB 3CX5E 3H1LJ 3G9RA 1QLED 1Y47A 1VQLP 5AVYB 3L71E 3RG2A 4DOJA 5DCKA 2IDBA 5APXA 3NMDA 1R8EA 1OVRA 2FXPA 1FZFA 3L73J 2O3JA 3L74J 4N78D 3B5IA 3TGUG 3USSA 2GZJA 2JGPA 2KP8A 2XZ0D 2OYOA 4L73A 1SQVJ 3G29A 1W2BO 2NO8A 2P58A 2KIKA 1EC5A 5I4TG 2K9JA 2HODA 1EZVI 1NTKJ 2KI7B 4U0CA 2IYOA 5GTHE 1L0IA 5F2NA 5HGOA 5AVRB 1FS0E 5CBOA 1UIXA 2WTYA 2XXMA 2E5TA 1DD4A 1X3OA 3G0VA 3BRTB 2BCCG 2N9YB 1HF9A 1L0LG 2MD9A 1JCCA 3CCUP 1VQ6P 3H1LE 2Y0EA 1KZUB 2WPRA 1OFCX 2WWWA 4GR6A 3L70J 1HH0A 1VQ9P 1VQ7P 2L5GB 2MKVA 3CX5H 1CI6A 2C0WA 1N73B 4YTPC 1YJ9P 1ZR4A 3VTPC 2BASA 2LF4A 1L2PA 2D2CC 1LT9B 1NAFA 2Z46A 2KG8A 4YXDC 5AW8B 1EMVA 1ZR2A 4JPZB 1J1EB 2YIUB 5E79E 1VQOP 3CCSP 2BHVA 3M9BA 2KGEA 2LTEA 1IFIA 2KB7P 2XV5A 1WRGA 3GW6A 2AFEA 2FYUE 1NKNA 3WUTA 1NTKE 3H1HD 1CSBA 3NTNA 4R0MA 2WITA 3H1KJ 2OTLP 3IR9A 1X0TA 2EIAA 5GTHH 3KHUA 1M6NA 2LMLA 2FHSC 2K93A 2V4HA 1ZRTE 1NTZK 5KLVG 5KLVK 2VLQA 2A06E 3VMAA 2KOSA 1YTZT 5HVCA 1FDIA 1RF1B 1ZOYC 3L75J 3W67A 1VL2A 3IAOA 5H2FE 2E75D 2N6ZA 1YQ3C 4L75A 2LPKA 5AW9B 2FADA 3A0BE 1JEKA 3CCJP 1BGYG 1P84E 3RK3B 3V4QA 2Q5UA 2JO1A 1LTIC 2RH0A 1JO5A 4OWFA 2KZJA 3O6QA 1KB9D 2JU2A 1J1DC 3AE1C 3MZWB 1SS1A 2QJPB 2FFDB 1FC2C 5AW5B 1LTJB 2YMYA 4BRYA 1SQXD 2K94A 2I1JA 5E79H 3SSUA 2GZGA 4Z1MH 2OGUA 2OYIA 1U57A 4U0AA 3DTJA 2QJKC 2QJYB 1AVYA 1KMIZ 1FJPA 1JY3P 3TNUA 1NYHA 3DS1A 1AQTA 2POHA 5CCGA 1TU3F 1NJIQ 3B5NB 3EJDA 3CWBJ 2FYNC 1PP9G 4EIJA 3CC2P 2PGDA 3CCEP 3CMEP 3SWFA 2E76C 1BXIA 4UHPB 1PL5A 1OVVA 2IZ0A 2GZIA 2FVAA 2P2UA 1AFOA 2KG6A 2EHTA 1AYIA 2N5HA 3L75E 2M3EA 4D6TG 3NXSA 2E76D 1PPJD 1L0ND 2L9FA 3IN6A 2WPQA 1KYOD 2YO2A 3CX5I 5H2FH 2PENA 3L37A 1Q90D 2J59M 4KHXA 3H0DA 3RBXA 1JY3N 3LIEA 1JY2P 1RE3A 4Y99C 1RO2A 5KLIB 2N1TB 2BUOA 3V4WA 3AE9C 4UB8E 1LTBC 3C1LA 5DJTB 2C0XA 3AEDC 1FZCA 4OGQB 2K1AA 3TGUE 5TISE 2XZRA 1BCCG 3BCCD 1PGOA 2OYIC 1KYOH 3C8VA 3L72J 1U7MA 1FZEA 2M8LA 1DX7A 2O01H 4H44C 3ABVC 4HKZH 4QMAA 4XA4A 1KILA 2KGCA 3DS0A 5KTBA 3HZQA 1SQQG 1SQQK 1GXHA 5KAIE 5CCHC 5CHXA 1LTSC 2FACA 3G1IA 1H88A 4H44D 3DS5A 1VQ5P 3H1IJ 3VN0A 2WMMA 3VRLC 1QL1A 2E5YA 1RY3A 1JUNA 1AV1A 3ITKA 4N6JA 4DT0A 3AEGC 1OVUA 5CCHD 2WPTA 4RO0A 1NTMD 1IZNB 1NTZJ 1VF5C 2BCCE 3GZMA 4EOTA 1L0LE 1KFNA 2O1JA 2KNCA 2J5UA 2BQ1E 1LTTC 1SQBD 2KLUA 3RL0C 1Y9BA 1RE3C 3H1LG 3HD7B 4U0BA 4WYMA 3MGEA 1FZCC 2AVAA 4UB8H 4U3FJ 3L73G 3L74G 3RL0D 3S4RA 5TISH 3E2DA 4BPGA 1OIPA 2GZEA 1KILC 4PH0A 1VHNA 2K2QA 1SFCB 1K05A 4I2LC 1SQVG 1SQVK 1URQC 3MD0A 1GL2C 1FR2A 1YITP 3U1CA 2JDIH 2K5XA 1NTKG 3MUDA 1KILD 1NVOA 4IL6X 3MGNA 3HE4A 2KORA 4BWNA 3QH9A 1IC2A 2A45G 1ZNVA 2QNWA 5AVVB 5B66E 3OJAB 2E42A 4AYCA 1EXIA 2LXBA 3G21A 1LGHB 1PEOA 1SLQA 5KLVE 4PWVB 3OW2O 3W68A 2AXCA 5APTA 2K0YA 5KP6B 1G2CA 3H32B 1SQXK 1MFTA 3GMAA 2RKLA 3GHGC 2AEJA 5TJHA 1K30A 1NU1D 1S4XA 3L70G 3A3YB 1BGYE 3Q5SA 3DS2A 1EQ7A 1D7MA 1ZV8A 2PP6A 3P8CE 4L76A 4H0LB 3AEBC 1FOSF 2M5AB 3HYBA 2WSEJ 2L22A 4U0EA 2HR3A 2Y0CA 1E5WA 5AW6B 5EW5E 2QM7A 4QKOA 3PH0A 1W5CE 3CL3D 1BSNA 5AW0B 3WUUA 3II6A 2JAZA 3IFMA 4GDOA 2KOQA 4MRTC 3MUDC 1UJZA 2Q6QA 4H2YC 1SQPD 3H1KG 1SVFA 1L0NK 1Q82Q 4JYBA 2WPVB 4UB6E 1PP9E 1FE6A 2H7HA 1T2KD 1EXJA 4RESB 1OW8A 1BGYD 4XRQA 1L4AB 1OXZA 3B4SA 1YJWP 4HB1A 1BE3J 1OW7A 4D6TE 1FZGA 2KS1B 2M8PA 2Z5HA 1YQ4C 1DV5A 3I56P 3L75G 2P1JA 1N7LA 1DH3A 1JTHB 1VQ8P 5APUA 3HTKA 1AF8A 2MVUA 