1KQSO

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1kqsO02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1kqsO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1kqsO03
1VQ6P 1W2BO 2OTLP 3I55P 1NJIQ 1VQ4P 1Q7YQ 3CCRP 3CPWO 2QEXP 3CMEP 2OTJP 1KQSO 1VQNP 3CC4P 3CCJP 1S72P 1K73Q 3G4SP 1VQ8P 3CC7P 1Q86Q 3CD6P 3CCQP 3CCLP 3CCVP 1YHQP 3I56P 1M90Q 1N8RQ 1VQLP 3CCMP 3G6EP 3G71P 3OW2O 1QVFO 1VQPP 1YJ9P 3CXCO 1YJNP 3CC2P 1VQ7P 1VQ9P 1KC8Q 1K8AQ 3CCEP 1YITP 1Q81Q 1M1KQ 1YJWP 3CMAP 1QVGO 1VQOP 1Q82Q 1VQMP 1VQKP 3CCSP 3CCUP 1K9MQ 1YIJP 1JJ2O 1VQ5P 2QA4P 1KD1Q 1YI2P
chains in the Genus database with same CATH superfamily
2WVRA 5CCHA 5I4TG 3H47A 1BGYG 2C9NY 2Q3IA 2C9LY 3AE6C 2E75D 1YHQP 2OYIC 4I7ZC 2WTYA 3L72G 2K0XA 2HFED 3L72E 5AW3B 4NEOA 1SQPE 3H1IJ 4DOJA 3BCCJ 1N7SC 4IL6H 3L37A 1Q7YQ 2P9XA 2RN0A 3OAKA 1SQXK 1L0LD 1FZFA 2N1TD 2KP8A 2PRRA 3N7NA 4GR2A 1BE3D 2B87B 3RK3D 3GHGB 4KHXA 4N78E 4U3FJ 1J1EC 2MVUA 2LTEA 3GZMA 2YXRB 3ITKA 1PEUA 2AF8A 4UB8H 4U0FA 2NZ2A 3HYBA 2FYUD 2GM4A 4CA3A 2K92A 5KP7B 1YQ4C 2J58A 3VMAA 1EZVD 1HUCA 3KZIH 3AEAC 4BPGA 5GTIH 2M0BA 1S1CX 4PWVB 1OVRA 1T6AA 4DJGA 1FU1A 1HTLC 1SQXD 2WZ7A 2PEJA 1FAVA 3A5TA 1OVVA 2QM7A 5CCGC 2CWOA 2PNGA 1MFZA 3S4RA 2JGPA 1NAFA 2IBZG 1SQBG 2KGEA 2LXBA 3SWFA 2KWLA 1SQBE 2Y0DA 1G2CB 3VMXA 1Y9BA 3WBHA 1OW7A 3A0BH 1SQPD 1OR5A 2AXTE 2N5IA 3RG2A 3U43A 1NTMG 3L71J 1KQFB 2SPZA 4PV1B 2ERHA 3CXHI 2W83C 4R0MA 1QGKB 5EJDA 1BCCJ 4COPA 1LP1A 4H13C 1P84H 1NU1J 2JU2A 3B5NB 3HD7C 2KORA 3NFQA 3EFFK 1IJDB 2IFMA 4N78D 3AE5C 2JU1A 2VLPA 3RBXA 2LPKA 1L0HA 3M91A 2AEFA 1NOHA 5KJ7C 1S72P 2OARA 1GU5A 2FXOA 2I1KA 3CCMP 3AE3C 3HUSC 1HGVA 2LIUA 3DPHA 4JBZA 4W7YA 1KC8Q 4WVZA 3Q5PA 3T97A 2WSFJ 4IFMA 3L74J 3MTUE 4BRYA 2BUOA 3E7KA 2QJKC 5HGOA 3A2AA 3P8CE 3GG2A 2N1TA 1FZCC 2AFDA 2L4BA 3D6ZA 1NU1K 1JO5A 2FADA 2CK3H 2POHA 4PV1D 5B66H 2GUVA 1BDCA 1AF8A 2E76C 3CI9A 2K9JA 1NTKJ 3G9RA 5KAFH 1L2PA 3CWBG 4HKZH 2AFEA 3CWBE 2FYNC 1GPJA 3CMAP 2JO0A 3AECC 2Q6QA 2BQ1E 3V2QA 4BXLA 2OTLP 5APUA 1WMKA 2Y0EA 4JF7A 4LLHA 1NU1D 3N4XA 1RF1B 1LJ2A 2FFDB 3U1CA 1PP9D 2Y9ZA 1IC2A 3CCEP 2O01H 2KUBA 5APSA 4U0CA 1OW8A 4U0DA 2A45G 1EIAA 2K93A 4H44B 3L70J 4XE5B 1MKMA 3P8CD 3VMZA 2YKPA 1IFPA 3A0HH 3H1HG 4DG9A 1NTKK 3FWNA 1VF5C 2HR3A 1PZQA 4HB1A 3DTJA 1GK6A 1EXJA 5KLIB 2YMYA 2LIWA 4K3AA 2BCCJ 1NJIQ 2FQ2A 1HGZA 1U57A 3CXHD 5CHXA 4I7ZB 2H43A 3E1RA 4PH0A 3OW2O 2XKMA 3Q2YA 4OWFA 1EMVA 2E42A 1IFNA 2PEIA 3H1LJ 3C9IA 1N7SB 2PFXA 3KQGA 1MUUA 4NPFX 3SWKA 3L73J 5KAIE 2YNYA 3O8ZA 2FBWC 5CZDB 3G3ZA 2M8NA 1LT9C 2DNWA 1M57D 1BDDA 1QRJA 5K5GB 3V5BA 2D2CC 1NHLA 1ZNVA 1YITP 4H44D 1J1EB 3S1KA 1LWUC 1QLED 1RE4C 4C46A 2MR7A 2IYPA 3L36A 3Q5RA 1KQSO 4PXHB 2AXCA 2LKMA 4LC1A 3GJNA 3NTEA 2JR8A 3CCRP 5F2NA 1GXGA 4WB4A 3WMM0 1A43A 3PP5A 1KFNA 2ZYAA 3TGUD 1P84I 1USDA 2LR2A 1AUMA 3TDKA 1LNQA 2GZJA 4U0AA 1IFMA 5EW5E 1IK7A 4PD4E 2N5HA 3TYYA 2N6ZA 2JBGA 2O1JA 4COCA 2YO3A 4H13B 4MN4C 1M56D 5AW7B 3HZQA 4HJGH 3DS2A 2W90A 2KNCB 3HD7B 4OGQB 1AJYA 1L0NJ 4DT0A 3Q1MA 3S9OA 3GF7A 3AEDC 1CEIA 5APYA 1M74A 2M8LA 2PAJA 1K73Q 3IN6A 2YIUC 3HUSB 2KOSA 4BWNA 1AFOA 5B5EE 1NTZJ 1FS0E 1SQQG 1SFCA 1SQQE 1RF1A 3CCSP 3PTZA 3SFEC 2FFDA 2JJLA 4ASVA 1FZCB 2V7QH 2L0QA 5EFWB 4WY4C 1VL2A 4R4LA 2MJZA 1FE6A 1ZP0C 1T3JA 1H0TA 3GMAA 4K35A 1Q90D 1L0NK 1Q82Q 2HPCA 2E76B 1VPCA 5DJUB 1K04A 1EXIA 3IAOA 2GUSA 4PD4D 3GLMA 2YMKA 3LIEA 5AW9B 4OGQD 5E79H 1J1DB 5GTHE 2OYHA 2CGQA 1NTZK 2OQQA 1BSNA 3DS1A 2IZ1A 2RKLA 2R3CA 2MD9A 2ZVNB 1SQVG 2A45H 3V2RA 2HG5D 2KB7P 5APXA 1NO4A 2HYNA 2E74C 4NPDA 4CPGA 4U0BA 2R5DA 4F37A 2R32A 2VLOA 2QNWA 1VQMP 1QL2A 2M5AB 4EOTA 1GL2C 1L0LJ 1LTJC 1BE3J 5DCKA 1LGHB 1VF5B 5AVWB 2E5TA 1VQLP 3H1KG 3H1KE 1W2EA 2A06D 1FDOA 3FWLA 2FYUJ 1QVGO 1GTWA 1ZV8A 