1KQSO

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1kqsO02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1kqsO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1kqsO03
3CXCO 3CCSP 1KQSO 1YI2P 1M1KQ 1VQKP 3G71P 1YIJP 2OTJP 3CCRP 1JJ2O 3CCEP 3CMEP 1S72P 1VQ9P 3G6EP 1N8RQ 1Q7YQ 3CMAP 1VQ6P 3CCUP 2OTLP 1YHQP 1W2BO 3CC4P 3OW2O 1KD1Q 1VQ4P 1VQ7P 1QVFO 3CCVP 1QVGO 1K73Q 1VQ8P 3CD6P 2QEXP 1VQPP 1Q81Q 3I55P 3CCMP 3CPWO 3CCJP 1VQ5P 1VQMP 1YJNP 3CCQP 1YITP 1VQOP 3I56P 3CC7P 1YJWP 3G4SP 2QA4P 1VQLP 1M90Q 3CC2P 1K8AQ 1VQNP 3CCLP 1NJIQ 1YJ9P 1K9MQ 1Q82Q 1Q86Q 1KC8Q
chains in the Genus database with same CATH superfamily
3L71D 2O1JA 1FOSF 5CJ4A 2FAEA 1H88A 3H25A 1QEXA 5E79E 4L75A 1X3OA 1URQD 1LTSC 4H0LC 4ZMDA 1NWQA 1JMMA 1KYOE 3H1LJ 2L6EA 3PHLA 2KGAA 2M8LA 3IFMA 1VQNP 1Y47A 4C46A 1Q86Q 3CWBJ 4AYCA 1ZR2A 1KILE 2ZVNB 4WY4D 5CCGA 2QJYB 2LXCB 2C9LY 2N50A 3GKLC 3BRVB 2Y0EA 2JWAA 1S9KD 3HE4B 1H89A 1NTZE 1EZVI 1BSNA 1AVOA 3HE4A 1GL2B 4PJ0H 1SQBD 4DT0A 1PEQA 1EDIA 1FZCC 1BE3D 1GL2A 2M8RA 1LTJB 2KB7P 2JU2A 1G2CA 2LL8A 1FAVA 5TJHA 1SQBK 3EFFK 2R44A 1PV3A 2ZYGA 3V6IA 1FBMA 5AVXB 1UIIA 5AW2B 1SQQG 2VLNA 3G0VA 2KOQA 2KR5A 1J1EC 1SQVG 2IZ1A 1KILC 2WZ7A 1N73C 4IZ6A 4N78D 3VMXA 1X22A 3H1KD 1N7LA 5AVTB 2M8PA 2H88C 2LR2A 1OW7A 4N3YB 4H13B 2WSEJ 4HKGA 2N9YB 2RKLA 1SQPK 3CMEP 3L74J 2M0BA 5AW8B 2FXPA 1XTGB 1HUCA 2R5DA 1LJ2A 1ZP0C 4LLHA 3T97B 3Q3DA 3GHGB 3HUSC 3M06A 2O1KA 4EOTA 2P9XA 2VLPA 5APTA 2G8YA 3GHGA 1H0TB 2POHA 1PP9D 1YTZI 2P58A 4D6TJ 2N1TB 3E7KA 5HGLA 3LRYA 4O9BA 3L72J 5K5GB 3RL0C 5KKZB 2LIWA 3RK2D 2N1TA 1L0NJ 2KOPA 1NTMJ 3SFDC 5B66H 3B8EB 1HQBA 1YJ9P 1BDCA 2Y0DA 3P32A 3B5NC 1K05A 4IL6X 2YKQA 3AE9C 3CMAP 2H43A 2OTLP 2JB0A 1E5WA 5CCGC 3VP9A 2FYUD 1LT9B 1KFMA 3CL3D 4A7PA 1VQOP 2QJYC 5CBOA 4H0LD 3CC7P 1K8AQ 2WPVB 3CXHH 2BQ1E 1GU4A 2N5IA 3OJAB 1FDMA 2FYUK 3CXHI 1W2BO 1PIXA 1RO0A 2J59M 1D7MA 4ZNCA 2WITA 1GL2C 1P84E 2E42A 2VLOA 3WBHA 5DJTB 5KLVD 1KV4A 4EDFA 3KDPB 5KLVK 3B4SA 3E1RA 1USEA 2K5XA 3AE7C 2HLOA 3L73G 4JYBA 2GDWA 1SQQE 2FXOA 2IYOA 1USDA 3VMZA 1SQVE 2ONTA 1T8ZA 2WSCH 1JOCA 5HGMA 1KYOD 2KS1B 2AEMA 4BPGA 1Q7YQ 4UB6E 5AVYB 2WSSH 2GYKA 3AEDC 4H13C 1KILD 3VTPC 1HH0A 2FFDC 2LOLA 2XT1A 1SFCA 2XKMA 1IFJA 3L71J 4R0MA 4OGQD 2LXBA 3CXCO 3P8MC 1S1CX 3GHGC 2BHVA 3RGUA 4JPZB 1SQPG 4C7NA 4XFXA 2FXMA 3H1JG 2P2UA 1VQPP 5AVSB 1AYIA 3F89A 1LGHB 2N1TC 1KN7A 2IBZI 5GTIH 1NTZK 2GZFA 5I4TG 1YBKA 3KXDA 3L75G 5AW0B 2D2CB 3M9QA 1LNQA 2O01H 1HWTC 1M7LA 3M0AA 3CC4P 1ZR4A 3L36A 3VOPA 3IN6A 1S5LE 2K0YA 5KP7B 1X0TA 4KT0J 1PGQA 4U0EA 3A7OA 3GJNA 5AW1B 5C39A 4MN4C 3CCLP 1HGVA 2KORA 2RH0A 1SQBJ 4Y28J 2CK3H 4UB8E 2M3BA 1T2KD 1BE3J 4PV1B 2HPCB 2BEQD 2K0XA 3B5ND 4BWNA 5TISH 2KYVA 2MR7A 3JCUE 3G1IA 1OIPA 1KQSO 1Z56A 2JYLA 2FQ2A 2CPBA 1H8AA 3SFEC 2B9BA 3AE3C 2XZRA 4EI2A 1R5LA 1W2EA 1VQ4P 2ZT9C 3HYBA 4BPHA 3M0DC 4LC1A 2Z44A 3L70J 1KMIZ 2Y9ZA 3I55P 1S2EA 3H1KJ 4U3FG 1CEIA 1CSBA 2YKPA 4U0CA 4H2XC 1GXHA 2XZ1C 4QMAA 1FZBA 1GW3A 3MUDA 1FDIA 4GR2A 2QM7A 3JSVC 2NPSB 3M9BA 3PLNA 1RE3C 1FE6A 2KZIA 5KLVG 5JPAA 2NPSA 3H1HJ 2WT7B 2QM8A 5AVVB 2ZJSE 1PP9J 1SFCC 1EDLA 2WT7A 2MVVA 4M0IA 3U43A 2FHSC 2W8ZA 1OR5A 1F80D 2E74B 4RKUJ 2IX7C 2YO2A 1VF5B 4L74A 3K5BA 4Y99C 2E5TA 5KJ7A 4GIFA 4K35A 1SQPE 2G3AA 1P84D 1MV8A 1Z6MA 1NKNA 3H1JE 4H44B 1NKZB 1L0HA 3CCUP 1TU3F 1S4XA 3KHUA 1R8EA 2YO3A 2N5HA 3SWYA 3D6ZA 1UIXA 3CX5H 3ZDMA 1BXIA 2CQ8A 5BU5A 3L75E 1GMJA 2FKWB 3CX5I 1K9MQ 3A0HH 1AFOA 4QKOA 3DS5A 1IFIA 2WVRA 1NTZG 1NO4A 3HD7B 3Q2YA 2W27A 1SQQD 4WVZA 3HD7A 3A3YB 1SQVD 2L91A 2B89A 4H2YC 2WQYC 1YITP 1GK4A 3A2AA 4K3AA 1VDFA 1J1DB 1SQQK 3CLQA 2OYIB 1PPJG 1LTTC 3FWNA 2NZ2A 1SQXJ 1QRJA 2WMMA 1YIJP 5AVZB 1SQVK 2OYIA 3N7NA 2BUOA 2JAZA 2L4BA 3WU2H 2O3JA 3L35A 1BSHA 