2Z5IA 7CEIA 1W2EA 3P8MC 4NPDA 2YNYA 2EG5A 2PAJA 2KGDA 1BCCE 2WSFH 4PV1B 2ZYDA 1QVFO 3CLQA 1KC8Q 4OH8B 1YYCA 2CK3H 1M6EX 5KP7B 1IFDA 4H2WC 5EFWB 1PP9D 3S9OA 4DJGA 1N8RQ 1J1EC 2YIUC 5HGNA 1UIIA 1SQQE 4HKGA 5CJ4A 5APSA 3EFFK 4JF7A 1AJYA 3HUSA 2EHSA 2HYNA 3A2AA 2KSJA 2IFNA 3H1JD 1SQBK 4UB6H 1ZMBA 3CWBG 1X22A 1EDJA 5BS1A 3CI9A 3RK3E 4WY4A 5CJ0A 2M0BA 2GA1A 2GDXA 1BE3E 3CX5D 2MVVA 4U0DA 3PJSK 5AW3B 3L71D 1M1JB 3FGAD 1KN7A 2FY8A 1DIPA 2YKPA 3F5HA 4XFXA 4I7ZC 1AA0A 1Q7YQ 2ZXXA 4IL6E 1SQXJ 1M8OB 1EIAA 3DPHA 1N86A 2I1KA 2C9NY 1LP1A 4H13C 1EDIA 1VQ4P 2VLPA 2Y9YA 1GZLA 3CXHE 1GK4A 2VSQA 3GZLA 3LMOA 4GIFA 2PEOA 4XFJA 2MR8A 3L73E 3L74E 1LTGC 3RK3C 2LR2A 1S5LE 2B87A 4H13D 4L74A 3H4EA 2MJZA 2WT7A 3L72G 1SQVE 2HPCA 2P67A 3G28A 1FZBA 2QJPC 2FFDC 4GOEA 3D71A 1GU5A 3AE8C 3RK3D 1RQVA 2D2CD 3HUSC 1MFZA 1IO4A 2FQ2A 4GT1A 1HUCA 2V7QH 2QJYC 2L6EA 2XKMA 3EJBA 1L0NJ 1VQMP 4WY4C 2WVRA 3H1IG 2KUBA 4RKUJ 2FAEA 3H1LD 3GLMA 1AVOA 5B5EE 4IOIH 3CXHD 1FDMA 1NTZG 1QRJA 4WY4D 2Z44A 5BS2A 1FOSE 1NQ4A 1USEA 3PRJA 1KLPA 3L73D 1IMPA 2FQ0A 2Y0DA 2XZ1C 2CGQA 2X2BA 3L70E 4F37A 2Y9ZA 2RMZA 5APWA 1KD1Q 3M06A 3GJNA 3TF5A 2QIWA 1RF0A 3CXHH 5CZDB 2FYUD 4U3FG 1NTKD 5BU8B 3HD7A 5KLIC 3RK2C 4HH2A 1S5LH 3EQ2A 2OYHB 3EWKA 4LGDE 4OGQC 2KOGA 2NPSA 2FKWB 1GMJA 2YXRB 1S9KE 1X9VA 1T8ZA 2IBZE 5APYA 3JSVC 2Q3IA 3GKLC 3Q3DA 3RK2D 1T8KA 1NTMJ 1IFNA 1HVVA 3H1KE 2W90A 1WMKA 1NAYA 2LIUA 1ZRTD 4OGQD 1F80D 2OARA 3JC22 1Q2NA 2G3AA 2A06D 2WQYC 2XV6A 2A45H 4ZMDA 4BPFA 1NHLA 1SQBJ 2ERHA 2HODB 1H0TA 1ZN5A 3L70D 3LW5J 5CCHA 2JYLA 1RE4A 3NY7B 2QA4P 1HGZA 1KQSO 1P84D 4XFYA 4KT0J 3QWOC 4BXLA 1S72P 3AEFC 2EFJA 5AVQB 2QVAA 4CPGA 2E75B 3G26A 3CCLP 3B71A 1R5LA 1HGVA 1RF0C 1NO4A 1YI2P 3RL0g 2FXMA 1WT6A 2PEKA 4WB4A 3A0BH 3HD7C 1YHQP 3VOPA 1P84H 1SP4A 3I5CA 2ZAEB 1JNMA 2KODA 1CI6B 2NPSC 1DEBA 3UIAA 3GF3A 1D1DA 2B89A 3PP5A 3HD7D 3G6EP 3MP7B 1J1DB 2IFMA 4U0FA 2WZ7A 2CQ8A 4COPA 5EJDA 2NPSD 2WSCJ 4KJMA 2ZT9B 1S2EA 3AEEC 4C7RA 1RQUA 1URQA 1H89A 2Z4EA 1GL2A 3CWBE 1IK7A 1MZ9A 3L75D 3TYYA 1RE4C 1NU1J 2GUVA 1Q86Q 2LIWA 2JJLA 2I8DA 3CE7A 1JY2N 5AVXB 4DCKA 4EYYQ 1G1JA 1S3JA 3AE3C 5APQA 4IZ6A 1BE3G 3HE5A 3U59A 1HBWA 1OX3A 2E76B 2W8ZA 1L4AA 2B88A 2CNRA 3TGUD 1DNYA 1MZ8A 3CXHI 1VF5D 2JQ4A 2YMKA 1K9MQ 2R32A 2AF8A 1ZP0C 3GHGA 5KP8B 2YXQB 3T97A 1KQFB 1SQPJ 1GXGA 2XDJA 3P05A 1A8OA 2KZIA 2FVFA 1ACPA 4H0LC 1FU1A 2MY5A 3M91A 5K5GB 3L72E 3O6QB 3BASA 2PFXA 1BSHA 3Q1MA 3G71P 1DD3A 4A7PA 1NKZB 1NH4A 4WBAA 2BEQD 1GU4A 2PEQA 2H89C 4H0LD 4BRYB 2LXCB 1OW6A 5HV8A 4NPFX 1GW4A 2A45I 2P10A 3Q20A 3PTZA 1EDKA 2BCCD 5KAIH 3H1IE 3FWLA 2JKVA 1L0LD 3LRYA 1HWTC 2R3CA 2KLVA 2SPZA 2XNDH 3TNUB 3R4YA 1URQD 1GL2D 3L35A 2KR5A 3E7KA 1JMMA 2FYUK 1NTZE 4ZKUA 3V2RA 1RO0A 5KKZB 3OA7A 3NFQA 2M5RA 2N50A 1L4AC 3FX0A 1X79B 1LNQA 2N98A 2L4BA 2LL8A 2PNGA 3V2PA 1E6JP 1YTZI 4HYTB 2WPSA 3LIDA 1X8YA 1SQXG 1IK9A 3F89A 3CCVP 1J2JB 1QEXA 1L4AD 1P84I 3S1KA 1HJBA 2JU1A 4U3FE 2JBGA 2ITAA 2YO3A 3H1JJ 1JMBA 1K73Q 3WBHA 1QVGO 1ZLLA 4ZKPA 3CXCO 1N73A 3H1ID 4PV1C 1FZCB 3FXEA 2W6BA 3A5TA 1LT9A 3AE4C 2IBZG 2Q9IA 1VDFA 1A43A 1NTZD 5KLVD 3L71J 1PGQA 2YKOA 1KILB 2KSEA 4PV1D 1FBMA 4DZOA 2JR8A 2ZFCA 1L0NG 3OAKA 2VLOA 4IFFA 4TLFA 4AQRD 3G4SP 4O9BA 1JOCA 2JB0A 4MN4C 1JB0J 5B66H 2M8RA 4QNBA 3KZIE 1BDCA 1KQLA 3MIWA 4NPEA 3K5BA 4LC1A 2BEZF 