2O01J 1NAYA 5KAIH 1FZEA 4YXDC 5KLVG 5JPAA 4B86A 5KLVE 1X8YA 2LMLA 4R4MA 2LXCB 3H1JG 3FXDA 1T2KD 3H1JE 3MUDC 1KILD 1QX8A 2N9BA 2O01N 4UB6E 5F2KA 3M0DA 3FGAD 2JWDA 3WUUA 1YQ3C 5KP6B 1MFTA 1LT9B 1L0LK 4H0LC 1SQPJ 2Q1KA 3H32B 2FXPA 1N73B 1PPJD 1URQD 1BGYE 1OFCX 1XTCC 2W27A 2FVAA 2VSQA 1UIXA 5HGMA 2ZT9C 3L4FA 2ZXXA 2DW3A 2Z45A 3FX0A 2FYUK 2KZJA 2KNCA 1VF5D 1OXZA 5AW8B 4LGDE 3CD6P 2UWJE 2AVAA 2VRSA 2KYVA 2IPPA 2LL8A 2L91A 2J5UA 2JP3A 5TISE 1GW4A 2G8YA 3KXDA 5BS2A 5CJ0A 2WSSH 4WYMA 3IF4A 3Q3DA 1GDTA 2Q9IA 3HTKA 1VQ6P 4I2LC 3BASA 4PD4H 2KOOA 3C8VA 2N9YB 1SQPK 3CCQP 1EQ7A 3BCCG 2M5RA 2K2QA 2M8PA 3BCCE 4OH8B 4ZKPA 1VQ9P 2FHSC 5L8RJ 1JY3O 1K8AQ 2EG5A 2KOQA 1VDFA 3OA7A 1G1JA 1SLQA 2PY8A 2KOPA 4QMAA 2XNDH 1DX7A 1SQBJ 1RO2A 2Z46A 2QEXP 1Y47A 1RF0A 4PJ0E 4HKGA 1BGYD 2H88C 4U3FG 3P8MC 2JO1A 3WU2E 2IBZE 2KXPB 3G0VA 5B5EH 1JB0J 3L72D 5M1BA 3RK2C 4M3LA 2WWWA 1DV5A 1JTHA 2I1JA 4ZNCA 1NTME 2XU6A 3CE7A 1JY2P 3HE4B 1HJBA 1KILA 3G4SP 4BPHA 3M9QA 2K0DX 2R44A 2WPSA 1IMQA 5CCHC 5HGNA 4C7NB 1PP9J 1OVUA 3K5BA 1URQA 3EQ2A 1SQBK 1VQ8P 1Q86Q 3O6QB 1HY8A 3NXSA 4W80A 1RH5B 3L71G 5GTHH 3L71E 1OIPA 2LOLA 2KLUA 2QJPC 5AVYB 1BCCG 2QIWA 3TSIA 1NKZB 1FZAA 3R2PA 4IFDK 2Y0CA 1FDMA 2ZYDA 2A45I 3PRJA 3G26A 1FOSF 2HLOA 2CNRA 1EC5A 2FACA 1NYHA 3DS4A 2IBZD 3BRVB 2V7QJ 2MKVA 1H88A 1SQBD 2QJYC 3TK1A 2QG4A 1PGJA 2P2UA 2IYOA 3MD0A 3DS5A 2K1AA 3AE7C 3WUTA 1NTMD 4KJMA 2XV5A 3B71A 3B5ND 2LF4A 1DIPA 1DD4A 3KHUA 3G6EP 1RE3A 2P58A 1N73A 4A7PA 1AVOA 2CG5B 1LTTC 1HBWA 4DCKA 1LTIC 4RJTA 2AEJA 2P7JA 1PEMA 2NPSB 3V6IA 2PGDA 3L75G 4N6JA 1M7LA 1QVFO 4EIJA 3L75E 3AE9C 4UB6H 1ZW0A 3CX5E 3R4YA 1BSHA 2NRGA 1E0HA 2B87A 4XRQA 3GHGA 1FZGA 4BPFA 5APQA 3H1HE 5HGLA 1FZBA 3VP8A 3TGUJ 2WSCH 2QRXA 4Y99C 1JY2O 2E75C 4H0LB 3KDPB 1X9VA 3V2NA 1GU4A 1Q2NA 3L35A 2OYIB 3QWOC 1IZNB 2XV6A 2ZT9B 1EOQA 5AW0B 3CC2P 3L70G 3G1IA 3MHVA 3CWBD 3L70E 5TISH 1VQOP 2QVAA 3MIWA 1YI2P 2PEQA 4PD4I 2NPSD 1CW5A 1G2CA 1RHZB 1PEQA 2N1TC 2E5YA 1H8AA 4L73A 3RK3C 5KKZC 1X3OA 2BCCG 3HE4A 3L75D 1FBMA 3B5IA 2Q5UA 2EIAA 1VQKP 3CX5D 1NKNA 2PEMA 1NQ4A 1HJ0A 3B5NA 3GZLA 2VLNA 1PFIA 2KG8A 3H1LG 1PGOA 3ZDMA 2KGCA 3H1LE 4PJ0H 5AVTB 3W68A 1MV8A 1R8EA 4H0LD 2KI7B 1VQPP 3H1HD 2ZAEB 1F80D 5APWA 3I5CA 2KSJA 1W2BO 1UIIA 1GD2E 1H89A 2AXTH 3MZWB 2K88A 4OVNF 2Y9YA 1M6NA 1T8ZA 1N7SD 2IDBA 4UHPB 2YXQB 4RKUJ 2ZXEB 3IFMA 3B8EB 3OJAB 3NMDA 2K3RA 2N98A 3AE4C 3E1IA 1KN7A 3PH0A 1T3UA 1NGMB 1QL1A 3I56P 2ROQA 2YKOA 1WT6A 4QNBA 2MY5A 3EWKA 3LMOA 2KR5A 5CMZA 3PJSK 2XNXA 3USSA 2GZGA 3SFDC 5AW6B 4JPZB 2H7HA 1ZN5A 3RGUA 5HVCA 3AE1C 5BS1A 1U7JA 2QJPB 2CPSA 2OTKE 3WUVA 3RL0g 2C0XA 5BU8B 5CCGD 2NPSA 1NWQA 1L4AC 2QJKB 2EFJA 1DEBA 1GZLA 5KP8B 3MGNA 5AVVB 4I1LA 3AEBC 1L0NG 2PEKA 1G1IA 2OGUA 2KGAA 1KTMA 4DZOA 2GZEA 1HH0A 2W6AA 2K94A 3GKLC 3M9HA 4JQ0D 1WRGA 2WITA 2QA4P 4H13D 1JCDA 5CBNA 1NTZG 1CSBA 3HD7D 1NTZE 1S4XA 1PGPA 1BAJA 1P84E 2EHSA 2FYNB 2GZFA 1JY3N 4ZMDA 2OYIA 5KJ7D 1LTSC 3CX5H 2L22A 1SQVE 1EDJA 1JM0A 1KB9E 1N7SA 5BVZA 2JEEA 2H89C 4XFJA 3DS0A 2W8ZA 2JWAA 1SQQD 2O3JA 1S5LX 1LP1B 3B4QA 3M1MA 1FDIA 2JKVA 2LKIA 3CCJP 3AEGC 4IPYA 2JYLA 2E76D 1VQ7P 3JCUE 2J59M 5AVUB 1E79H 3JC22 5AW5B 3H1JJ 5AVRB 3AE2C 1KD1Q 3I55P 2PEOA 3RL0C 3T97B 3F5HA 1SFCC 5CCGA 1RF1C 1PV3A 2FFDC 2YKQA 1BGYJ 4GT1A 2WPTA 1YIJP 2WPVB 2N1TB 2WSCJ 2KIKA 3L72J 2KZIA 1SQVD 2N50A 2FYUG 2FYUE 1ZRTE 2D2CB 2I8DA 1EZVG 1EZVE 4D6TG 4L75A 2IBZI 4D6TE 1U7MA 1LWUB 2FKWB 4XROA 2Z5HA 5KLIC 2RH0A 5KTBA 4W7ZA 3HD7A 1SQXG 2JDIH 1SQXE 4AYCA 1JEKA 2OYHC 3A0HE 2BEZF 3Q5SA 2E43A 3CCLP 2ZFCA 1X79B 1GK4A 5KJ7A 2Z4EA 2KGDA 3H1KD 3V2PA 4GDOA 1SQPG 2R3SA 4IL6X 1M1KQ 2Q3EA 3HUSA 4XFXA 4XFZA 3B4SA 1HWTC 3DS3A 3SSUA 1R5LA 1YBKA 2M3BA 4M0IA 1KYOE 4AUWA 1IUQA 2CPBA 1LT1A 5KLVD 1M1JC 3JSVC 