2FADA 4OVNF 5CMZA 1VQLP 1Y9BA 3TGUG 1EDJA 3AE2C 2KSEA 1L4AB 1D1DA 1JNMA 1XTCC 3MUDC 4RESB 1ZN5A 2BCCG 1L4AA 3O6QB 2R3SA 3CCJP 2L0QA 2ZT9D 1VKUA 2E76B 2PEQA 3P8CE 2NPSC 2KK7A 1M1JA 3O6QA 5CJ0A 1U57A 2K1AA 3CCRP 3MP7B 1NU1J 3EJEA 2YKOA 4NPDA 5DJUB 1T6AA 3FXDA 3P05A 1HTLC 1JMBA 2KWLA 2O01N 4DOJA 1QGKB 1N7SB 2QG4A 2LMLA 2RN0A 1GDTA 1VF5C 2HG5D 3D71A 1JY2N 1SFCD 1FR2A 1MZ8A 5CZDB 1N7SA 3NTEA 4TT3H 1FZAA 1ZW0A 2Q5UA 2W6JH 1IZNB 1MUUA 3O8ZA 3V2NA 2OYHB 5GTHH 2ITAA 4H44C 3HE5B 1A43A 1L2PA 1S3JA 5AVUB 2OYHA 1NVOA 3HE5A 2QJKC 1QVFO 2ROQA 1JCDA 3G28A 3BCCE 1CZQA 2QVAA 3HD7C 1M6EX 1L0LE 4U0AA 2GM4A 3DS2A 3A0BE 3L73D 4BRYB 2FACA 1NTKE 2O01J 2IDBA 3GZMA 4BRYA 3SWKA 3KZIH 1J1DC 2OYIC 1IFMA 3M91A 2A06G 5HV8A 1AA0A 1PPJE 1DNYA 4NPFX 2N6ZA 2FYNB 1QL1A 5H2FE 1LTJA 3DPHA 3BATA 1HBWA 1G1IA 4XE5B 3EFGA 4IFFA 1DEEG 1SQPD 2HODB 3TGUE 5KLIC 2QIWA 4M3LA 1Y8AA 1GW4A 3H1JD 3AEGC 4YXWH 2PGDA 1GD2E 2HODA 1RE4A 5HGNA 1M1JC 3H1LE 1ZNVA 4XRQA 2LF4A 3CCEP 3GF3A 2XNDH 2BCCE 2E76C 2R3CA 3L75D 3CWBE 2EFJA 1KB9D 1NQ4A 2WSFH 1DD3A 3LIDA 3T97A 2KGDA 2W6BA 3CCSP 3DS0A 4ZKPA 1BGYG 5AVRB 2HYNA 1DIPA 1L0IA 1T3UA 1H0TA 1RNIA 3EWKA 2ZYDA 2JR8A 2K94A 2J58A 4W7YA 1AF8A 2OYHC 2OQQA 1SQQJ 2E75B 1IO4A 5KAFH 4JYCA 2Q3EA 2MJZA 2X2BA 2J5UA 2KOSA 2IFNA 1YJNP 2ZVOB 5TISE 3RK3B 1DX7A 1J2JB 3FGAD 2JKVA 1NHLA 1GTWA 5E79H 4U3FD 2P7JA 1LT9A 2W83C 2OTJP 4ZKUA 2DGYA 1ZLLA 1KYOH 2BEZF 2WPQA 1EOQA 3P8CD 2KSJA 3FXEA 3H1IJ 1LWUB 3D70A 2V4HA 5KAIH 2IFMA 3L74E 1LWUA 1X79B 3VN0A 1IK7A 1LTJC 2KP8A 3ITKA 4PD4D 3RG6C 3L4FA 3G71P 2A45G 1S72P 1KLPA 2A06E 1JY2O 3MZWB 2FYZA 3DS4A 2MKVA 3CI9A 2IYPA 1GXGA 4D6TE 3M1MA 3L72E 2GZEA 2FQ0A 1QLED 1EXIA 1RE4C 4N6JA 2JP3A 4I1LA 1VQ7P 3G1GA 2KS1A 3V5BA 3V4QA 3WUTA 4UHPB 1HY8A 1KC8Q 1BCCG 1EXJA 3OAKA 3Q5PA 1FZFA 1NTZD 5CCHA 5KP8B 1URQB 1JY3N 3D6YA 3VMAA 5EFWB 1RF1B 4WBAA 1HF9A 1NTKD 2H7HA 4XFJA 5BVZA 2KG8A 1BGYE 1URQA 4DJGA 3CX5E 1RF1A 2KG9A 1L0LK 2B87B 5KKZC 1FOSE 1EZVG 2CNRA 4YPCA 2XV6A 1PPJD 2BASA 1NTKK 3A0HE 4WY4B 1PEUA 2XDJA 1OVUA 4PWVB 5BS2A 4WY4A 3L73J 2E75C 5F2OA 3LMOA 3RL0D 4CPGA 3G29A 1M6NA 4GR6A 3W67A 2WTYA 2Q9IA 2YMYA 2L9FA 4KHXA 1M1KQ 2ERHA 3TGUD 1LT9C 3C8VA 4COCA 3RK3C 4GOFA 3VRLC 2Z46A 1PEOA 1M57D 4XFZA 1MFTA 1KQFB 4I6MC 1VL2A 2K9YA 5CCHD 5CCGD 2HPCA 4AQRD 2BCCD 2QA4P 4EYYQ 1NJIQ 1LWUC 4U0DA 2AXTE 3CWBD 1PZQA 3S1KA 2NRGA 1IK9A 2H8PD 4XFYA 2CG5B 3MGNA 3AE6C 2CWOA 1SQPJ 3GW6A 1ACPA 1QL2A 2LKIA 5AW3B 1CW5A 5EW5E 2FVEA 1GL2D 3M9HA 4DZOA 3AE5C 2ZFCA 2NO8A 2WPTA 3L75J 1P84H 1RY3A 1FZEA 1SVFA 3RBZA 1BDDA 3U1AA 1P84I 3DS3A 3GMAA 1BAJA 4L76A 1OVRA 3BRTB 5DCKA 1Q82Q 1S9KE 2L5GB 5BS1A 4TLFA 3EQ2A 3NMDA 4MRTC 3WUVA 3QWOC 5CCHC 3RK2B 1VQ5P 1BCCE 1JY2P 1BE3E 1E6JP 4H13D 3TNUB 1SQXG 3KQGA 5GTHE 1PGJA 1RF1C 5AW9B 1VQKP 4JQ0D 1JJ2O 2K93A 3L74D 2Q1KA 2MD9A 1IUQA 2EIAA 2FYUJ 2JDIH 1T8KA 3MTUE 2WSFJ 1HJBA 1EZVE 2A06D 2D2CC 4U3FJ 1NYHA 4WY4C 2PEKA 4N78E 1HGZA 4H0LB 3BCCG 4ASVA 2KUBA 3L70E 2N1TD 4WYMA 2OARA 2XZ0D 1SS1A 1L0LG 3EJDA 2GA1A 3H1KE 1KORA 4D6TD 3DTJA 4PJ0E 1NTKG 2QSIA 4H2WC 3L72D 2YMKA 2ZXXA 2OTKE 2YNYA 1LT1A 3LW5H 5AW5B 3KZIE 2XU6A 5KLVJ 2CPSA 4PV1C 1KQLA 2KGEA 1RH5B 2SPZA 1Q90D 3GLMA 1S5LH 3H1HE 1NTMK 4OH8B 2W6AA 2XV5A 2M8NA 1FDOA 1WRGA 1PP9E 3IF4A 1JY3O 1NOHA 3PJSK 3TF5A 3I5CA 3S9OA 5B5EH 3RG2A 4UB8H 1M90Q 4I2LC 3V2QA 1LTIC 3RBXA 2JQ4A 1M74A 4EIJA 1KZUB 1WMKA 4NEOA 3G6EP 1RO2A 2I1KA 1BGYD 2C0WA 2MF4A 3H1LG 2WPSA 3JCUH 1DEBA 3AEAC 3PTZA 1AQTA 5CBNA 2AFEA 2FVAA 1KILB 3CWBG 3VMYA 3IR9A 3TSIA 1OMIA 1YQ3C 4OGQB 4IOIH 2AEFA 2IBZG 5KTBA 1YI2P 5APYA 4AUWA 1NTZJ 3II6A 5APQA 1KQGB 2A45H 1K73Q 1EDKA 3MIWA 3H4EA 2CGQA 2A45I 3H32B 3TYYA 2E74C 5KJ7C 4RO0A 3P7KA 3B71A 3H32A 5B66E 2LKMA 3S4RA 4Z1MH 3NTNA 2PRRA 3C9IA 4PXHB 1AVYA 