2LKMA 3P8CD 4N78E 1GDTA 4W80A 3A0HE 4PJ0E 1M56D 1M1JC 3R2PA 2H88C 1U7JA 4COCA 1R5SA 3H25A 2KOPA 1PGPA 2GDYA 2KNCB 1QL2A 1CEIA 3RBZA 3Q5RA 3D6ZA 1M90Q 1FDOA 1RF1A 1OR5A 3H1HJ 3VP8A 3SFEC 1FJKA 1N73C 2XU6A 3VMYA 2O01N 4W7ZA 5HGLA 4NEOA 5CMZA 2YKQA 2KK7A 1LT9C 3M9QA 2PEJA 2CG5B 2P7JA 4N3YB 5C39A 1LWUB 3VMXA 2PEIA 3EJEA 2OYHA 2E1MA 1NTMG 1PEMA 1Y8AA 1NTMK 3P7KA 3V6IA 1KTMA 4WWIA 2FFDA 3P32A 1JY3O 1LTJA 2OQQA 1GK6A 1YBKA 3G1GA 4D6TD 4AUWA 1SQBG 2E74B 5KAFE 3RGUA 1PV3A 2L0QA 3VYIA 4PD4E 3HE4B 3V2NA 2GZFA 4HJGH 3KZIH 1IFMA 1VQPP 3AE2C 1N7SB 2FYUJ 2N9BA 1BAJA 3B5NA 2AXTE 1YJNP 2CPBA 3SFDC 4IFDK 1LJ2A 1EZVG 3A0HH 1BCCD 4PJ0H 3AE7C 5AVWB 2Z45A 2ZYAA 1VQKP 1IMQA 1FZAA 2VRSA 4WVZA 5AW7B 2AEFA 1RF1C 1E0HA
chains in the Genus database with same CATH topology
2EG5A 2EIAA 4XFZA 1RO0A 3G28A 5I4TG 2BQ1E 3DS2A 5JPAA 2QEXP 1Q86Q 3CCQP 2OARA 1QVFO 1M6NA 3H47A 5HGMA 4COCA 1KC8Q 2OTLP 3HYBA 1M6EX 2PEMA 2XV6A 4U0EA 4U0CA 3CCRP 1E6JP 3CC7P 5F2NA 5HGOA 3DS3A 3CCMP 3RG6C 4U0BA 1M90Q 4XROA 1N8RQ 4WYMA 3MGEA 2L6EA 2JYLA 2XXMA 5HGNA 3I55P 3CCVP 1VQMP 2PENA 1Q81Q 3CPWO 3H0DA 3G0VA 5HGLA 2QA4P 1M1KQ 2M8NA 1KQSO 4XFYA 1RO2A 3E2DA 2OTJP 2BUOA 1EOQA 2PEJA 3CMAP 1S72P 1ZMBA 4PH0A 2EFJA 1K73Q 3CD6P 1K9MQ 3CCJP 5BS1A 4IPYA 3CCUP 1VQ6P 3WBHA 2PEIA 3G26A 2Z44A 4M0IA 5BS2A 1QVGO 3CCLP 1PEUA 2E1MA 1Q82Q 3M1MA 3CXCO 1PEMA 5F2OA 4GR6A 1YI2P 3P05A 1VQ9P 1YITP 2PY8A 1VQ7P 1A8OA 3NTEA 2PEKA 1PEQA 1VQNP 2M8LA 4U0DA 4PH1A 1YIJP 2ONTA 1YHQP 1YJ9P 3G1GA 5F2KA 3DS4A 4GR2A 2LF4A 1KD1Q 1A43A 3DS0A 4XRQA 2KODA 3HZQA 3G71P 2CWOA 2P9XA 4XFXA 1VQLP 2Z46A 1Q7YQ 2PEQA 1YJWP 2JO0A 4U0AA 3DTJA 1EIAA 3DPHA 1AUMA 1D1DA 2JYGA 5DCKA 3G21A 3G1IA 2M8PA 1PEOA 1VQOP 3G4SP 1VQPP 3G6EP 3OW2O 1VQ4P 3DS5A 1BAJA 2BHVA 3CCSP 1VQ5P 3I56P 3CC4P 3Q20A 3VRLC 1RNIA 1VQ8P 4U0FA 3B5IA 4COPA 1YJNP 2DGYA 2PEOA 3DS1A 4QNBA 3LRYA 1NJIQ 1IUQA 1JJ2O 1K8AQ 2XT1A 2Z45A 3CC2P 3CCEP 1M74A 1VQKP 3CMEP 3G29A 1K30A 3H4EA 1W2BO 1QRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 Q;  1VQ9 P;  1YIT P;  1VQ7 P;  1VQO P;  3CPW O;  3I55 P;  1VQN P;  3G4S P;  1VQP P;  3G6E P;  3OW2 O;  1VQ4 P;  3CCS P;  3CC4 P;  1VQ5 P;  3I56 P;  2QEX P;  1Q86 Q;  2QA4 P;  3CCQ P;  1YIJ P;  1M1K Q;  1QVF O;  1KQS O;  1YHQ P;  1YJ9 P;  1W2B O;  1VQ8 P;  1KC8 Q;  1YJN P;  2OTJ P;  1KD1 Q;  3CMA P;  1S72 P;  3CCR P;  1NJI Q;  3CC7 P;  3G71 P;  3CCM P;  1JJ2 O;  3CD6 P;  1K73 Q;  1K8A Q;  1M90 Q;  1N8R Q;  1K9M Q;  3CCJ P;  1VQL P;  3CCU P;  1Q7Y Q;  3CC2 P;  1VQ6 P;  3CCE P;  1VQK P;  3CME P;  1YJW P;  1QVG O;  3CCL P;  1Q82 Q;  2OTL P;  3CXC O;  3CCV P;  1VQM P;  1YI2 P; 
#chains in the Genus database with same CATH topology
 1G2C B;  3H1H E;  4XFZ A;  1JY2 O;  2WSE H;  3Q5P A;  2NZ2 A;  3H47 A;  1SQQ D;  1USD A;  3N4X A;  3CCR P;  3WU2 E;  1PGJ A;  1NGM B;  1L0L K;  4ASW A;  3VMZ A;  1GD2 E;  3V2Q A;  2OYH C;  1K04 A;  2GYK A;  3MTU E;  2N1T A;  2Q3E A;  4PD4 D;  1M1K Q;  2FQ1 A;  2K9Y A;  2JWA A;  1LTJ C;  2DW3 A;  2OTJ P;  2R5D A;  4I1L A;  3CMA P;  1RHZ B;  1BE3 D;  3U1A A;  1A02 F;  4IPY A;  2Q7C A;  2L91 A;  1AQ5 A;  2PY8 A;  5GTI E;  1NU1 G;  5KAF H;  1NU1 K;  1VQN P;  4PD4 H;  4C7N B;  2Q1K A;  3B5N C;  2O01 J;  3DS4 A;  2FYZ A;  4JYC A;  1KB9 E;  1T3J A;  2QE7 H;  3BVH A;  1AUM A;  