3H1IG 1N8RQ 2Q7CA 3H1IE 2QE7H 4WWIA 1GXHA 1LTGC 5AW4B 2KG6A 3H1JD 3VYIA 1EDIA 1KV4A 4U0EA 1A8OA 1S2EA 5DJTB 1IK9A 1D7MA 1X22A 1FZCA 3CLQA 1S3JA 1FR2A 2GZIA 2D2CD 2HODB 1FJKA 2L6EA 1SS1A 3CC7P 3W67A 1ZRTD 1NTMJ 4U3FE 3BATA 2MR8A 2AEMA 1HVVA 4D6TD 1N2DC 1NVOA 3V4WA 1JY2N 4GKGA 2FXMA 2FVEA 3KPEA 1IO4A 3RBZA 1A02F 1R5SA 1Y8AA 4GOEA 1VKUA 1XTGB 1LTAC 2YIUB 3V4QA 1ZOYC 4HYTB 3G21A 3TNUB 1YTZT 3M0DC 1E5WA 1L4AB 3M06A 4L76A 4YTPC 2MVVA 1GW3A 2GA1A 2OTJP 1KYOD 2V4HA 2JQ4A 2M5AA 4WY4B 2KODA 2KS1B 4IFFA 3EFGA 2KLVA 2WPRA 5H2FE 3G71P 3H1ID 3BCCD 2WPQA 3CXCO 1NTMK 1YJNP 1DNYA 4OGQC 1UNKA 4XFYA 2WSEH 3LIDA 3CX5I 1BCCE 4GR6A 4XA4A 3H25A 2M8RA 1NU1G 1NU1E 3H4EA 2FYZA 1KB9H 1Z56A 3HRNA 4U7JA 2B88A 4GIFA 3CCVP 1PP9G 2BEQD 1KQGB 4YXWH 1PP9E 2ZVOB 3VRLC 4U3FD 1T8KA 1AQ5A 3HE5B 3NY7B 1JJ2O 1JNMA 5BU5A 1QEXA 5AVXB 3CWBJ 3RG6C 2Z5IA 2X2BA 1L4AD 2E74B 1JUNA 3L74G 3P7KA 4ZKUA 5C39A 1LT9A 3L74E 3C1LA 1SVFA 3H32A 3JCUH 1YJWP 2FAEA 1GL2B 1DEEG 1OZHA 1J2JB 4WY4D 1ZR4A 3L75J 1LTJB 1RF0C 2ZJSE 1LWUA 2FY8A 3CXHE 4N3YB 1RE4A 3D71A 4RESB 2QM8A 1J1DC 1IFJA 2JAZA 2K9YA 3L71D 4H2WC 2WT7B 1KZUB 3VTPC 3VP9A 3H1HJ 1NTKG 1NTKE 1BCCD 1DD3A 1T2KC 1KILC 4PH1A 5E79E 3RL0B 3G1GA 3G29A 3EJEA 3CMEP 2R5BA 3UIAA 3LW5H 2K5XA 3U1AA 3IR9A 2W6BA 1SFCB 2XDJA 2IFNA 1KFMA 1DH3A 1L0IA 3SWYA 5F2OA 2XXMA 1URQC 2E74D 3PHLA 2P10A 3MGEA 1S5LE 4NPEA 2RMZA 2EHTA 1H0TB 2M3EA 1HQBA 1GL2D 2HPCB 4I6MC 1YYCA 3H0DA 2HODA 1FJPA 3L74D 2B89A 2FVFA 1AA0A 3CCUP 2KSEA 1RNIA 1CI6B 2OYHB 3H6PA 3D6YA 3TGUG 1KYOH 3TGUE 2PP6A 2XT1A 1IMPA 4KT0J 3AEFC 1HF9A 2BCCE 2G3AA 2VLQA 1IFDA 3RL0D 1ZMBA 4HH2A 3TNUA 1SFCD 1PIXA 1L4AA 1X0TA 5AW1B 1NTKD 1YTZI 2GDXA 3CPWO 1M1JB 1VQNP 4GODA 1N86A 1OW6A 1RE3C 4C7NA 1Z6MA 1AYIA 5AVZB 1N73C 2CQ8A 3L73G 3WU2H 3L73E 4WY4A 3II6A 1ZR2A 2KS1A 3GF3A 3O6QA 1ACPA 1KORA 2ZYGA 2ZT9D 4RO0A 2KW2A 1USEA 3P05A 3QH9A 1ZLLA 5APVA 3RK2B 2DGYA 3L70D 4IL6E 4ASWA 3GHGC 2WMMA 3HE5A 3CC4P 2PENA 4MRTC 1PGQA 2P67A 1JCCA 2WQYC 4C7RA 5H2FH 2L5GB 1A02J 2NO8A 2ITAA 4TLFA 2BCCD 1KQLA 2N6YA 1PEOA 1E6JP 3U59A 3A7OA 4YPCA 3BVHA 5CBOA 5AW2B 2QSIA 1SQQJ 3NTNA 1GL2A 4UB8E 1KB9I 1N7LA 1LTJA 1EDKA 4O9BA 1OMIA 3H1LD 2BHVA 3AE8C 1TU3F 2O1KA 3KZIE 3L73D 2H8PD 1LTBC 5GTIE 1KLPA 4EI2A 3D70A 3FXEA 1ZMEC 2E1MA 2WT7A 1MZ9A 1JOCA 5AVSB 7CEIA 1MZ8A 1L0NE 2XZRA 3RK2D 2GDYA 4PV1C 2IX7C 3HTKB 2WSFH 3LRYA 3PLNA 2QJYB 3A0BE 3MUDA 5APTA 3A3YB 1M6EX 2KG9A 2C0WA 3B5NC 4H2XC 2WSEJ 2MF4A 1RO0A 1SQQK 3CXHH 5CCHD 1FC2C 1K05A 4H2YC 2XZ1C 1SQVJ 2A06G 2A06E 5CJ4A 1S9KE 3AEEC 3EJDA 4GOFA 2IZ0A 3VOPA 2K0YA 2Z44A 4L74A 4Z1MH 2W6JH 2GDWA 2YO2A 1CI6A 3P32A 1FOSE 1KILE 4TT3H 4JYBA 1JTHB 1EZVI 1RQUA 4EYYQ 1GMJA 1AVYA 2XZ0D 1KILB 1JY3P 3H1KJ 3MP7B 2OYOA 4IOIH 1VQ4P 3CL3D 1PPJG 1PPJE 1IFIA 1S5LH 3E2DA 2FQ1A 1L0ND 1M90Q 1M1JA 1SQVK 4Y99B 1URQB 5KLVJ 1CZQA 1PL5A 1Q81Q 2E75B 5B66E 3BRTB 1D1DA 1K9MQ 1AV1A 2FQ0A 2B9BA 4WBAA 3F89A 2JYGA 1KYOI 1SP4A 3M0AA 2KOGA 1EDLA 1NTZD 1JMBA 2K37A 5KAFE 1P84D 1L0LG 1NH4A 3LW5J 2NPSC 1YJ9P 2BASA 4AQRD 1L0LE 4BRYB 2L9FA 5AVQB 1S9KD 2JB0A 1BE3G 1OX3A 3M9BA 3Q20A 5HV8A 1ZXGA 1BE3E 4JYCA 3RK3E 2KK7A 1VQ5P 3EJBA 1JMMA 4D6TJ 3TF5A 3ABVC 1UJZA 4QKOA 3KYQA 1KMIZ 3VN0A 2P1JA 2GYKA 3RK3B 1BXIA 4H44C 1KB9D 5KKZB 3G28A 1SQXJ 1VHNA 3GW6A 3VMYA 1RY3A 1K30A 1OWAA 1M8OB 4Y28J 5TJHA 4EDFA 1AQTA 2ONTA 5KLVK 4IZ6A 1RQVA 2K9JB 1W5CE
chains in the Genus database with same CATH topology