1SQXE 5KAFE 2K2QA 1A02F 2KODA 1U7MA 3C1LA 2Y9YA 3R2PA 1JO5A 3TGUJ 4RJTA 2MY5A 2KI7B 2QRXA 1PGPA 1SLQA 3CXHE 2PNGA 4I7ZB 4R4LA 1LP1B 2HR3A 2FBWC 2PP6A 3B5NB 1YYCA 3CCMP 4PH0A 3CPWO 2BCCJ 1LP1A 1OX3A 2OYOA 3B5NA 5KAIE 1IFNA 1AUMA 3L74G 2D2CD 1GPJA 1JB0J 2QE7H 4LGDE 1G1JA 1KFNA 2AEJA 4IFDK 1KD1Q 2I8DA 3AE4C 1RHZB 1KB9H 5APSA 2Q3IA 4GODA 2OGUA 2QJPB 1NU1E 1KB9I 4D6TG 2M5AB 2P10A 1OXZA 1G2CB 4PV1D 1BCCD 3L72G 2KG6A 2I1JA 1L0NG 3QH9A 1NTMG 2M5AA 2FY8A 2YXQB 2KGCA 1NAFA 3MHVA 2W90A 3JC22 1IC2A 1L4AC 1N2DC 3Q1MA 1ZMBA 2GUSA 5HVCA 2DNWA 1IJDB 1QX8A 3B5IA 3AE8C 1EZVD 2KXPB 3AE1C 3Q5RA 4OGQC 4CA3A 2PEOA 5APWA 3L70D 1ZV8A 3KPEA 2L22A 2IBZE 4WWIA 2V7QJ 1IMPA 4DG9A 1JY3P 1FJPA 5APVA 1FJKA 5GTIE 1RQVA 2FFDB 2NPSD 5AW7B 1IMQA 3AEBC 3H1IG 2PY8A 2YIUB 4IL6H 1PEMA 4DCKA 1QVGO 1JM0A 1OWAA 2FFDA 2QEXP 2AXCA 1N7SC 5APUA 3H1HD 1EC5A 4U0FA 3SWFA 2PEJA 4PD4H 3W68A 7CEIA 2PEIA 2E74D 5KJ7D 5L8RJ 4PD4I 1SQVJ 1VF5D 2K0DX 1GU5A 1DV5A 1T2KC 1DD4A 4I7ZC 4GOEA 1LTGC 2Z5HA 2GZJA 4HB1A 2Z4EA 2KLUA 4H44D 3U59A 1UJZA 2VRSA 1X9VA 3OW2O 3Q20A 1HJ0A 2Y0CA 1KYOI 1EQ7A 3H0DA 3L71G 3AEFC 4IPYA 1AJYA 3BASA 1OZHA 3HD7D 2EHSA 4KJMA 2E43A 2K3RA 1A02J 4GT1A 1BGYJ 2FYNC 1YHQP 3B4QA 2QJPC 3LW5J 1UNKA 3A0BH 1DH3A 4ASWA 4GKGA 3V4WA 1NGMB 1AQ5A 1ZXGA 2ZT9B 2WWWA 2E5YA 1VPCA 2HFED 1L0NE 1NTME 3VP8A 1SQXD 1W5CE 5BU8B 3M0DA 3V2RA 4PH1A 1MKMA 1N86A 5H2FH 1X8YA 1ZRTE 2GZGA 2GDXA 3RL0B 4WB4A 2K92A 1SQXK 3UIAA 5AW6B 4C7RA 3CXHD 1SQBG 1JTHB 3KYQA 5APXA 5F2NA 4XA4A 1YQ4C 1BE3G 2JYGA 2Z45A 1E0HA 1L4AD 3RK3E 4U0BA 3BCCD 2C0XA 1RE3A 1JTHA 1M56D 2PENA 1FU1A 1SFCB 1ZOYC 1L0LD 1GK6A 1VHNA 2E76D 1VQMP 3FWLA 2KLVA 2LIUA 2YIUC 4C7NB 1RF0A 3H1IE 2VSQA 4Y99B 3U1CA 1MZ9A 1M8OB 1VQ6P 3L70G 1NU1D 2B87A 3IAOA 3H1KG 4U7JA 2KNCB 2AVAA 1YTZT 4R4MA 1N7SD 3USSA 2KNCA 3NY7B 3GZLA 1NU1K 1FZGA 2MR8A 3Q5SA 2KW2A 1VQ8P 3F5HA 1Q81Q 3LIEA 2PEMA 3H1HG 3VYIA 4HH2A 2E1MA 3CE7A 1EMVA 3H1LD 1PP9G 1YJWP 4JBZA 3WU2E 1GZLA 5B5EE 4HYTB 1BCCJ 3R4YA 3BVHA 3E1IA 2Q6QA 5F2KA 2IBZD 1Q2NA 1FS0E 2M3EA 3L71E 2KIKA 2PAJA 3CD6P 1FC2C 1JEKA 1R5SA 4B86A 2LPKA 3H1JJ 3GG2A 1AV1A 2JGPA 1U7JA 1PFIA 1IFPA 2K9JB 2V7QH 3L37A 5CHXA 2WSEH 2B88A 2FYUG 2N9BA 3GF7A 2K9JA 3CCVP 2WPRA 2Q7CA 4HJGH 2KOOA 2DW3A 2K88A 5AVWB 2MVUA 2AFDA 4BXLA 5AW4B 3L73E 4YTPC 3G26A 2KZJA 4GDOA 1K04A 3TK1A 1SQBE 2JO0A 3AEEC 3PP5A 1LTAC 2YXRB 5AVQB 3G4SP 1JUNA 4W80A 3H6PA 4UB6H 2ZXEB 1URQC 3HRNA 1RF0C 2Z5IA 1K30A 3TNUA 2IPPA 2K37A 3H47A 1E79H 4BPFA 2JJLA 1PGOA 1HVVA 2P1JA 3G3ZA 3WMM0 1LTBC 1WT6A 2IZ0A 1KTMA 2R32A 2AF8A 2C9NY 3SSUA 3G9RA 1EIAA 3OA7A 2H89C 4XROA 3PRJA 3V2PA 1JCCA 5EJDA 4W7ZA 1L0ND 1A8OA 2QJKB 1NTMD 2GDYA 1OFCX 2KOGA 3WUUA 1KB9E 2E75D 1ZRTD 2P67A 2VLQA 3MGEA 1NU1G 3E2DA 1L0NK 4JF7A 2PFXA 4IFMA 5KP6B 2R5BA 2GUVA 1ZMEC 1PL5A 4NPEA 3RK3D 1MFZA 3FX0A 1IFDA 3I56P 1FZCB 2XXMA 3EJBA 3NXSA 4F37A 3AECC 3HTKB 1FZCA 2JU1A 4L73A 2JEEA 3NFQA 3N4XA 3CX5D 3HTKA 2ZAEB 2LTEA 1OVVA 2EG5A 3H1ID 2FVFA 2AXTH 1J1EB 1N73B 3RL0g 3CC2P 5HGOA 2JWDA 2FQ1A 3DS1A 3A5TA 1S5LX 3BCCJ 1CI6B 2FYUE 2XNXA 5KLIB 2N98A 4QNBA 1SP4A 3G21A 1KILA 1N73A 1OW6A 3MD0A 2ZYAA 1VQ9P 1N8RQ 1L0LJ 4U3FE 4OWFA 1CI6A 3PH0A 1OW8A 1M1JB 1NTKJ 2M5RA 4IL6E 2EHTA 3CCQP 2JBGA 3ABVC 2RMZA 2N6YA 1T3JA 3HZQA 3HUSB 2QNWA 3RK2C 5KLVE 2UWJE 4PD4E 2JO1A 3HUSA 2GZIA 4YXDC 3TDKA 5M1BA 4COPA 4HKZH 1RQUA 2WSCJ 1NH4A 1NAYA
chains in the Genus database with same CATH topology