2AXT H;  4YXW H;  3L74 D;  1SQX E;  3BCC J;  3B5N D;  3B4Q A;  3AE6 C;  1RNI A;  2KGA A;  4IL6 H;  2E75 C;  2ZJS E;  2W6J H;  1SQV D;  1T6A A;  3KXD A;  4JBZ A;  2GM4 A;  3HTK B;  1SQP G;  1IJD B;  1SQP K;  4I7Z B;  2K37 A;  4TT3 H;  2QSI A;  3M0A A;  2MR7 A;  3GG2 A;  3FWN A;  3HRN A;  1KFM A;  3WU2 H;  1ZXG A;  2QEX P;  4H13 B;  1MV8 A;  3CCQ P;  2N1T C;  4EDF A;  3TDK A;  4LLH A;  3N7N A;  1GW3 A;  2E43 A;  3CCM P;  1M57 D;  4GOF A;  4ZNC A;  2D2C B;  3AEC C;  3AE5 C;  2N6Y A;  1Q81 Q;  2N1T D;  1KQG B;  1L0H A;  1PPJ E;  2KWL A;  1L0N E;  5DJU B;  4OVN F;  2ZT9 C;  1SFC A;  1KYO E;  3TGU J;  1H8A A;  2K9J B;  3HUS B;  5GTI H;  3CD6 P;  3KPE A;  2NRG A;  3TK1 A;  1PEU A;  4I6M C;  2ZVO B;  3M1M A;  4B86 A;  3D6Y A;  2ZT9 D;  1PEQ A;  1E79 H;  1KB9 H;  4WY4 B;  2B9B A;  2N5I A;  2ONT A;  5B5E H;  2W27 A;  3BCC E;  5F2K A;  3KDP B;  1JM0 A;  2ZXE B;  3L4F A;  3M0D A;  2JYG A;  2FXO A;  2O1K A;  4C46 A;  1S9K D;  1JCD A;  5M1B A;  3CC4 P;  2IBZ D;  3B8E B;  2QM8 A;  1LP1 B;  3H32 A;  4YPC A;  2DGY A;  2KOO A;  3H1J G;  2KYV A;  3O8Z A;  1HJ0 A;  2BCC J;  3H1K D;  2JWD A;  5AVU B;  1L0L J;  1M74 A;  2GUS A;  1A02 J;  2B87 B;  2CPS A;  2M5A A;  2FBW C;  3PLN A;  1NTM E;  5APV A;  2WT7 B;  3KQG A;  3RK2 B;  2W83 C;  1GTW A;  1SFC C;  2HPC B;  1NOH A;  3L71 G;  3AEA C;  4RJT A;  1T3U A;  1SQB E;  2AEM A;  3IF4 A;  4PD4 I;  3CPW O;  2QJK B;  1S1C X;  1SFC D;  1VPC A;  1MKM A;  2M8N A;  1MUU A;  3H6P A;  1EOQ A;  4BPH A;  2MF4 A;  5CCG C;  1QGK B;  2ROQ A;  3BRV B;  2KW2 A;  4K3A A;  4M0I A;  1EDL A;  2C9L Y;  2FYN B;  5KKZ C;  1EZV E;  2K0X A;  3M0D C;  3NTE A;  5BVZ A;  1DEE G;  4XE5 B;  5AVZ B;  1ZME C;  1HTL C;  1N2D C;  2IZ1 A;  5CCG D;  3C9I A;  1RH5 B;  4GR2 A;  5KJ7 A;  3Q2Y A;  2J58 A;  2KS1 A;  2W6A A;  3H1H G;  3U43 A;  1KIL E;  5KLV J;  1BDD A;  2K0D X;  2PRR A;  2KG9 A;  3EFG A;  1JTH A;  4GKG A;  2H8P D;  2QRX A;  2ZYG A;  2HFE D;  3JCU E;  2IYP A;  3CWB D;  5AW2 B;  1CW5 A;  4Y99 B;  1BGY J;  1ZW0 A;  2NPS B;  3D70 A;  3M9H A;  4M3L A;  1M7L A;  4R4L A;  2OYI B;  4IFM A;  5JPA A;  2ZVN B;  1LWU A;  2WSS H;  5HGM A;  1NU1 E;  2WSF J;  5CBN A;  4K35 A;  2PEM A;  1EZV D;  4H44 B;  2R5B A;  3CC7 P;  3LW5 H;  3DS3 A;  3RG6 C;  4H2X C;  3L36 A;  1KB9 I;  3I55 P;  1H0T B;  2KXP B;  2GDW A;  4W7Y A;  2XNX A;  2FYU G;  1NTK K;  4CA3 A;  4GOD A;  4R4M A;  1FAV A;  5L8R J;  5KJ7 C;  3WMM 0;  1PP9 J;  1N7S A;  2UWJ E;  3L72 D;  1UNK A;  1NWQ A;  2K3R A;  3FXD A;  1QX8 A;  1VF5 B;  1M1J A;  1SQP E;  1S5L X;  4PH1 A;  5KJ7 D;  1KOR A;  2A06 G;  2CWO A;  2P9X A;  4D6T J;  1HQB A;  3RL0 B;  3SWY A;  2IX7 C;  1OZH A;  3MHV A;  1PFI A;  3SWK A;  2JO0 A;  1G1I A;  1XTC C;  4U7J A;  3JCU H;  2FVE A;  2IBZ I;  3E1I A;  3GF7 A;  2WSC H;  1LWU C;  2QG4 A;  1OMI A;  1OWA A;  1IUQ A;  1JJ2 O;  1KYO I;  2M3B A;  2OTK E;  1K8A Q;  2XT1 A;  5BU5 A;  4ASV A;  2R3S A;  4JQ0 D;  1PPJ G;  1PZQ A;  5AVS B;  1BCC J;  1KV4 A;  2HG5 D;  4DG9 A;  1URQ B;  1GPJ A;  1GL2 B;  2LKI A;  2JEE A;  3G3Z A;  2E74 C;  2JP3 A;  1IFJ A;  1PIX A;  2H43 A;  5AVT B;  5AW4 B;  1IFP A;  1T2K C;  1LT1 A;  1SQQ J;  4Y28 J;  4XRO A;  3KYQ A;  1Z56 A;  2K92 A;  2IPP A;  3TSI A;  2V7Q J;  1LTA C;  4U3F D;  1VKU A;  1N7S C;  