2PEQA 3DS5A 3DS3A 2OTLP 1RO2A 5I4TG 3H47A 2Z46A 4M0IA 2BQ1E 3M1MA 1PEQA 5JPAA 3MGEA 2QEXP 2Z44A 1KQSO 3H4EA 3CC4P 3CCJP 1IUQA 2PENA 4COPA 3CCVP 2LF4A 1YHQP 1N8RQ 5BS1A 4IPYA 3H0DA 3G6EP 2JYLA 3VRLC 4U0EA 1A8OA 3G0VA 1VQ7P 3CCEP 5F2KA 3B5IA 1Q82Q 2EIAA 3CCUP 1VQKP 1PEOA 1JJ2O 1E6JP 4U0CA 1KD1Q 4U0DA 2PEMA 2EFJA 1RNIA 3NTEA 3RG6C 3I55P 1EIAA 1VQ4P 1Q7YQ 2L6EA 3CCRP 5F2NA 2PEKA 2P9XA 1S72P 2OARA 1A43A 2PEOA 3E2DA 3G4SP 3CC7P 1PEMA 2XT1A 1M90Q 1AUMA 3CCMP 1QVFO 1VQPP 2BHVA 5HGMA 3DTJA 3DPHA 4U0AA 1KC8Q 1Q81Q 1YJWP 4GR2A 1ZMBA 2Z45A 5HGNA 3DS1A 1D1DA 1K9MQ 1YIJP 2QA4P 2BUOA 1W2BO 2E1MA 1NJIQ 5HGOA 3CPWO 2JYGA 1PEUA 1VQNP 4COCA 4XRQA 1VQ8P 3CD6P 4U0FA 1Q86Q 1BAJA 3HZQA 1M6NA 3HYBA 3G21A 3DS2A 4PH0A 3OW2O 1YJ9P 5HGLA 3LRYA 4U0BA 3Q20A 4XROA 5BS2A 2PEIA 1M6EX 4WYMA 1VQMP 1VQ5P 1VQ6P 4PH1A 1M74A 3G1GA 1RO0A 3G29A 3G26A 2PEJA 5DCKA 2M8LA 2M8NA 3CMEP 2OTJP 3P05A 2CWOA 1K73Q 2KODA 3CCQP 3CCLP 2M8PA 3G28A 3I56P 1QRJA 1VQLP 3DS4A 1K30A 2XV6A 4QNBA 3G71P 3CXCO 3DS0A 1EOQA 1YJNP 3CC2P 3G1IA 1VQ9P 1K8AQ 2ONTA 1YITP 2EG5A 4XFYA 1M1KQ 5F2OA 3WBHA 3CMAP 2JO0A 2XXMA 1VQOP 2DGYA 1QVGO 3CCSP 4XFXA 4XFZA 2PY8A 4GR6A 1YI2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 P;  1W2B O;  2OTL P;  3I55 P;  1NJI Q;  1VQ4 P;  1Q7Y Q;  3CCR P;  3CPW O;  2QEX P;  3CME P;  2OTJ P;  1KQS O;  1VQN P;  3CC4 P;  3CCJ P;  1S72 P;  1K73 Q;  3G4S P;  1VQ8 P;  3CC7 P;  1Q86 Q;  3CD6 P;  3CCQ P;  3CCL P;  3CCV P;  1YHQ P;  3I56 P;  1M90 Q;  1N8R Q;  1VQL P;  3CCM P;  3G6E P;  3G71 P;  3OW2 O;  1QVF O;  1VQP P;  1YJ9 P;  3CXC O;  1YJN P;  3CC2 P;  1VQ7 P;  1VQ9 P;  1KC8 Q;  1K8A Q;  3CCE P;  1YIT P;  1Q81 Q;  1M1K Q;  1YJW P;  3CMA P;  1QVG O;  1VQO P;  1Q82 Q;  1VQM P;  1VQK P;  3CCS P;  3CCU P;  1K9M Q;  1YIJ P;  1JJ2 O;  1VQ5 P;  2QA4 P;  1KD1 Q;  1YI2 P; 
#chains in the Genus database with same CATH topology
 2WVR A;  5CCH A;  5I4T G;  3H47 A;  1BGY G;  2C9N Y;  2Q3I A;  2C9L Y;  3AE6 C;  2E75 D;  1YHQ P;  2OYI C;  4I7Z C;  2WTY A;  3L72 G;  2K0X A;  2HFE D;  3L72 E;  5AW3 B;  4NEO A;  1SQP E;  3H1I J;  4DOJ A;  3BCC J;  1N7S C;  4IL6 H;  3L37 A;  1Q7Y Q;  2P9X A;  2RN0 A;  3OAK A;  1SQX K;  1L0L D;  1FZF A;  2N1T D;  2KP8 A;  2PRR A;  3N7N A;  4GR2 A;  1BE3 D;  2B87 B;  3RK3 D;  3GHG B;  4KHX A;  4N78 E;  4U3F J;  1J1E C;  2MVU A;  2LTE A;  3GZM A;  2YXR B;  3ITK A;  1PEU A;  2AF8 A;  4UB8 H;  4U0F A;  2NZ2 A;  3HYB A;  2FYU D;  2GM4 A;  4CA3 A;  2K92 A;  5KP7 B;  1YQ4 C;  2J58 A;  3VMA A;  1EZV D;  1HUC A;  3KZI H;  3AEA C;  4BPG A;  5GTI H;  2M0B A;  1S1C X;  4PWV B;  1OVR A;  1T6A A;  4DJG A;  1FU1 A;  1HTL C;  1SQX D;  2WZ7 A;  2PEJ A;  1FAV A;  3A5T A;  1OVV A;  2QM7 A;  5CCG C;  2CWO A;  2PNG A;  1MFZ A;  3S4R A;  2JGP A;  1NAF A;  2IBZ G;  1SQB G;  2KGE A;  2LXB A;  3SWF A;  2KWL A;  1SQB E;  2Y0D A;  1G2C B;  3VMX A;  1Y9B A;  3WBH A;  1OW7 A;  3A0B H;  1SQP D;  1OR5 A;  2AXT E;  2N5I A;  3RG2 A;  3U43 A;  1NTM G;  3L71 J;  1KQF B;  2SPZ A;  4PV1 B;  2ERH A;  3CXH I;  2W83 C;  4R0M A;  1QGK B;  5EJD A;  1BCC J;  4COP A;  1LP1 A;  4H13 C;  1P84 H;  1NU1 J;  2JU2 A;  3B5N B;  3HD7 C;  2KOR A;  3NFQ A;  3EFF K;  1IJD B;  2IFM A;  4N78 D;  3AE5 C;  2JU1 A;  2VLP A;  3RBX A;  2LPK A;  1L0H A;  3M91 A;  2AEF A;  1NOH A;  5KJ7 C;  1S72 P;  2OAR A;  1GU5 A;  2FXO A;  2I1K A;  3CCM P;  3AE3 C;  3HUS C;  1HGV A;  2LIU A;  3DPH A;  4JBZ A;  4W7Y A;  1KC8 Q;  4WVZ A;  3Q5P A;  3T97 A;  2WSF J;  4IFM A;  3L74 J;  3MTU E;  4BRY A;  2BUO A;  3E7K A;  2QJK C;  5HGO A;  3A2A A;  3P8C E;  3GG2 A;  2N1T A;  1FZC C;  2AFD A;  2L4B A;  3D6Z A;  1NU1 K;  1JO5 A;  2FAD A;  2CK3 H;  2POH A;  4PV1 D;  5B66 H;  2GUV A;  1BDC A;  1AF8 A;  2E76 C;  3CI9 A;  2K9J A;  1NTK J;  3G9R A;  5KAF H;  1L2P A;  3CWB G;  4HKZ H;  2AFE A;  3CWB E;  2FYN C;  1GPJ A;  3CMA P;  2JO0 A;  3AEC C;  2Q6Q A;  2BQ1 E;  3V2Q A;  4BXL A;  2OTL P;  5APU A;  1WMK A;  2Y0E A;  4JF7 A;  4LLH A;  1NU1 D;  3N4X A;  1RF1 B;  1LJ2 A;  2FFD B;  3U1C A;  1PP9 D;  2Y9Z A;  1IC2 