1AUMA 5F2NA 2PEJA 3DPHA 2JYGA 2Z45A 5BS1A 1M74A 4U0BA 2OTJP 3CCRP 3CMEP 2XV6A 2DGYA 3MGEA 3G6EP 1RO2A 3E2DA 3CCUP 2PEIA 1EOQA 2PENA 1PEUA 1KD1Q 3CCVP 2L6EA 5BS2A 1VQ5P 2M8LA 1VQMP 3I56P 3P05A 2P9XA 1E6JP 5F2OA 3G1IA 2XXMA 1VQNP 3G29A 1M6NA 4GR6A 1K9MQ 1Q86Q 2ONTA 1KQSO 3DS5A 3RG6C 5HGNA 5HGMA 2JYLA 1YI2P 1M1KQ 1VQKP 3G71P 4XRQA 2LF4A 1JJ2O 5HGLA 3CCEP 1S72P 4COCA 3LRYA 3G26A 1Q7YQ 1VQ6P 3VRLC 2Z46A 1PEOA 3NTEA 3OW2O 1VQ4P 3HYBA 4XFZA 1IUQA 3Q20A 3DS4A 2EIAA 1K73Q 2Z44A 2EFJA 2EG5A 3I55P 3H0DA 3H4EA 3M1MA 2JO0A 1YITP 2XT1A 3G4SP 2QA4P 1A43A 2PEKA 3CC2P 4IPYA 5HGOA 1ZMBA 4U0CA 1NJIQ 1YJ9P 3DS1A 3CXCO 3CCSP 3DS0A 4U0DA 4QNBA 4WYMA 2OARA 1QRJA 3G21A 1YIJP 2BHVA 1PEQA 1VQ9P 3B5IA 1N8RQ 4GR2A 1K30A 3CMAP 4XFYA 3DTJA 2OTLP 2BUOA 1YHQP 1RNIA 2CWOA 4XFXA 3H47A 1VQ7P 1QVFO 1VQ8P 3G1GA 3G28A 1VQPP 1Q81Q 2PEOA 2PEMA 2E1MA 5JPAA 1M6EX 3CCQP 2KODA 1VQOP 3CC7P 4U0AA 3DS2A 1YJWP 1VQLP 1K8AQ 5I4TG 1KC8Q 2BQ1E 3HZQA 4M0IA 3G0VA 1D1DA 5F2KA 1EIAA 2M8NA 2PY8A 1W2BO 3CC4P 4PH1A 1RO0A 1PEMA 1QVGO 3CD6P 4XROA 2QEXP 3CCMP 4PH0A 3DS3A 3CPWO 4COPA 3CCJP 4U0EA 1BAJA 1A8OA 3WBHA 1YJNP 2PEQA 5DCKA 2M8PA 1M90Q 3CCLP 4U0FA 1Q82Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC O;  3CCS P;  1KQS O;  1YI2 P;  1M1K Q;  1VQK P;  3G71 P;  1YIJ P;  2OTJ P;  3CCR P;  1JJ2 O;  3CCE P;  3CME P;  1S72 P;  1VQ9 P;  3G6E P;  1N8R Q;  1Q7Y Q;  3CMA P;  1VQ6 P;  3CCU P;  2OTL P;  1YHQ P;  1W2B O;  3CC4 P;  3OW2 O;  1KD1 Q;  1VQ4 P;  1VQ7 P;  1QVF O;  3CCV P;  1QVG O;  1K73 Q;  1VQ8 P;  3CD6 P;  2QEX P;  1VQP P;  1Q81 Q;  3I55 P;  3CCM P;  3CPW O;  3CCJ P;  1VQ5 P;  1VQM P;  1YJN P;  3CCQ P;  1YIT P;  1VQO P;  3I56 P;  3CC7 P;  1YJW P;  3G4S P;  2QA4 P;  1VQL P;  1M90 Q;  3CC2 P;  1K8A Q;  1VQN P;  3CCL P;  1NJI Q;  1YJ9 P;  1K9M Q;  1Q82 Q;  1Q86 Q;  1KC8 Q; 
#chains in the Genus database with same CATH topology
 3L71 D;  2O1J A;  1FOS F;  5CJ4 A;  2FAE A;  1H88 A;  3H25 A;  1QEX A;  5E79 E;  4L75 A;  1X3O A;  1URQ D;  1LTS C;  4H0L C;  4ZMD A;  1NWQ A;  1JMM A;  1KYO E;  3H1L J;  2L6E A;  3PHL A;  2KGA A;  2M8L A;  3IFM A;  1VQN P;  1Y47 A;  4C46 A;  1Q86 Q;  3CWB J;  4AYC A;  1ZR2 A;  1KIL E;  2ZVN B;  4WY4 D;  5CCG A;  2QJY B;  2LXC B;  2C9L Y;  2N50 A;  3GKL C;  3BRV B;  2Y0E A;  2JWA A;  1S9K D;  3HE4 B;  1H89 A;  1NTZ E;  1EZV I;  1BSN A;  1AVO A;  3HE4 A;  1GL2 B;  4PJ0 H;  1SQB D;  4DT0 A;  1PEQ A;  1EDI A;  1FZC C;  1BE3 D;  1GL2 A;  2M8R A;  1LTJ B;  2KB7 P;  2JU2 A;  1G2C A;  2LL8 A;  1FAV A;  5TJH A;  1SQB K;  3EFF K;  2R44 A;  1PV3 A;  2ZYG A;  3V6I A;  1FBM A;  5AVX B;  1UII A;  5AW2 B;  1SQQ G;  2VLN A;  3G0V A;  2KOQ A;  2KR5 A;  1J1E C;  1SQV G;  2IZ1 A;  1KIL C;  2WZ7 A;  1N73 C;  4IZ6 A;  4N78 D;  3VMX A;  1X22 A;  3H1K D;  1N7L A;  5AVT B;  2M8P A;  2H88 C;  2LR2 A;  1OW7 A;  4N3Y B;  4H13 B;  2WSE J;  4HKG A;  2N9Y B;  2RKL A;  1SQP K;  3CME P;  3L74 J;  2M0B A;  5AW8 B;  2FXP A;  1XTG B;  1HUC A;  2R5D A;  1LJ2 A;  1ZP0 C;  4LLH A;  3T97 B;  3Q3D A;  3GHG B;  3HUS C;  3M06 A;  2O1K A;  4EOT A;  2P9X A;  2VLP A;  5APT A;  2G8Y A;  3GHG A;  1H0T B;  2POH A;  1PP9 D;  1YTZ I;  2P58 A;  4D6T J;  2N1T B;  3E7K A;  5HGL A;  3LRY A;  4O9B A;  3L72 J;  5K5G B;  3RL0 C;  5KKZ B;  2LIW A;  3RK2 D;  2N1T A;  1L0N J;  2KOP A;  1NTM J;  3SFD C;  5B66 H;  3B8E B;  1HQB A;  1YJ9 P;  1BDC A;  2Y0D A;  3P32 A;  3B5N C;  1K05 A;  4IL6 X;  2YKQ A;  3AE9 C;  3CMA P;  2H43 A;  2OTL P;  2JB0 A;  1E5W A;  5CCG C;  3VP9 A;  2FYU D;  1LT9 B;  1KFM A;  3CL3 D;  4A7P A;  1VQO P;  2QJY C;  5CBO A;  4H0L D;  3CC7 P;  1K8A Q;  2WPV B;  3CXH H;  2BQ1 E;  1GU4 A;  2N5I A;  3OJA B;  1FDM A;  2FYU K;  3CXH I;  1W2B O;  1PIX A;  1RO0 A;  2J59 M;  1D7M A;  4ZNC A;  2WIT A;  1GL2 C;  1P84 E;  2E42 A;  2VLO A;  3WBH A;  5DJT B;  5KLV D;  1KV4 A;  4EDF A;  3KDP B;  5KLV K;  3B4S A;  3E1R A;  1USE A;  2K5X A;  3AE7 C;  2HLO A;  3L73 G;  4JYB A;  2GDW A;  1SQQ E;  2FXO A;  2IYO A;  1USD A;  3VMZ A;  1SQV E;  2ONT A;  1T8Z A;  2WSC H;  1JOC A;  5HGM