1XTG B;  4C7N A;  2RN0 A;  2E74 D;  3VP9 A;  3BCC G;  3HE5 B;  2AFD A;  2LOL A;  2K88 A;  1Z6M A;  3A7O A;  1CZQ A;  4EI2 A;  1HY8 A;  3WUV A;  3BAT A;  2DNW A;  1N7S D;  5AW1 B;  3ZDM A;  2G8Y A;  2HLO A;  3H1J E;  5F2O A;  3PHL A;  3GHG B;  3E1R A;  2VLN A;  3T97 B;  2R44 A;  1YIJ P;  3V5B A;  4PXH B;  3CX5 E;  3H1L J;  3G9R A;  1QLE D;  1Y47 A;  1VQL P;  5AVY B;  3L71 E;  3RG2 A;  4DOJ A;  5DCK A;  2IDB A;  5APX A;  3NMD A;  1R8E A;  1OVR A;  2FXP A;  1FZF A;  3L73 J;  2O3J A;  3L74 J;  4N78 D;  3B5I A;  3TGU G;  3USS A;  2GZJ A;  2JGP A;  2KP8 A;  2XZ0 D;  2OYO A;  4L73 A;  1SQV J;  3G29 A;  1W2B O;  2NO8 A;  2P58 A;  2KIK A;  1EC5 A;  5I4T G;  2K9J A;  2HOD A;  1EZV I;  1NTK J;  2KI7 B;  4U0C A;  2IYO A;  5GTH E;  1L0I A;  5F2N A;  5HGO A;  5AVR B;  1FS0 E;  5CBO A;  1UIX A;  2WTY A;  2XXM A;  2E5T A;  1DD4 A;  1X3O A;  3G0V A;  3BRT B;  2BCC G;  2N9Y B;  1HF9 A;  1L0L G;  2MD9 A;  1JCC A;  3CCU P;  1VQ6 P;  3H1L E;  2Y0E A;  1KZU B;  2WPR A;  1OFC X;  2WWW A;  4GR6 A;  3L70 J;  1HH0 A;  1VQ9 P;  1VQ7 P;  2L5G B;  2MKV A;  3CX5 H;  1CI6 A;  2C0W A;  1N73 B;  4YTP C;  1YJ9 P;  1ZR4 A;  3VTP C;  2BAS A;  2LF4 A;  1L2P A;  2D2C C;  1LT9 B;  1NAF A;  2Z46 A;  2KG8 A;  4YXD C;  5AW8 B;  1EMV A;  1ZR2 A;  4JPZ B;  1J1E B;  2YIU B;  5E79 E;  1VQO P;  3CCS P;  2BHV A;  3M9B A;  2KGE A;  2LTE A;  1IFI A;  2KB7 P;  2XV5 A;  1WRG A;  3GW6 A;  2AFE A;  2FYU E;  1NKN A;  3WUT A;  1NTK E;  3H1H D;  1CSB A;  3NTN A;  4R0M A;  2WIT A;  3H1K J;  2OTL P;  3IR9 A;  1X0T A;  2EIA A;  5GTH H;  3KHU A;  1M6N A;  2LML A;  2FHS C;  2K93 A;  2V4H A;  1ZRT E;  1NTZ K;  5KLV G;  5KLV K;  2VLQ A;  2A06 E;  3VMA A;  2KOS A;  1YTZ T;  5HVC A;  1FDI A;  1RF1 B;  1ZOY C;  3L75 J;  3W67 A;  1VL2 A;  3IAO A;  5H2F E;  2E75 D;  2N6Z A;  1YQ3 C;  4L75 A;  2LPK A;  5AW9 B;  2FAD A;  3A0B E;  1JEK A;  3CCJ P;  1BGY G;  1P84 E;  3RK3 B;  3V4Q A;  2Q5U A;  2JO1 A;  1LTI C;  2RH0 A;  1JO5 A;  4OWF A;  2KZJ A;  3O6Q A;  1KB9 D;  2JU2 A;  1J1D C;  3AE1 C;  3MZW B;  1SS1 A;  2QJP B;  2FFD B;  1FC2 C;  5AW5 B;  1LTJ B;  2YMY A;  4BRY A;  1SQX D;  2K94 A;  2I1J A;  5E79 H;  3SSU A;  2GZG A;  4Z1M H;  2OGU A;  2OYI A;  1U57 A;  4U0A A;  3DTJ A;  2QJK C;  2QJY B;  1AVY A;  1KMI Z;  1FJP A;  1JY3 P;  3TNU A;  1NYH A;  3DS1 A;  1AQT A;  2POH A;  5CCG A;  1TU3 F;  1NJI Q;  3B5N B;  3EJD A;  3CWB J;  2FYN C;  1PP9 G;  4EIJ A;  3CC2 P;  2PGD A;  3CCE P;  3CME P;  3SWF A;  2E76 C;  1BXI A;  4UHP B;  1PL5 A;  1OVV A;  2IZ0 A;  2GZI A;  2FVA A;  2P2U A;  1AFO A;  2KG6 A;  2EHT A;  1AYI A;  2N5H A;  3L75 E;  2M3E A;  4D6T G;  3NXS A;  2E76 D;  1PPJ D;  1L0N D;  2L9F A;  3IN6 A;  2WPQ A;  1KYO D;  2YO2 A;  3CX5 I;  5H2F H;  2PEN A;  3L37 A;  1Q90 D;  2J59 M;  4KHX A;  3H0D A;  3RBX A;  1JY3 N;  3LIE A;  1JY2 P;  1RE3 A;  4Y99 C;  1RO2 A;  5KLI B;  2N1T B;  2BUO A;  3V4W A;  3AE9 C;  4UB8 E;  1LTB C;  3C1L A;  5DJT B;  2C0X A;  3AED C;  1FZC A;  4OGQ B;  2K1A A;  3TGU E;  5TIS E;  2XZR A;  1BCC G;  3BCC D;  1PGO A;  2OYI C;  1KYO H;  3C8V A;  3L72 J;  1U7M A;  1FZE A;  2M8L A;  1DX7 A;  2O01 H;  4H44 C;  3ABV C;  4HKZ H;  4QMA A;  4XA4 A;  1KIL A;  2KGC A;  3DS0 A;  5KTB A;  3HZQ A;  1SQQ G;  1SQQ K;  1GXH A;  5KAI E;  5CCH C;  5CHX