A;  3CCE P;  2O01 H;  2KUB A;  5APS A;  4U0C A;  1OW8 A;  4U0D A;  2A45 G;  1EIA A;  2K93 A;  4H44 B;  3L70 J;  4XE5 B;  1MKM A;  3P8C D;  3VMZ A;  2YKP A;  1IFP A;  3A0H H;  3H1H G;  4DG9 A;  1NTK K;  3FWN A;  1VF5 C;  2HR3 A;  1PZQ A;  4HB1 A;  3DTJ A;  1GK6 A;  1EXJ A;  5KLI B;  2YMY A;  2LIW A;  4K3A A;  2BCC J;  1NJI Q;  2FQ2 A;  1HGZ A;  1U57 A;  3CXH D;  5CHX A;  4I7Z B;  2H43 A;  3E1R A;  4PH0 A;  3OW2 O;  2XKM A;  3Q2Y A;  4OWF A;  1EMV A;  2E42 A;  1IFN A;  2PEI A;  3H1L J;  3C9I A;  1N7S B;  2PFX A;  3KQG A;  1MUU A;  4NPF X;  3SWK A;  3L73 J;  5KAI E;  2YNY A;  3O8Z A;  2FBW C;  5CZD B;  3G3Z A;  2M8N A;  1LT9 C;  2DNW A;  1M57 D;  1BDD A;  1QRJ A;  5K5G B;  3V5B A;  2D2C C;  1NHL A;  1ZNV A;  1YIT P;  4H44 D;  1J1E B;  3S1K A;  1LWU C;  1QLE D;  1RE4 C;  4C46 A;  2MR7 A;  2IYP A;  3L36 A;  3Q5R A;  1KQS O;  4PXH B;  2AXC A;  2LKM A;  4LC1 A;  3GJN A;  3NTE A;  2JR8 A;  3CCR P;  5F2N A;  1GXG A;  4WB4 A;  3WMM 0;  1A43 A;  3PP5 A;  1KFN A;  2ZYA A;  3TGU D;  1P84 I;  1USD A;  2LR2 A;  1AUM A;  3TDK A;  1LNQ A;  2GZJ A;  4U0A A;  1IFM A;  5EW5 E;  1IK7 A;  4PD4 E;  2N5H A;  3TYY A;  2N6Z A;  2JBG A;  2O1J A;  4COC A;  2YO3 A;  4H13 B;  4MN4 C;  1M56 D;  5AW7 B;  3HZQ A;  4HJG H;  3DS2 A;  2W90 A;  2KNC B;  3HD7 B;  4OGQ B;  1AJY A;  1L0N J;  4DT0 A;  3Q1M A;  3S9O A;  3GF7 A;  3AED C;  1CEI A;  5APY A;  1M74 A;  2M8L A;  2PAJ A;  1K73 Q;  3IN6 A;  2YIU C;  3HUS B;  2KOS A;  4BWN A;  1AFO A;  5B5E E;  1NTZ J;  1FS0 E;  1SQQ G;  1SFC A;  1SQQ E;  1RF1 A;  3CCS P;  3PTZ A;  3SFE C;  2FFD A;  2JJL A;  4ASV A;  1FZC B;  2V7Q H;  2L0Q A;  5EFW B;  4WY4 C;  1VL2 A;  4R4L A;  2MJZ A;  1FE6 A;  1ZP0 C;  1T3J A;  1H0T A;  3GMA A;  4K35 A;  1Q90 D;  1L0N K;  1Q82 Q;  2HPC A;  2E76 B;  1VPC A;  5DJU B;  1K04 A;  1EXI A;  3IAO A;  2GUS A;  4PD4 D;  3GLM A;  2YMK A;  3LIE A;  5AW9 B;  4OGQ D;  5E79 H;  1J1D B;  5GTH E;  2OYH A;  2CGQ A;  1NTZ K;  2OQQ A;  1BSN A;  3DS1 A;  2IZ1 A;  2RKL A;  2R3C A;  2MD9 A;  2ZVN B;  1SQV G;  2A45 H;  3V2R A;  2HG5 D;  2KB7 P;  5APX A;  1NO4 A;  2HYN A;  2E74 C;  4NPD A;  4CPG A;  4U0B A;  2R5D A;  4F37 A;  2R32 A;  2VLO A;  2QNW A;  1VQM P;  1QL2 A;  2M5A B;  4EOT A;  1GL2 C;  1L0L J;  1LTJ C;  1BE3 J;  5DCK A;  1LGH B;  1VF5 B;  5AVW B;  2E5T A;  1VQL P;  3H1K G;  3H1K E;  1W2E A;  2A06 D;  1FDO A;  3FWL A;  2FYU J;  1QVG O;  1GTW A;  1ZV8 A;  2O01 J;  1NAY A;  5KAI H;  1FZE A;  4YXD C;  5KLV G;  5JPA A;  4B86 A;  5KLV E;  1X8Y A;  2LML A;  4R4M A;  2LXC B;  3H1J G;  3FXD A;  1T2K D;  3H1J E;  3MUD C;  1KIL D;  1QX8 A;  2N9B A;  2O01 N;  4UB6 E;  5F2K A;  3M0D A;  3FGA D;  2JWD A;  3WUU A;  1YQ3 C;  5KP6 B;  1MFT A;  1LT9 B;  1L0L K;  4H0L C;  1SQP J;  2Q1K A;  3H32 B;  2FXP A;  1N73 B;  1PPJ D;  1URQ D;  1BGY E;  1OFC X;  1XTC C;  2W27 A;  2FVA A;  2VSQ A;  1UIX A;  5HGM A;  2ZT9 C;  3L4F A;  2ZXX A;  2DW3 A;  2Z45 A;  3FX0 A;  2FYU K;  2KZJ A;  2KNC A;  1VF5 D;  1OXZ A;  5AW8 B;  4LGD E;  3CD6 P;  2UWJ E;  2AVA A;  2VRS A;  2KYV A;  2IPP A;  2LL8 A;  2L91 A;  2J5U A;  2JP3 A;  5TIS E;  1GW4 A;  2G8Y A;  3KXD A;  5BS2 A;  5CJ0 A;  2WSS H;  4WYM A;  3IF4 A;  3Q3D A;  1GDT A;  2Q9I A;  3HTK A;  1VQ6 P;  4I2L C;  3BAS A;  4PD4 H;  2KOO A;  3C8V A;  2N9Y B;  1SQP K;  3CCQ P;  1EQ7 A;  3BCC G;  2M5R A;  2K2Q A;  2M8P A;  3BCC E;  4OH8 B;  4ZKP A;  1VQ9 P;  2FHS C;  5L8R J;  1JY3 O;  1K8A Q;  2EG5 A;  2KOQ A;  1VDF A;  3OA7 A;  1G1J A;  1SLQ A;  2PY8 A;  2KOP A;  4QMA A;  2XND H;  1DX7 A;  1SQB J;  1RO2 A;  2Z46 A;  2QEX P;  1Y47 A;  1RF0 A;  4PJ0 E;  4HKG A;  1BGY D;  2H88 C;  4U3F G;  3P8M C;  2JO1 A;  3WU2 E;  2IBZ E;  2KXP B;  3G0V A;  5B5E H;  1JB0 