A;  1KYO D;  2KS1 B;  2AEM A;  4BPG A;  1Q7Y Q;  4UB6 E;  5AVY B;  2WSS H;  2GYK A;  3AED C;  4H13 C;  1KIL D;  3VTP C;  1HH0 A;  2FFD C;  2LOL A;  2XT1 A;  1SFC A;  2XKM A;  1IFJ A;  3L71 J;  4R0M A;  4OGQ D;  2LXB A;  3CXC O;  3P8M C;  1S1C X;  3GHG C;  2BHV A;  3RGU A;  4JPZ B;  1SQP G;  4C7N A;  4XFX A;  2FXM A;  3H1J G;  2P2U A;  1VQP P;  5AVS B;  1AYI A;  3F89 A;  1LGH B;  2N1T C;  1KN7 A;  2IBZ I;  5GTI H;  1NTZ K;  2GZF A;  5I4T G;  1YBK A;  3KXD A;  3L75 G;  5AW0 B;  2D2C B;  3M9Q A;  1LNQ A;  2O01 H;  1HWT C;  1M7L A;  3M0A A;  3CC4 P;  1ZR4 A;  3L36 A;  3VOP A;  3IN6 A;  1S5L E;  2K0Y A;  5KP7 B;  1X0T A;  4KT0 J;  1PGQ A;  4U0E A;  3A7O A;  3GJN A;  5AW1 B;  5C39 A;  4MN4 C;  3CCL P;  1HGV A;  2KOR A;  2RH0 A;  1SQB J;  4Y28 J;  2CK3 H;  4UB8 E;  2M3B A;  1T2K D;  1BE3 J;  4PV1 B;  2HPC B;  2BEQ D;  2K0X A;  3B5N D;  4BWN A;  5TIS H;  2KYV A;  2MR7 A;  3JCU E;  3G1I A;  1OIP A;  1KQS O;  1Z56 A;  2JYL A;  2FQ2 A;  2CPB A;  1H8A A;  3SFE C;  2B9B A;  3AE3 C;  2XZR A;  4EI2 A;  1R5L A;  1W2E A;  1VQ4 P;  2ZT9 C;  3HYB A;  4BPH A;  3M0D C;  4LC1 A;  2Z44 A;  3L70 J;  1KMI Z;  2Y9Z A;  3I55 P;  1S2E A;  3H1K J;  4U3F G;  1CEI A;  1CSB A;  2YKP A;  4U0C A;  4H2X C;  1GXH A;  2XZ1 C;  4QMA A;  1FZB A;  1GW3 A;  3MUD A;  1FDI A;  4GR2 A;  2QM7 A;  3JSV C;  2NPS B;  3M9B A;  3PLN A;  1RE3 C;  1FE6 A;  2KZI A;  5KLV G;  5JPA A;  2NPS A;  3H1H J;  2WT7 B;  2QM8 A;  5AVV B;  2ZJS E;  1PP9 J;  1SFC C;  1EDL A;  2WT7 A;  2MVV A;  4M0I A;  3U43 A;  2FHS C;  2W8Z A;  1OR5 A;  1F80 D;  2E74 B;  4RKU J;  2IX7 C;  2YO2 A;  1VF5 B;  4L74 A;  3K5B A;  4Y99 C;  2E5T A;  5KJ7 A;  4GIF A;  4K35 A;  1SQP E;  2G3A A;  1P84 D;  1MV8 A;  1Z6M A;  1NKN A;  3H1J E;  4H44 B;  1NKZ B;  1L0H A;  3CCU P;  1TU3 F;  1S4X A;  3KHU A;  1R8E A;  2YO3 A;  2N5H A;  3SWY A;  3D6Z A;  1UIX A;  3CX5 H;  3ZDM A;  1BXI A;  2CQ8 A;  5BU5 A;  3L75 E;  1GMJ A;  2FKW B;  3CX5 I;  1K9M Q;  3A0H H;  1AFO A;  4QKO A;  3DS5 A;  1IFI A;  2WVR A;  1NTZ G;  1NO4 A;  3HD7 B;  3Q2Y A;  2W27 A;  1SQQ D;  4WVZ A;  3HD7 A;  3A3Y B;  1SQV D;  2L91 A;  2B89 A;  4H2Y C;  2WQY C;  1YIT P;  1GK4 A;  3A2A A;  4K3A A;  1VDF A;  1J1D B;  1SQQ K;  3CLQ A;  2OYI B;  1PPJ G;  1LTT C;  3FWN A;  2NZ2 A;  1SQX J;  1QRJ A;  2WMM A;  1YIJ P;  5AVZ B;  1SQV K;  2OYI A;  3N7N A;  2BUO A;  2JAZ A;  2L4B A;  3WU2 H;  2O3J A;  3L35 A;  1BSH A;  2FAD A;  4OVN F;  5CMZ A;  1VQL P;  1Y9B A;  3TGU G;  1EDJ A;  3AE2 C;  2KSE A;  1L4A B;  1D1D A;  1JNM A;  1XTC C;  3MUD C;  4RES B;  1ZN5 A;  2BCC G;  1L4A A;  3O6Q B;  2R3S A;  3CCJ P;  2L0Q A;  2ZT9 D;  1VKU A;  2E76 B;  2PEQ A;  3P8C E;  2NPS C;  2KK7 A;  1M1J A;  3O6Q A;  5CJ0 A;  1U57 A;  2K1A A;  3CCR P;  3MP7 B;  1NU1 J;  3EJE A;  2YKO A;  4NPD A;  5DJU B;  1T6A A;  3FXD A;  3P05 A;  1HTL C;  1JMB A;  2KWL A;  2O01 N;  4DOJ A;  1QGK B;  1N7S B;  2QG4 A;  2LML A;  2RN0 A;  1GDT A;  1VF5 C;  2HG5 D;  3D71 A;  1JY2 N;  1SFC D;  1FR2 A;  1MZ8 A;  5CZD B;  1N7S A;  3NTE A;  4TT3 H;  1FZA A;  1ZW0 A;  2Q5U A;  2W6J H;  1IZN B;  1MUU A;  3O8Z A;  3V2N A;  2OYH B;  5GTH H;  2ITA A;  4H44 C;  3HE5 B;  1A43 A;  1L2P A;  1S3J A;  5AVU B;  2OYH A;  1NVO A;  3HE5 A;  2QJK C;  1QVF O;  2ROQ A;  1JCD A;  3G28 A;  3BCC E;  1CZQ A;  2QVA A;  3HD7 C;  1M6E X;  1L0L E;  4U0A A;  2GM4 A;  3DS2 A;  3A0B E;  3L73 D;  4BRY B;  2FAC A;  1NTK E;  2O01 J;  2IDB A;  3GZM A;  4BRY A;  3SWK A;  3KZI H;  1J1D C;  2OYI C;  1IFM A;  3M91 A;  2A06 G;  5HV8 A;  1AA0 A;  1PPJ E;  1DNY A;  4NPF X;  2N6Z A;  2FYN B;  1QL1 A;  5H2F E;  1LTJ A;  3DPH A;  3BAT A;  1HBW A;  1G1I A;  4XE5 B;  3EFG A;  4IFF A;  1DEE G;  1SQP D;  2HOD B;  3TGU