A;  1LTS C;  2FAC A;  3G1I A;  1H88 A;  4H44 D;  3DS5 A;  1VQ5 P;  3H1I J;  3VN0 A;  2WMM A;  3VRL C;  1QL1 A;  2E5Y A;  1RY3 A;  1JUN A;  1AV1 A;  3ITK A;  4N6J A;  4DT0 A;  3AEG C;  1OVU A;  5CCH D;  2WPT A;  4RO0 A;  1NTM D;  1IZN B;  1NTZ J;  1VF5 C;  2BCC E;  3GZM A;  4EOT A;  1L0L E;  1KFN A;  2O1J A;  2KNC A;  2J5U A;  2BQ1 E;  1LTT C;  1SQB D;  2KLU A;  3RL0 C;  1Y9B A;  1RE3 C;  3H1L G;  3HD7 B;  4U0B A;  4WYM A;  3MGE A;  1FZC C;  2AVA A;  4UB8 H;  4U3F J;  3L73 G;  3L74 G;  3RL0 D;  3S4R A;  5TIS H;  3E2D A;  4BPG A;  1OIP A;  2GZE A;  1KIL C;  4PH0 A;  1VHN A;  2K2Q A;  1SFC B;  1K05 A;  4I2L C;  1SQV G;  1SQV K;  1URQ C;  3MD0 A;  1GL2 C;  1FR2 A;  1YIT P;  3U1C A;  2JDI H;  2K5X A;  1NTK G;  3MUD A;  1KIL D;  1NVO A;  4IL6 X;  3MGN A;  3HE4 A;  2KOR A;  4BWN A;  3QH9 A;  1IC2 A;  2A45 G;  1ZNV A;  2QNW A;  5AVV B;  5B66 E;  3OJA B;  2E42 A;  4AYC A;  1EXI A;  2LXB A;  3G21 A;  1LGH B;  1PEO A;  1SLQ A;  5KLV E;  4PWV B;  3OW2 O;  3W68 A;  2AXC A;  5APT A;  2K0Y A;  5KP6 B;  1G2C A;  3H32 B;  1SQX K;  1MFT A;  3GMA A;  2RKL A;  3GHG C;  2AEJ A;  5TJH A;  1K30 A;  1NU1 D;  1S4X A;  3L70 G;  3A3Y B;  1BGY E;  3Q5S A;  3DS2 A;  1EQ7 A;  1D7M A;  1ZV8 A;  2PP6 A;  3P8C E;  4L76 A;  4H0L B;  3AEB C;  1FOS F;  2M5A B;  3HYB A;  2WSE J;  2L22 A;  4U0E A;  2HR3 A;  2Y0C A;  1E5W A;  5AW6 B;  5EW5 E;  2QM7 A;  4QKO A;  3PH0 A;  1W5C E;  3CL3 D;  1BSN A;  5AW0 B;  3WUU A;  3II6 A;  2JAZ A;  3IFM A;  4GDO A;  2KOQ A;  4MRT C;  3MUD C;  1UJZ A;  2Q6Q A;  4H2Y C;  1SQP D;  3H1K G;  1SVF A;  1L0N K;  1Q82 Q;  4JYB A;  2WPV B;  4UB6 E;  1PP9 E;  1FE6 A;  2H7H A;  1T2K D;  1EXJ A;  4RES B;  1OW8 A;  1BGY D;  4XRQ A;  1L4A B;  1OXZ A;  3B4S A;  1YJW P;  4HB1 A;  1BE3 J;  1OW7 A;  4D6T E;  1FZG A;  2KS1 B;  2M8P A;  2Z5H A;  1YQ4 C;  1DV5 A;  3I56 P;  3L75 G;  2P1J A;  1N7L A;  1DH3 A;  1JTH B;  1VQ8 P;  5APU A;  3HTK A;  1AF8 A;  2MVU A;  2Z5I A;  7CEI A;  1W2E A;  3P8M C;  4NPD A;  2YNY A;  2EG5 A;  2PAJ A;  2KGD A;  1BCC E;  2WSF H;  4PV1 B;  2ZYD A;  1QVF O;  3CLQ A;  1KC8 Q;  4OH8 B;  1YYC A;  2CK3 H;  1M6E X;  5KP7 B;  1IFD A;  4H2W C;  5EFW B;  1PP9 D;  3S9O A;  4DJG A;  1N8R Q;  1J1E C;  2YIU C;  5HGN A;  1UII A;  1SQQ E;  4HKG A;  5CJ4 A;  5APS A;  3EFF K;  4JF7 A;  1AJY A;  3HUS A;  2EHS A;  2HYN A;  3A2A A;  2KSJ A;  2IFN A;  3H1J D;  1SQB K;  4UB6 H;  1ZMB A;  3CWB G;  1X22 A;  1EDJ A;  5BS1 A;  3CI9 A;  3RK3 E;  4WY4 A;  5CJ0 A;  2M0B A;  2GA1 A;  2GDX A;  1BE3 E;  3CX5 D;  2MVV A;  4U0D A;  3PJS K;  5AW3 B;  3L71 D;  1M1J B;  3FGA D;  1KN7 A;  2FY8 A;  1DIP A;  2YKP A;  3F5H A;  4XFX A;  4I7Z C;  1AA0 A;  1Q7Y Q;  2ZXX A;  4IL6 E;  1SQX J;  1M8O B;  1EIA A;  3DPH A;  1N86 A;  2I1K A;  2C9N Y;  1LP1 A;  4H13 C;  1EDI A;  1VQ4 P;  2VLP A;  2Y9Y A;  1GZL A;  3CXH E;  1GK4 A;  2VSQ A;  3GZL A;  3LMO A;  4GIF A;  2PEO A;  4XFJ A;  2MR8 A;  3L73 E;  3L74 E;  1LTG C;  3RK3 C;  2LR2 A;  1S5L E;  2B87 A;  4H13 D;  4L74 A;  3H4E A;  2MJZ A;  2WT7 A;  3L72 G;  1SQV E;  2HPC A;  2P67 A;  3G28 A;  1FZB A;  2QJP C;  2FFD C;  4GOE A;  3D71 A;  1GU5 A;  3AE8 C;  3RK3 D;  1RQV A;  2D2C D;  3HUS C;  1MFZ A;  1IO4 A;  2FQ2 A;  4GT1 A;  1HUC A;  2V7Q H;  2QJY C;  2L6E A;  2XKM A;  3EJB