J;  3L72 D;  5M1B A;  3RK2 C;  4M3L A;  2WWW A;  1DV5 A;  1JTH A;  2I1J A;  4ZNC A;  1NTM E;  2XU6 A;  3CE7 A;  1JY2 P;  3HE4 B;  1HJB A;  1KIL A;  3G4S P;  4BPH A;  3M9Q A;  2K0D X;  2R44 A;  2WPS A;  1IMQ A;  5CCH C;  5HGN A;  4C7N B;  1PP9 J;  1OVU A;  3K5B A;  1URQ A;  3EQ2 A;  1SQB K;  1VQ8 P;  1Q86 Q;  3O6Q B;  1HY8 A;  3NXS A;  4W80 A;  1RH5 B;  3L71 G;  5GTH H;  3L71 E;  1OIP A;  2LOL A;  2KLU A;  2QJP C;  5AVY B;  1BCC G;  2QIW A;  3TSI A;  1NKZ B;  1FZA A;  3R2P A;  4IFD K;  2Y0C A;  1FDM A;  2ZYD A;  2A45 I;  3PRJ A;  3G26 A;  1FOS F;  2HLO A;  2CNR A;  1EC5 A;  2FAC A;  1NYH A;  3DS4 A;  2IBZ D;  3BRV B;  2V7Q J;  2MKV A;  1H88 A;  1SQB D;  2QJY C;  3TK1 A;  2QG4 A;  1PGJ A;  2P2U A;  2IYO A;  3MD0 A;  3DS5 A;  2K1A A;  3AE7 C;  3WUT A;  1NTM D;  4KJM A;  2XV5 A;  3B71 A;  3B5N D;  2LF4 A;  1DIP A;  1DD4 A;  3KHU A;  3G6E P;  1RE3 A;  2P58 A;  1N73 A;  4A7P A;  1AVO A;  2CG5 B;  1LTT C;  1HBW A;  4DCK A;  1LTI C;  4RJT A;  2AEJ A;  2P7J A;  1PEM A;  2NPS B;  3V6I A;  2PGD A;  3L75 G;  4N6J A;  1M7L A;  1QVF O;  4EIJ A;  3L75 E;  3AE9 C;  4UB6 H;  1ZW0 A;  3CX5 E;  3R4Y A;  1BSH A;  2NRG A;  1E0H A;  2B87 A;  4XRQ A;  3GHG A;  1FZG A;  4BPF A;  5APQ A;  3H1H E;  5HGL A;  1FZB A;  3VP8 A;  3TGU J;  2WSC H;  2QRX A;  4Y99 C;  1JY2 O;  2E75 C;  4H0L B;  3KDP B;  1X9V A;  3V2N A;  1GU4 A;  1Q2N A;  3L35 A;  2OYI B;  3QWO C;  1IZN B;  2XV6 A;  2ZT9 B;  1EOQ A;  5AW0 B;  3CC2 P;  3L70 G;  3G1I A;  3MHV A;  3CWB D;  3L70 E;  5TIS H;  1VQO P;  2QVA A;  3MIW A;  1YI2 P;  2PEQ A;  4PD4 I;  2NPS D;  1CW5 A;  1G2C A;  1RHZ B;  1PEQ A;  2N1T C;  2E5Y A;  1H8A A;  4L73 A;  3RK3 C;  5KKZ C;  1X3O A;  2BCC G;  3HE4 A;  3L75 D;  1FBM A;  3B5I A;  2Q5U A;  2EIA A;  1VQK P;  3CX5 D;  1NKN A;  2PEM A;  1NQ4 A;  1HJ0 A;  3B5N A;  3GZL A;  2VLN A;  1PFI A;  2KG8 A;  3H1L G;  1PGO A;  3ZDM A;  2KGC A;  3H1L E;  4PJ0 H;  5AVT B;  3W68 A;  1MV8 A;  1R8E A;  4H0L D;  2KI7 B;  1VQP P;  3H1H D;  2ZAE B;  1F80 D;  5APW A;  3I5C A;  2KSJ A;  1W2B O;  1UII A;  1GD2 E;  1H89 A;  2AXT H;  3MZW B;  2K88 A;  4OVN F;  2Y9Y A;  1M6N A;  1T8Z A;  1N7S D;  2IDB A;  4UHP B;  2YXQ B;  4RKU J;  2ZXE B;  3IFM A;  3B8E B;  3OJA B;  3NMD A;  2K3R A;  2N98 A;  3AE4 C;  3E1I A;  1KN7 A;  3PH0 A;  1T3U A;  1NGM B;  1QL1 A;  3I56 P;  2ROQ A;  2YKO A;  1WT6 A;  4QNB A;  2MY5 A;  3EWK A;  3LMO A;  2KR5 A;  5CMZ A;  3PJS K;  2XNX A;  3USS A;  2GZG A;  3SFD C;  5AW6 B;  4JPZ B;  2H7H A;  1ZN5 A;  3RGU A;  5HVC A;  3AE1 C;  5BS1 A;  1U7J A;  2QJP B;  2CPS A;  2OTK E;  3WUV A;  3RL0 g;  2C0X A;  5BU8 B;  5CCG D;  2NPS A;  1NWQ A;  1L4A C;  2QJK B;  2EFJ A;  1DEB A;  1GZL A;  5KP8 B;  3MGN A;  5AVV B;  4I1L A;  3AEB C;  1L0N G;  2PEK A;  1G1I A;  2OGU A;  2KGA A;  1KTM A;  4DZO A;  2GZE A;  1HH0 A;  2W6A A;  2K94 A;  3GKL C;  3M9H A;  4JQ0 D;  1WRG A;  2WIT A;  2QA4 P;  4H13 D;  1JCD A;  5CBN A;  1NTZ G;  1CSB A;  3HD7 D;  1NTZ E;  1S4X A;  1PGP A;  1BAJ A;  1P84 E;  2EHS A;  2FYN B;  2GZF A;  1JY3 N;  4ZMD A;  2OYI A;  5KJ7 D;  1LTS C;  3CX5 H;  2L22 A;  1SQV E;  1EDJ A;  1JM0 A;  1KB9 E;  1N7S A;  5BVZ A;  2JEE A;  2H89 C;  4XFJ A;  3DS0 A;  2W8Z A;  2JWA A;  1SQQ D;  2O3J A;  1S5L X;  1LP1 B;  3B4Q A;  3M1M A;  1FDI A;  2JKV A;  2LKI A;  3CCJ P;  3AEG C;  4IPY A;  2JYL A;  2E76 D;  1VQ7 P;  3JCU E;  2J59 M;  5AVU B;  1E79 H;  3JC2 2;  5AW5 B;  3H1J J;  5AVR B;  3AE2 C;  1KD1 Q;  3I55 P;  2PEO A;  3RL0 C;  3T97 B;  3F5H A;  1SFC C;  5CCG A;  1RF1 C;  1PV3 A;  2FFD C;  2YKQ A;  1BGY J;  4GT1 A;  2WPT A;  1YIJ P;  2WPV B;  2N1T B;  2WSC J;  2KIK A;  3L72 J;  2KZI A;  1SQV D;  2N50 A;  2FYU G;  2FYU E;  1ZRT E;  2D2C B;  2I8D