E;  5KLI C;  2QIW A;  4M3L A;  1Y8A A;  1GW4 A;  3H1J D;  3AEG C;  4YXW H;  2PGD A;  1GD2 E;  2HOD A;  1RE4 A;  5HGN A;  1M1J C;  3H1L E;  1ZNV A;  4XRQ A;  2LF4 A;  3CCE P;  3GF3 A;  2XND H;  2BCC E;  2E76 C;  2R3C A;  3L75 D;  3CWB E;  2EFJ A;  1KB9 D;  1NQ4 A;  2WSF H;  1DD3 A;  3LID A;  3T97 A;  2KGD A;  2W6B A;  3CCS P;  3DS0 A;  4ZKP A;  1BGY G;  5AVR B;  2HYN A;  1DIP A;  1L0I A;  1T3U A;  1H0T A;  1RNI A;  3EWK A;  2ZYD A;  2JR8 A;  2K94 A;  2J58 A;  4W7Y A;  1AF8 A;  2OYH C;  2OQQ A;  1SQQ J;  2E75 B;  1IO4 A;  5KAF H;  4JYC A;  2Q3E A;  2MJZ A;  2X2B A;  2J5U A;  2KOS A;  2IFN A;  1YJN P;  2ZVO B;  5TIS E;  3RK3 B;  1DX7 A;  1J2J B;  3FGA D;  2JKV A;  1NHL A;  1GTW A;  5E79 H;  4U3F D;  2P7J A;  1LT9 A;  2W83 C;  2OTJ P;  4ZKU A;  2DGY A;  1ZLL A;  1KYO H;  2BEZ F;  2WPQ A;  1EOQ A;  3P8C D;  2KSJ A;  3FXE A;  3H1I J;  1LWU B;  3D70 A;  2V4H A;  5KAI H;  2IFM A;  3L74 E;  1LWU A;  1X79 B;  3VN0 A;  1IK7 A;  1LTJ C;  2KP8 A;  3ITK A;  4PD4 D;  3RG6 C;  3L4F A;  3G71 P;  2A45 G;  1S72 P;  1KLP A;  2A06 E;  1JY2 O;  3MZW B;  2FYZ A;  3DS4 A;  2MKV A;  3CI9 A;  2IYP A;  1GXG A;  4D6T E;  3M1M A;  3L72 E;  2GZE A;  2FQ0 A;  1QLE D;  1EXI A;  1RE4 C;  4N6J A;  2JP3 A;  4I1L A;  1VQ7 P;  3G1G A;  2KS1 A;  3V5B A;  3V4Q A;  3WUT A;  4UHP B;  1HY8 A;  1KC8 Q;  1BCC G;  1EXJ A;  3OAK A;  3Q5P A;  1FZF A;  1NTZ D;  5CCH A;  5KP8 B;  1URQ B;  1JY3 N;  3D6Y A;  3VMA A;  5EFW B;  1RF1 B;  4WBA A;  1HF9 A;  1NTK D;  2H7H A;  4XFJ A;  5BVZ A;  2KG8 A;  1BGY E;  1URQ A;  4DJG A;  3CX5 E;  1RF1 A;  2KG9 A;  1L0L K;  2B87 B;  5KKZ C;  1FOS E;  1EZV G;  2CNR A;  4YPC A;  2XV6 A;  1PPJ D;  2BAS A;  1NTK K;  3A0H E;  4WY4 B;  1PEU A;  2XDJ A;  1OVU A;  4PWV B;  5BS2 A;  4WY4 A;  3L73 J;  2E75 C;  5F2O A;  3LMO A;  3RL0 D;  4CPG A;  3G29 A;  1M6N A;  4GR6 A;  3W67 A;  2WTY A;  2Q9I A;  2YMY A;  2L9F A;  4KHX A;  1M1K Q;  2ERH A;  3TGU D;  1LT9 C;  3C8V A;  4COC A;  3RK3 C;  4GOF A;  3VRL C;  2Z46 A;  1PEO A;  1M57 D;  4XFZ A;  1MFT A;  1KQF B;  4I6M C;  1VL2 A;  2K9Y A;  5CCH D;  5CCG D;  2HPC A;  4AQR D;  2BCC D;  2QA4 P;  4EYY Q;  1NJI Q;  1LWU C;  4U0D A;  2AXT E;  3CWB D;  1PZQ A;  3S1K A;  2NRG A;  1IK9 A;  2H8P D;  4XFY A;  2CG5 B;  3MGN A;  3AE6 C;  2CWO A;  1SQP J;  3GW6 A;  1ACP A;  1QL2 A;  2LKI A;  5AW3 B;  1CW5 A;  5EW5 E;  2FVE A;  1GL2 D;  3M9H A;  4DZO A;  3AE5 C;  2ZFC A;  2NO8 A;  2WPT A;  3L75 J;  1P84 H;  1RY3 A;  1FZE A;  1SVF A;  3RBZ A;  1BDD A;  3U1A A;  1P84 I;  3DS3 A;  3GMA A;  1BAJ A;  4L76 A;  1OVR A;  3BRT B;  5DCK A;  1Q82 Q;  1S9K E;  2L5G B;  5BS1 A;  4TLF A;  3EQ2 A;  3NMD A;  4MRT C;  3WUV A;  3QWO C;  5CCH C;  3RK2 B;  1VQ5 P;  1BCC E;  1JY2 P;  1BE3 E;  1E6J P;  4H13 D;  3TNU B;  1SQX G;  3KQG A;  5GTH E;  1PGJ A;  1RF1 C;  5AW9 B;  1VQK P;  4JQ0 D;  1JJ2 O;  2K93 A;  3L74 D;  2Q1K A;  2MD9 A;  1IUQ A;  2EIA A;  2FYU J;  2JDI H;  1T8K A;  3MTU E;  2WSF J;  1HJB A;  1EZV E;  2A06 D;  2D2C C;  4U3F J;  1NYH A;  4WY4 C;  2PEK A;  4N78 E;  1HGZ A;  4H0L B;  3BCC G;  4ASV A;  2KUB A;  3L70 E;  2N1T D;  4WYM A;  2OAR A;  2XZ0 D;  1SS1 A;  1L0L G;  3EJD A;  2GA1 A;  3H1K E;  1KOR A;  4D6T D;  3DTJ A;  4PJ0 E;  1NTK G;  2QSI A;  4H2W C;  3L72 D;  2YMK A;  2ZXX A;  2OTK E;  2YNY A;  1LT1 A;  3LW5 H;  5AW5 B;  3KZI E;  2XU6 A;  5KLV J;  2CPS A;  4PV1 C;  1KQL A;  2KGE A;  1RH5 B;  2SPZ A;  1Q90 D;  3GLM A;  1S5L H;  3H1H E;  1NTM K;  4OH8 B;  2W6A A;  2XV5 A;  2M8N A;  1FDO A;  1WRG A;  1PP9 E;  3IF4 A;  1JY3 O;  1NOH A;  3PJS K;  3TF5 A;  3I5C A;  3S9O A;  5B5E H;  3RG2 A;  4UB8 H;  1M90 Q;  4I2L C;  3V2Q A;  1LTI C;  3RBX A;  2JQ4 A;  1M74 A;  4EIJ A;  1KZU B;  1WMK A;  4NEO A;  3G6E P;  1RO2 A;  2I1K A;  1BGY D;  2C0W A;  2MF4 A;  3H1L G;  2WPS A;  3JCU H;  1DEB A;  3AEA C;  3PTZ A;  1AQT A;  5CBN A;  2AFE A;  2FVA A;  1KIL B;  3CWB G;  3VMY A;  3IR9 A;  3TSI A;  1OMI A;  1YQ3 C;  4OGQ B;  4IOI H;  2AEF A;  2IBZ G;  5KTB A;  1YI2 P;  5APY A;  4AUW A;  1NTZ J;  3II6 A;  5APQ A;  1KQG B;  2A45 H;  1K73 Q;  1EDK A;  3MIW A;  3H4E A;  2CGQ A;  2A45 I;  3H32 B;  3TYY A;  2E74 C;  5KJ7 C;  4RO0 A;  3P7K A;  3B71 A;  3H32 A;  5B66 E;  2LKM A;  3S4R A;  4Z1M H;  3NTN A;  2PRR A;  3C9I A;  4PXH B;  1AVY A;  1SQX E;  5KAF E;  2K2Q A;  1A02 F;  2KOD A;  1U7M A;  3C1L A;  2Y9Y A;  3R2P A;  1JO5 A;  3TGU J;  4RJT A;  2MY5 A;  2KI7 B;  2QRX A;  1PGP A;  1SLQ A;  3CXH E;  2PNG A;  4I7Z B;  4R4L A;  1LP1 B;  2HR3 A;  2FBW C;  2PP6 A;  3B5N B;  1YYC A;  3CCM P;  4PH0 A;  3CPW O;  2BCC J;  1LP1 A;  1OX3 A;  2OYO A;  3B5N A;  5KAI E;  1IFN A;  1AUM A;  3L74 G;  2D2C D;  1GPJ A;  1JB0 J;  2QE7 H;  4LGD E;  1G1J A;  1KFN A;  2AEJ A;  4IFD K;  1KD1 Q;  2I8D A;  3AE4 C;  1RHZ B;  1KB9 H;  5APS A;  2Q3I A;  4GOD A;  2OGU A;  2QJP B;  1NU1 E;  1KB9 I;  4D6T G;  2M5A B;  2P10 A;  1OXZ A;  1G2C B;  4PV1 D;  1BCC D;  3L72 G;  2KG6 A;  2I1J A;  1L0N G;  3QH9 A;  1NTM G;  2M5A A;  2FY8 A;  2YXQ B;  2KGC A;  1NAF A;  3MHV A;  2W90 A;  3JC2 2;  1IC2 A;  1L4A C;  1N2D C;  3Q1M A;  1ZMB A;  2GUS A;  5HVC A;  2DNW A;  1IJD B;  1QX8 A;  3B5I A;  3AE8 C;  1EZV D;  2KXP B;  3AE1 C;  3Q5R A;  4OGQ C;  4CA3 A;  2PEO A;  5APW A;  3L70 D;  1ZV8 A;  3KPE A;  2L22 A;  2IBZ E;  4WWI A;  2V7Q J;  1IMP A;  4DG9 A;  1JY3 P;  1FJP A;  5APV A;  1FJK A;  5GTI E;  1RQV A;  2FFD B;  2NPS D;  5AW7 B;  1IMQ A;  3AEB C;  3H1I G;  2PY8 A;  2YIU B;  4IL6 H;  1PEM A;  4DCK A;  1QVG O;  1JM0 A;  1OWA A;  2FFD A;  2QEX P;  2AXC A;  1N7S C;  5APU A;  3H1H D;  1EC5 A;  4U0F A;  3SWF A;  2PEJ A;  4PD4 H;  3W68 A;  7CEI A;  2PEI A;  2E74 D;  5KJ7 D;  5L8R J;  4PD4 I;  1SQV J;  1VF5 D;  2K0D X;  1GU5 A;  1DV5 A;  1T2K C;  1DD4 A;  4I7Z C;  4GOE A;  1LTG C;  2Z5H A;  2GZJ A;  4HB1 A;  2Z4E A;  2KLU A;  4H44 D;  3U59 A;  1UJZ A;  2VRS A;  1X9V A;  3OW2 O;  3Q20 A;  1HJ0 A;  2Y0C A;  1KYO I;  1EQ7 A;  3H0D A;  3L71 G;  3AEF C;  4IPY A;  1AJY A;  3BAS A;  1OZH A;  3HD7 D;  2EHS A;  4KJM A;  2E43 A;  2K3R A;  1A02 J;  4GT1 A;  1BGY J;  2FYN C;  1YHQ P;  3B4Q A;  2QJP C;  3LW5 J;  1UNK A;  3A0B H;  1DH3 A;  4ASW A;  4GKG A;  3V4W A;  1NGM B;  1AQ5 A;  1ZXG A;  2ZT9 B;  2WWW A;  2E5Y A;  1VPC A;  2HFE D;  1L0N E;  1NTM E;  3VP8 A;  1SQX D;  1W5C E;  5BU8 B;  3M0D A;  3V2R A;  4PH1 A;  1MKM A;  1N86 A;  5H2F H;  1X8Y A;  1ZRT E;  2GZG A;  2GDX A;  3RL0 B;  4WB4 A;  2K92 A;  1SQX K;  3UIA A;  5AW6 B;  4C7R A;  3CXH D;  1SQB G;  1JTH B;  3KYQ A;  5APX A;  5F2N A;  4XA4 A;  1YQ4 C;  1BE3 G;  2JYG A;  2Z45 A;  1E0H A;  1L4A D;  3RK3 E;  4U0B A;  3BCC D;  2C0X A;  1RE3 A;  1JTH A;  1M56 D;  2PEN A;  1FU1 A;  1SFC B;  1ZOY C;  1L0L D;  1GK6 A;  1VHN A;  2E76 D;  1VQM P;  3FWL A;  2KLV A;  2LIU A;  2YIU C;  4C7N B;  1RF0 A;  3H1I E;  2VSQ A;  4Y99 B;  3U1C A;  1MZ9 A;  1M8O B;  1VQ6 P;  3L70 G;  1NU1 D;  2B87 A;  3IAO A;  3H1K G;  4U7J A;  2KNC B;  2AVA A;  1YTZ T;  4R4M A;  1N7S D;  3USS A;  2KNC A;  3NY7 B;  3GZL A;  1NU1 K;  1FZG A;  2MR8 A;  3Q5S A;  2KW2 A;  1VQ8 P;  3F5H A;  1Q81 Q;  3LIE A;  2PEM A;  3H1H G;  3VYI A;  4HH2 A;  2E1M A;  3CE7 A;  1EMV A;  3H1L D;  1PP9 G;  1YJW P;  4JBZ A;  3WU2 E;  1GZL A;  5B5E E;  4HYT B;  1BCC J;  3R4Y A;  3BVH A;  3E1I A;  2Q6Q A;  5F2K A;  2IBZ D;  1Q2N A;  1FS0 E;  2M3E A;  3L71 E;  2KIK A;  2PAJ A;  3CD6 P;  1FC2 C;  1JEK A;  1R5S A;  4B86 A;  2LPK A;  3H1J J;  3GG2 A;  1AV1 A;  