A;  1L0N J;  1VQM P;  4WY4 C;  2WVR A;  3H1I G;  2KUB A;  4RKU J;  2FAE A;  3H1L D;  3GLM A;  1AVO A;  5B5E E;  4IOI H;  3CXH D;  1FDM A;  1NTZ G;  1QRJ A;  4WY4 D;  2Z44 A;  5BS2 A;  1FOS E;  1NQ4 A;  1USE A;  3PRJ A;  1KLP A;  3L73 D;  1IMP A;  2FQ0 A;  2Y0D A;  2XZ1 C;  2CGQ A;  2X2B A;  3L70 E;  4F37 A;  2Y9Z A;  2RMZ A;  5APW A;  1KD1 Q;  3M06 A;  3GJN A;  3TF5 A;  2QIW A;  1RF0 A;  3CXH H;  5CZD B;  2FYU D;  4U3F G;  1NTK D;  5BU8 B;  3HD7 A;  5KLI C;  3RK2 C;  4HH2 A;  1S5L H;  3EQ2 A;  2OYH B;  3EWK A;  4LGD E;  4OGQ C;  2KOG A;  2NPS A;  2FKW B;  1GMJ A;  2YXR B;  1S9K E;  1X9V A;  1T8Z A;  2IBZ E;  5APY A;  3JSV C;  2Q3I A;  3GKL C;  3Q3D A;  3RK2 D;  1T8K A;  1NTM J;  1IFN A;  1HVV A;  3H1K E;  2W90 A;  1WMK A;  1NAY A;  2LIU A;  1ZRT D;  4OGQ D;  1F80 D;  2OAR A;  3JC2 2;  1Q2N A;  2G3A A;  2A06 D;  2WQY C;  2XV6 A;  2A45 H;  4ZMD A;  4BPF A;  1NHL A;  1SQB J;  2ERH A;  2HOD B;  1H0T A;  1ZN5 A;  3L70 D;  3LW5 J;  5CCH A;  2JYL A;  1RE4 A;  3NY7 B;  2QA4 P;  1HGZ A;  1KQS O;  1P84 D;  4XFY A;  4KT0 J;  3QWO C;  4BXL A;  1S72 P;  3AEF C;  2EFJ A;  5AVQ B;  2QVA A;  4CPG A;  2E75 B;  3G26 A;  3CCL P;  3B71 A;  1R5L A;  1HGV A;  1RF0 C;  1NO4 A;  1YI2 P;  3RL0 g;  2FXM A;  1WT6 A;  2PEK A;  4WB4 A;  3A0B H;  3HD7 C;  1YHQ P;  3VOP A;  1P84 H;  1SP4 A;  3I5C A;  2ZAE B;  1JNM A;  2KOD A;  1CI6 B;  2NPS C;  1DEB A;  3UIA A;  3GF3 A;  1D1D A;  2B89 A;  3PP5 A;  3HD7 D;  3G6E P;  3MP7 B;  1J1D B;  2IFM A;  4U0F A;  2WZ7 A;  2CQ8 A;  4COP A;  5EJD A;  2NPS D;  2WSC J;  4KJM A;  2ZT9 B;  1S2E A;  3AEE C;  4C7R A;  1RQU A;  1URQ A;  1H89 A;  2Z4E A;  1GL2 A;  3CWB E;  1IK7 A;  1MZ9 A;  3L75 D;  3TYY A;  1RE4 C;  1NU1 J;  2GUV A;  1Q86 Q;  2LIW A;  2JJL A;  2I8D A;  3CE7 A;  1JY2 N;  5AVX B;  4DCK A;  4EYY Q;  1G1J A;  1S3J A;  3AE3 C;  5APQ A;  4IZ6 A;  1BE3 G;  3HE5 A;  3U59 A;  1HBW A;  1OX3 A;  2E76 B;  2W8Z A;  1L4A A;  2B88 A;  2CNR A;  3TGU D;  1DNY A;  1MZ8 A;  3CXH I;  1VF5 D;  2JQ4 A;  2YMK A;  1K9M Q;  2R32 A;  2AF8 A;  1ZP0 C;  3GHG A;  5KP8 B;  2YXQ B;  3T97 A;  1KQF B;  1SQP J;  1GXG A;  2XDJ A;  3P05 A;  1A8O A;  2KZI A;  2FVF A;  1ACP A;  4H0L C;  1FU1 A;  2MY5 A;  3M91 A;  5K5G B;  3L72 E;  3O6Q B;  3BAS A;  2PFX A;  1BSH A;  3Q1M A;  3G71 P;  1DD3 A;  4A7P A;  1NKZ B;  1NH4 A;  4WBA A;  2BEQ D;  1GU4 A;  2PEQ A;  2H89 C;  4H0L D;  4BRY B;  2LXC B;  1OW6 A;  5HV8 A;  4NPF X;  1GW4 A;  2A45 I;  2P10 A;  3Q20 A;  3PTZ A;  1EDK A;  2BCC D;  5KAI H;  3H1I E;  3FWL A;  2JKV A;  1L0L D;  3LRY A;  1HWT C;  2R3C A;  2KLV A;  2SPZ A;  2XND H;  3TNU B;  3R4Y A;  1URQ D;  1GL2 D;  3L35 A;  2KR5 A;  3E7K A;  1JMM A;  2FYU K;  1NTZ E;  4ZKU A;  3V2R A;  1RO0 A;  5KKZ B;  3OA7 A;  3NFQ A;  2M5R A;  2N50 A;  1L4A C;  3FX0 A;  1X79 B;  1LNQ A;  2N98 A;  2L4B A;  2LL8 A;  2PNG A;  3V2P A;  1E6J P;  1YTZ I;  4HYT B;  2WPS A;  3LID A;  1X8Y A;  1SQX G;  1IK9 A;  3F89 A;  3CCV P;  1J2J B;  1QEX A;  1L4A D;  1P84 I;  3S1K A;  1HJB A;  2JU1 A;  4U3F E;  2JBG A;  2ITA A;  2YO3 A;  3H1J J;  1JMB A;  1K73 Q;  3WBH A;  1QVG O;  1ZLL A;  4ZKP A;  3CXC O;  1N73 A;  3H1I D;  4PV1 C;  1FZC B;  3FXE A;  2W6B A;  3A5T A;  1LT9 A;  3AE4 C;  2IBZ G;  2Q9I A;  1VDF A;  1A43 A;  1NTZ D;  5KLV