A;  1EZV G;  1EZV E;  4D6T G;  4L75 A;  2IBZ I;  4D6T E;  1U7M A;  1LWU B;  2FKW B;  4XRO A;  2Z5H A;  5KLI C;  2RH0 A;  5KTB A;  4W7Z A;  3HD7 A;  1SQX G;  2JDI H;  1SQX E;  4AYC A;  1JEK A;  2OYH C;  3A0H E;  2BEZ F;  3Q5S A;  2E43 A;  3CCL P;  2ZFC A;  1X79 B;  1GK4 A;  5KJ7 A;  2Z4E A;  2KGD A;  3H1K D;  3V2P A;  4GDO A;  1SQP G;  2R3S A;  4IL6 X;  1M1K Q;  2Q3E A;  3HUS A;  4XFX A;  4XFZ A;  3B4S A;  1HWT C;  3DS3 A;  3SSU A;  1R5L A;  1YBK A;  2M3B A;  4M0I A;  1KYO E;  4AUW A;  1IUQ A;  2CPB A;  1LT1 A;  5KLV D;  1M1J C;  3JSV C;  3H1I G;  1N8R Q;  2Q7C A;  3H1I E;  2QE7 H;  4WWI A;  1GXH A;  1LTG C;  5AW4 B;  2KG6 A;  3H1J D;  3VYI A;  1EDI A;  1KV4 A;  4U0E A;  1A8O A;  1S2E A;  5DJT B;  1IK9 A;  1D7M A;  1X22 A;  1FZC A;  3CLQ A;  1S3J A;  1FR2 A;  2GZI A;  2D2C D;  2HOD B;  1FJK A;  2L6E A;  1SS1 A;  3CC7 P;  3W67 A;  1ZRT D;  1NTM J;  4U3F E;  3BAT A;  2MR8 A;  2AEM A;  1HVV A;  4D6T D;  1N2D C;  1NVO A;  3V4W A;  1JY2 N;  4GKG A;  2FXM A;  2FVE A;  3KPE A;  1IO4 A;  3RBZ A;  1A02 F;  1R5S A;  1Y8A A;  4GOE A;  1VKU A;  1XTG B;  1LTA C;  2YIU B;  3V4Q A;  1ZOY C;  4HYT B;  3G21 A;  3TNU B;  1YTZ T;  3M0D C;  1E5W A;  1L4A B;  3M06 A;  4L76 A;  4YTP C;  2MVV A;  1GW3 A;  2GA1 A;  2OTJ P;  1KYO D;  2V4H A;  2JQ4 A;  2M5A A;  4WY4 B;  2KOD A;  2KS1 B;  4IFF A;  3EFG A;  2KLV A;  2WPR A;  5H2F E;  3G71 P;  3H1I D;  3BCC D;  2WPQ A;  3CXC O;  1NTM K;  1YJN P;  1DNY A;  4OGQ C;  1UNK A;  4XFY A;  2WSE H;  3LID A;  3CX5 I;  1BCC E;  4GR6 A;  4XA4 A;  3H25 A;  2M8R A;  1NU1 G;  1NU1 E;  3H4E A;  2FYZ A;  1KB9 H;  1Z56 A;  3HRN A;  4U7J A;  2B88 A;  4GIF A;  3CCV P;  1PP9 G;  2BEQ D;  1KQG B;  4YXW H;  1PP9 E;  2ZVO B;  3VRL C;  4U3F D;  1T8K A;  1AQ5 A;  3HE5 B;  3NY7 B;  1JJ2 O;  1JNM A;  5BU5 A;  1QEX A;  5AVX B;  3CWB J;  3RG6 C;  2Z5I A;  2X2B A;  1L4A D;  2E74 B;  1JUN A;  3L74 G;  3P7K A;  4ZKU A;  5C39 A;  1LT9 A;  3L74 E;  3C1L A;  1SVF A;  3H32 A;  3JCU H;  1YJW P;  2FAE A;  1GL2 B;  1DEE G;  1OZH A;  1J2J B;  4WY4 D;  1ZR4 A;  3L75 J;  1LTJ B;  1RF0 C;  2ZJS E;  1LWU A;  2FY8 A;  3CXH E;  4N3Y B;  1RE4 A;  3D71 A;  4RES B;  2QM8 A;  1J1D C;  1IFJ A;  2JAZ A;  2K9Y A;  3L71 D;  4H2W C;  2WT7 B;  1KZU B;  3VTP C;  3VP9 A;  3H1H J;  1NTK G;  1NTK E;  1BCC D;  1DD3 A;  1T2K C;  1KIL C;  4PH1 A;  5E79 E;  3RL0 B;  3G1G A;  3G29 A;  3EJE A;  3CME P;  2R5B A;  3UIA A;  3LW5 H;  2K5X A;  3U1A A;  3IR9 A;  2W6B A;  1SFC B;  2XDJ A;  2IFN A;  1KFM A;  1DH3 A;  1L0I A;  3SWY A;  5F2O A;  2XXM A;  1URQ C;  2E74 D;  3PHL A;  2P10 A;  3MGE A;  1S5L E;  4NPE A;  2RMZ A;  2EHT A;  1H0T B;  2M3E A;  1HQB A;  1GL2 D;  2HPC B;  4I6M C;  1YYC A;  3H0D A;  2HOD A;  1FJP A;  3L74 D;  2B89 A;  2FVF A;  1AA0 A;  3CCU P;  2KSE A;  1RNI A;  1CI6 B;  2OYH B;  3H6P A;  3D6Y A;  3TGU G;  1KYO H;  3TGU E;  2PP6 A;  2XT1 A;  1IMP A;  4KT0 J;  3AEF C;  1HF9 A;  2BCC E;  2G3A A;  2VLQ A;  1IFD A;  3RL0 D;  1ZMB A;  4HH2 A;  3TNU A;  1SFC D;  1PIX A;  1L4A A;  1X0T A;  5AW1 B;  1NTK D;  1YTZ I;  2GDX A;  3CPW O;  1M1J B;  1VQN P;  4GOD A;  1N86 A;  1OW6 A;  1RE3 C;  4C7N A;  1Z6M A;  1AYI A;  5AVZ B;  1N73 C;  2CQ8 A;  3L73 G;  3WU2 H;  3L73 E;  4WY4 A;  3II6 A;  1ZR2 A;  2KS1 A;  3GF3 A;  3O6Q A;  1ACP A;  1KOR A;  2ZYG A;  2ZT9 D;  4RO0 A;  2KW2 A;  1USE A;  3P05 A;  3QH9 A;  1ZLL A;  5APV A;  3RK2 B;  2DGY A;  3L70 D;  4IL6 E;  4ASW A;  3GHG C;  2WMM A;  3HE5 A;  3CC4 P;  2PEN A;  4MRT C;  1PGQ A;  2P67 A;  1JCC A;  2WQY C;  4C7R A;  5H2F H;  2L5G B;  1A02 J;  2NO8 A;  2ITA A;  4TLF A;  2BCC D;  1KQL A;  2N6Y A;  1PEO A;  1E6J P;  3U59 A;  3A7O A;  4YPC A;  3BVH A;  5CBO A;  5AW2 B;  2QSI A;  1SQQ J;  3NTN A;  1GL2 A;  4UB8 E;  1KB9 I;  1N7L A;  1LTJ A;  1EDK A;  4O9B A;  1OMI A;  3H1L D;  2BHV A;  3AE8 C;  1TU3 F;  2O1K A;  3KZI E;  3L73 D;  2H8P D;  1LTB C;  5GTI E;  1KLP A;  4EI2 A;  3D70 A;  3FXE A;  1ZME C;  2E1M A;  2WT7 A;  1MZ9 A;  1JOC A;  5AVS B;  7CEI A;  1MZ8 A;  1L0N E;  2XZR A;  3RK2 D;  2GDY A;  4PV1 C;  2IX7 C;  3HTK B;  2WSF H;  3LRY A;  3PLN A;  2QJY B;  3A0B E;  3MUD A;  5APT A;  3A3Y B;  1M6E X;  2KG9 A;  2C0W A;  3B5N C;  4H2X C;  2WSE J;  2MF4 A;  1RO0 A;  1SQQ K;  3CXH H;  5CCH D;  1FC2 C;  1K05 A;  4H2Y C;  2XZ1 C;  1SQV J;  2A06 G;  2A06 E;  5CJ4 A;  1S9K E;  3AEE C;  3EJD A;  4GOF A;  2IZ0 A;  3VOP A;  2K0Y A;  2Z44 A;  4L74 A;  4Z1M H;  2W6J H;  2GDW A;  2YO2 A;  1CI6 A;  3P32 A;  1FOS E;  1KIL E;  4TT3 H;  4JYB A;  1JTH B;  1EZV I;  1RQU A;  4EYY Q;  1GMJ A;  1AVY A;  2XZ0 D;  1KIL B;  1JY3 P;  3H1K J;  3MP7 B;  2OYO A;  4IOI H;  1VQ4 P;  3CL3 D;  1PPJ G;  1PPJ E;  1IFI A;  1S5L H;  3E2D A;  2FQ1 A;  1L0N D;  1M90 Q;  1M1J A;  1SQV K;  4Y99 B;  1URQ B;  5KLV J;  1CZQ A;  1PL5 A;  1Q81 Q;  2E75 B;  5B66 E;  3BRT B;  1D1D A;  1K9M Q;  1AV1 A;  2FQ0 A;  2B9B A;  4WBA A;  3F89 A;  2JYG A;  1KYO I;  1SP4 A;  3M0A A;  2KOG A;  1EDL A;  1NTZ D;  1JMB A;  2K37 A;  5KAF E;  1P84 D;  1L0L G;  1NH4 A;  3LW5 J;  2NPS C;  1YJ9 P;  2BAS A;  4AQR D;  1L0L E;  4BRY B;  2L9F A;  5AVQ B;  1S9K D;  2JB0 A;  1BE3 G;  1OX3 A;  3M9B A;  3Q20 A;  5HV8 A;  1ZXG A;  1BE3 E;  4JYC A;  3RK3 E;  2KK7 A;  1VQ5 P;  3EJB A;  1JMM A;  4D6T J;  3TF5 A;  3ABV C;  1UJZ A;  4QKO A;  3KYQ A;  1KMI Z;  3VN0 A;  2P1J A;  2GYK A;  3RK3 B;  1BXI A;  4H44 C;  1KB9 D;  5KKZ B;  3G28 A;  1SQX J;  1VHN A;  3GW6 A;  3VMY A;  1RY3 A;  1K30 A;  1OWA A;  1M8O B;  4Y28 J;  5TJH A;  4EDF A;  1AQT A;  2ONT A;  5KLV K;  4IZ6 A;  1RQV A;  2K9J B;  1W5C E; 
#chains in the Genus database with same CATH homology
 2PEQ A;  3DS5 A;  3DS3 A;  2OTL P;  1RO2 A;  5I4T G;  3H47 A;  2Z46 A;  4M0I A;  2BQ1 E;  3M1M A;  1PEQ A;  5JPA A;  3MGE A;  2QEX P;  2Z44 A;  1KQS O;  3H4E A;  3CC4 P;  3CCJ P;  1IUQ A;  2PEN A;  4COP A;  3CCV P;  2LF4 A;  1YHQ P;  1N8R Q;  5BS1 A;  4IPY A;  3H0D A;  3G6E P;  2JYL A;  3VRL C;  4U0E A;  1A8O A;  3G0V A;  1VQ7 P;  3CCE P;  5F2K A;  3B5I A;  1Q82 Q;  2EIA A;  3CCU P;  1VQK P;  1PEO A;  1JJ2 O;  1E6J P;  4U0C A;  1KD1 Q;  4U0D A;  2PEM A;  2EFJ A;  1RNI A;  3NTE A;  3RG6 C;  3I55 P;  1EIA A;  1VQ4 P;  1Q7Y Q;  2L6E A;  3CCR P;  5F2N A;  2PEK A;  2P9X A;  1S72 P;  2OAR A;  1A43 A;  2PEO A;  3E2D A;  3G4S P;  3CC7 P;  1PEM A;  2XT1 A;  1M90 Q;  1AUM A;  3CCM P;  1QVF O;  1VQP P;  2BHV A;  5HGM A;  3DTJ A;  3DPH A;  4U0A A;  1KC8 Q;  1Q81 Q;  1YJW P;  4GR2 A;  1ZMB A;  2Z45 A;  5HGN A;  3DS1 A;  1D1D A;  1K9M Q;  1YIJ P;  2QA4 P;  2BUO A;  1W2B O;  2E1M A;  1NJI Q;  5HGO A;  3CPW O;  2JYG A;  1PEU A;  1VQN P;  4COC A;  4XRQ A;  1VQ8 P;  3CD6 P;  4U0F A;  1Q86 Q;  1BAJ A;  3HZQ A;  1M6N A;  3HYB A;  3G21 A;  3DS2 A;  4PH0 A;  3OW2 O;  1YJ9 P;  5HGL A;  3LRY A;  4U0B A;  3Q20 A;  4XRO A;  5BS2 A;  2PEI A;  1M6E X;  4WYM A;  1VQM P;  1VQ5 P;  1VQ6 P;  4PH1 A;  1M74 A;  3G1G A;  1RO0 A;  3G29 A;  3G26 A;  2PEJ A;  5DCK A;  2M8L A;  2M8N A;  3CME P;  2OTJ P;  3P05 A;  2CWO A;  1K73 Q;  2KOD A;  3CCQ P;  3CCL P;  2M8P A;  3G28 A;  3I56 P;  1QRJ A;  1VQL P;  3DS4 A;  1K30 A;  2XV6 A;  4QNB A;  3G71 P;  3CXC O;  3DS0 A;  1EOQ A;  1YJN P;  3CC2 P;  3G1I A;  1VQ9 P;  1K8A Q;  2ONT A;  1YIT P;  2EG5 A;  4XFY A;  1M1K Q;  5F2O A;  3WBH A;  3CMA P;  2JO0 A;  2XXM A;  1VQO P;  2DGY A;  1QVG O;  3CCS P;  4XFX A;  4XFZ A;  2PY8 A;  4GR6 A;  1YI2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...