2JGP A;  1U7J A;  1PFI A;  1IFP A;  2K9J B;  2V7Q H;  3L37 A;  5CHX A;  2WSE H;  2B88 A;  2FYU G;  2N9B A;  3GF7 A;  2K9J A;  3CCV P;  2WPR A;  2Q7C A;  4HJG H;  2KOO A;  2DW3 A;  2K88 A;  5AVW B;  2MVU A;  2AFD A;  4BXL A;  5AW4 B;  3L73 E;  4YTP C;  3G26 A;  2KZJ A;  4GDO A;  1K04 A;  3TK1 A;  1SQB E;  2JO0 A;  3AEE C;  3PP5 A;  1LTA C;  2YXR B;  5AVQ B;  3G4S P;  1JUN A;  4W80 A;  3H6P A;  4UB6 H;  2ZXE B;  1URQ C;  3HRN A;  1RF0 C;  2Z5I A;  1K30 A;  3TNU A;  2IPP A;  2K37 A;  3H47 A;  1E79 H;  4BPF A;  2JJL A;  1PGO A;  1HVV A;  2P1J A;  3G3Z A;  3WMM 0;  1LTB C;  1WT6 A;  2IZ0 A;  1KTM A;  2R32 A;  2AF8 A;  2C9N Y;  3SSU A;  3G9R A;  1EIA A;  3OA7 A;  2H89 C;  4XRO A;  3PRJ A;  3V2P A;  1JCC A;  5EJD A;  4W7Z A;  1L0N D;  1A8O A;  2QJK B;  1NTM D;  2GDY A;  1OFC X;  2KOG A;  3WUU A;  1KB9 E;  2E75 D;  1ZRT D;  2P67 A;  2VLQ A;  3MGE A;  1NU1 G;  3E2D A;  1L0N K;  4JF7 A;  2PFX A;  4IFM A;  5KP6 B;  2R5B A;  2GUV A;  1ZME C;  1PL5 A;  4NPE A;  3RK3 D;  1MFZ A;  3FX0 A;  1IFD A;  3I56 P;  1FZC B;  2XXM A;  3EJB A;  3NXS A;  4F37 A;  3AEC C;  3HTK B;  1FZC A;  2JU1 A;  4L73 A;  2JEE A;  3NFQ A;  3N4X A;  3CX5 D;  3HTK A;  2ZAE B;  2LTE A;  1OVV A;  2EG5 A;  3H1I D;  2FVF A;  2AXT H;  1J1E B;  1N73 B;  3RL0 g;  3CC2 P;  5HGO A;  2JWD A;  2FQ1 A;  3DS1 A;  3A5T A;  1S5L X;  3BCC J;  1CI6 B;  2FYU E;  2XNX A;  5KLI B;  2N98 A;  4QNB A;  1SP4 A;  3G21 A;  1KIL A;  1N73 A;  1OW6 A;  3MD0 A;  2ZYA A;  1VQ9 P;  1N8R Q;  1L0L J;  4U3F E;  4OWF A;  1CI6 A;  3PH0 A;  1OW8 A;  1M1J B;  1NTK J;  2M5R A;  4IL6 E;  2EHT A;  3CCQ P;  2JBG A;  3ABV C;  2RMZ A;  2N6Y A;  1T3J A;  3HZQ A;  3HUS B;  2QNW A;  3RK2 C;  5KLV E;  2UWJ E;  4PD4 E;  2JO1 A;  3HUS A;  2GZI A;  4YXD C;  3TDK A;  5M1B A;  4COP A;  4HKZ H;  1RQU A;  2WSC J;  1NH4 A;  1NAY A; 
#chains in the Genus database with same CATH homology
 1AUM A;  5F2N A;  2PEJ A;  3DPH A;  2JYG A;  2Z45 A;  5BS1 A;  1M74 A;  4U0B A;  2OTJ P;  3CCR P;  3CME P;  2XV6 A;  2DGY A;  3MGE A;  3G6E P;  1RO2 A;  3E2D A;  3CCU P;  2PEI A;  1EOQ A;  2PEN A;  1PEU A;  1KD1 Q;  3CCV P;  2L6E A;  5BS2 A;  1VQ5 P;  2M8L A;  1VQM P;  3I56 P;  3P05 A;  2P9X A;  1E6J P;  5F2O A;  3G1I A;  2XXM A;  1VQN P;  3G29 A;  1M6N A;  4GR6 A;  1K9M Q;  1Q86 Q;  2ONT A;  1KQS O;  3DS5 A;  3RG6 C;  5HGN A;  5HGM A;  2JYL A;  1YI2 P;  1M1K Q;  1VQK P;  3G71 P;  4XRQ A;  2LF4 A;  1JJ2 O;  5HGL A;  3CCE P;  1S72 P;  4COC A;  3LRY A;  3G26 A;  1Q7Y Q;  1VQ6 P;  3VRL C;  2Z46 A;  1PEO A;  3NTE A;  3OW2 O;  1VQ4 P;  3HYB A;  4XFZ A;  1IUQ A;  3Q20 A;  3DS4 A;  2EIA A;  1K73 Q;  2Z44 A;  2EFJ A;  2EG5 A;  3I55 P;  3H0D A;  3H4E A;  3M1M A;  2JO0 A;  1YIT P;  2XT1 A;  3G4S P;  2QA4 P;  1A43 A;  2PEK A;  3CC2 P;  4IPY A;  5HGO A;  1ZMB A;  4U0C A;  1NJI Q;  1YJ9 P;  3DS1 A;  3CXC O;  3CCS P;  3DS0 A;  4U0D A;  4QNB A;  4WYM A;  2OAR A;  1QRJ A;  3G21 A;  1YIJ P;  2BHV A;  1PEQ A;  1VQ9 P;  3B5I A;  1N8R Q;  4GR2 A;  1K30 A;  3CMA P;  4XFY A;  3DTJ A;  2OTL P;  2BUO A;  1YHQ P;  1RNI A;  2CWO A;  4XFX A;  3H47 A;  1VQ7 P;  1QVF O;  1VQ8 P;  3G1G A;  3G28 A;  1VQP P;  1Q81 Q;  2PEO A;  2PEM A;  2E1M A;  5JPA A;  1M6E X;  3CCQ P;  2KOD A;  1VQO P;  3CC7 P;  4U0A A;  3DS2 A;  1YJW P;  1VQL P;  1K8A Q;  5I4T G;  1KC8 Q;  2BQ1 E;  3HZQ A;  4M0I A;  3G0V A;  1D1D A;  5F2K A;  1EIA A;  2M8N A;  2PY8 A;  1W2B O;  3CC4 P;  4PH1 A;  1RO0 A;  1PEM A;  1QVG O;  3CD6 P;  4XRO A;  2QEX P;  3CCM P;  4PH0 A;  3DS3 A;  3CPW O;  4COP A;  3CCJ P;  4U0E A;  1BAJ A;  1A8O A;  3WBH A;  1YJN P;  2PEQ A;  5DCK A;  2M8P A;  1M90 Q;  3CCL P;  4U0F A;  1Q82 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...