D;  3L71 J;  1PGQ A;  2YKO A;  1KIL B;  2KSE A;  4PV1 D;  1FBM A;  4DZO A;  2JR8 A;  2ZFC A;  1L0N G;  3OAK A;  2VLO A;  4IFF A;  4TLF A;  4AQR D;  3G4S P;  4O9B A;  1JOC A;  2JB0 A;  4MN4 C;  1JB0 J;  5B66 H;  2M8R A;  4QNB A;  3KZI E;  1BDC A;  1KQL A;  3MIW A;  4NPE A;  3K5B A;  4LC1 A;  2BEZ F;  2LKM A;  3P8C D;  4N78 E;  1GDT A;  4W80 A;  3A0H E;  4PJ0 E;  1M56 D;  1M1J C;  3R2P A;  2H88 C;  1U7J A;  4COC A;  1R5S A;  3H25 A;  2KOP A;  1PGP A;  2GDY A;  2KNC B;  1QL2 A;  1CEI A;  3RBZ A;  3Q5R A;  3D6Z A;  1M90 Q;  1FDO A;  1RF1 A;  1OR5 A;  3H1H J;  3VP8 A;  3SFE C;  1FJK A;  1N73 C;  2XU6 A;  3VMY A;  2O01 N;  4W7Z A;  5HGL A;  4NEO A;  5CMZ A;  2YKQ A;  2KK7 A;  1LT9 C;  3M9Q A;  2PEJ A;  2CG5 B;  2P7J A;  4N3Y B;  5C39 A;  1LWU B;  3VMX A;  2PEI A;  3EJE A;  2OYH A;  2E1M A;  1NTM G;  1PEM A;  1Y8A A;  1NTM K;  3P7K A;  3V6I A;  1KTM A;  4WWI A;  2FFD A;  3P32 A;  1JY3 O;  1LTJ A;  2OQQ A;  1GK6 A;  1YBK A;  3G1G A;  4D6T D;  4AUW A;  1SQB G;  2E74 B;  5KAF E;  3RGU A;  1PV3 A;  2L0Q A;  3VYI A;  4PD4 E;  3HE4 B;  3V2N A;  2GZF A;  4HJG H;  3KZI H;  1IFM A;  1VQP P;  3AE2 C;  1N7S B;  2FYU J;  2N9B A;  1BAJ A;  3B5N A;  2AXT E;  1YJN P;  2CPB A;  3SFD C;  4IFD K;  1LJ2 A;  1EZV G;  3A0H H;  1BCC D;  4PJ0 H;  3AE7 C;  5AVW B;  2Z45 A;  2ZYA A;  1VQK P;  1IMQ A;  1FZA A;  2VRS A;  4WVZ A;  5AW7 B;  2AEF A;  1RF1 C;  1E0H A; 
#chains in the Genus database with same CATH homology
 2EG5 A;  2EIA A;  4XFZ A;  1RO0 A;  3G28 A;  5I4T G;  2BQ1 E;  3DS2 A;  5JPA A;  2QEX P;  1Q86 Q;  3CCQ P;  2OAR A;  1QVF O;  1M6N A;  3H47 A;  5HGM A;  4COC A;  1KC8 Q;  2OTL P;  3HYB A;  1M6E X;  2PEM A;  2XV6 A;  4U0E A;  4U0C A;  3CCR P;  1E6J P;  3CC7 P;  5F2N A;  5HGO A;  3DS3 A;  3CCM P;  3RG6 C;  4U0B A;  1M90 Q;  4XRO A;  1N8R Q;  4WYM A;  3MGE A;  2L6E A;  2JYL A;  2XXM A;  5HGN A;  3I55 P;  3CCV P;  1VQM P;  2PEN A;  1Q81 Q;  3CPW O;  3H0D A;  3G0V A;  5HGL A;  2QA4 P;  1M1K Q;  2M8N A;  1KQS O;  4XFY A;  1RO2 A;  3E2D A;  2OTJ P;  2BUO A;  1EOQ A;  2PEJ A;  3CMA P;  1S72 P;  1ZMB A;  4PH0 A;  2EFJ A;  1K73 Q;  3CD6 P;  1K9M Q;  3CCJ P;  5BS1 A;  4IPY A;  3CCU P;  1VQ6 P;  3WBH A;  2PEI A;  3G26 A;  2Z44 A;  4M0I A;  5BS2 A;  1QVG O;  3CCL P;  1PEU A;  2E1M A;  1Q82 Q;  3M1M A;  3CXC O;  1PEM A;  5F2O A;  4GR6 A;  1YI2 P;  3P05 A;  1VQ9 P;  1YIT P;  2PY8 A;  1VQ7 P;  1A8O A;  3NTE A;  2PEK A;  1PEQ A;  1VQN P;  2M8L A;  4U0D A;  4PH1 A;  1YIJ P;  2ONT A;  1YHQ P;  1YJ9 P;  3G1G A;  5F2K A;  3DS4 A;  4GR2 A;  2LF4 A;  1KD1 Q;  1A43 A;  3DS0 A;  4XRQ A;  2KOD A;  3HZQ A;  3G71 P;  2CWO A;  2P9X A;  4XFX A;  1VQL P;  2Z46 A;  1Q7Y Q;  2PEQ A;  1YJW P;  2JO0 A;  4U0A A;  3DTJ A;  1EIA A;  3DPH A;  1AUM A;  1D1D A;  2JYG A;  5DCK A;  3G21 A;  3G1I A;  2M8P A;  1PEO A;  1VQO P;  3G4S P;  1VQP P;  3G6E P;  3OW2 O;  1VQ4 P;  3DS5 A;  1BAJ A;  2BHV A;  3CCS P;  1VQ5 P;  3I56 P;  3CC4 P;  3Q20 A;  3VRL C;  1RNI A;  1VQ8 P;  4U0F A;  3B5I A;  4COP A;  1YJN P;  2DGY A;  2PEO A;  3DS1 A;  4QNB A;  3LRY A;  1NJI Q;  1IUQ A;  1JJ2 O;  1K8A Q;  2XT1 A;  2Z45 A;  3CC2 P;  3CCE P;  1M74 A;  1VQK P;  3CME P;  3G29 A;  1K30 A;  3H4E A;  1W2B O;  1QRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...