1KQSO

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1kqsO02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1kqsO01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1kqsO03
3CCLP 1VQPP 1N8RQ 1K9MQ 2QEXP 3I55P 2OTJP 1KQSO 3I56P 1VQNP 3CMEP 1YITP 1K8AQ 1YIJP 1VQMP 1VQLP 1YJNP 1M1KQ 1KD1Q 1VQKP 2OTLP 3CCEP 3CMAP 3CCRP 1YI2P 1VQ7P 3G4SP 1K73Q 1KC8Q 3CCUP 3CCSP 1VQ4P 3CXCO 1Q82Q 1NJIQ 1YHQP 3G6EP 1VQ5P 3CD6P 3CC2P 1M90Q 1JJ2O 1YJ9P 1Q7YQ 1W2BO 1Q81Q 2QA4P 3G71P 1VQOP 1Q86Q 1QVGO 1VQ8P 3CC4P 3CC7P 3CCJP 3CCQP 1YJWP 3OW2O 1S72P 3CPWO 1QVFO 1VQ9P 3CCMP 3CCVP 1VQ6P
chains in the Genus database with same CATH superfamily
1BCCE 1IC2A 2QJPB 5KLIB 3H25A 3H1HG 1ZP0C 4WY4D 1FOSF 1JY3P 3JCUE 1EQ7A 5AVQB 1OMIA 3H1ID 4EYYQ 1EZVD 1OIPA 3PJSK 1QX8A 2I1KA 2N5HA 1GW4A 1EOQA 3IN6A 3RK3D 3KQGA 3AEBC 1L0HA 2P58A 4JBZA 2M5RA 1VQKP 3MD0A 2VSQA 3MP7B 1GPJA 1S1CX 3II6A 2A06G 2IX7C 4COCA 5HGLA 4WVZA 3M0AA 3RBZA 1YBKA 3L75J 1IZNB 1G2CB 2C0XA 2WSSH 2R5DA 4I2LC 3RK2C 3ABVC 1NTZK 5AW0B 2Y0DA 1L0LG 3TSIA 1Q81Q 1SFCC 1RE3A 1SQXG 3HTKA 2B87A 4N6JA 1SFCD 1SVFA 3LW5J 3BATA 5EW5E 1A02F 2R3CA 2E74C 1NTMD 1ZV8A 1NWQA 2VLOA 1GW3A 4EIJA 1RY3A 1YHQP 1FZCB 1LTAC 3AEGC 3MIWA 3KHUA 1KB9D 4I6MC 1U57A 3L70G 2KGAA 4C7NB 1ZN5A 4XFXA 2K0YA 2L91A 2BQ1E 2ROQA 1N73A 4EI2A 3HE5A 1N7LA 2N9YB 5BU8B 1NTMK 2XNXA 1NO4A 2IFMA 1Q2NA 2ZYAA 1QVGO 4IOIH 1LT9B 1CI6B 3V5BA 2H43A 3CPWO 4C7NA 1L0LD 5B5EH 5TISH 1URQA 1GTWA 2W83C 4IPYA 1GK6A 2FBWC 4WY4C 3L35A 2IBZD 1M6NA 1HBWA 2WPTA 2KI7B 3T97A 3MUDC 2YMKA 1BE3J 3SWYA 3L74D 1FU1A 3KPEA 2WT7A 1S5LE 1CW5A 3MGNA 2C9NY 3MGEA 2Y9ZA 3JC22 2FYNB 2MJZA 4AQRD 2NPSC 4DJGA 4W80A 3CL3D 3AEEC 3KYQA 4U3FD 3M9BA 4NPEA 5AVYB 3FWNA 1EDKA 2KNCB 2KOPA 1T2KC 5DJTB 1JY2N 2JP3A 2GM4A 1KILA 4L73A 2JR8A 3PLNA 3WUUA 3IR9A 5I4TG 4GT1A 3DS2A 1VQPP 2WVRA 2HG5D 2JBGA 1YTZT 2O01N 3BASA 4TLFA 1VQ5P 5APUA 1FC2C 1LT9A 4JF7A 5AVZB 2NRGA 2K9JA 1SQBD 3WU2E 2QJKC 3A7OA 4LGDE 3M9HA 1HTLC 2GA1A 1SS1A 2IBZG 4Z1MH 3KDPB 1K73Q 4IFDK 3G26A 5GTHE 2Z5IA 1LJ2A 2OYIB 3TF5A 1YJWP 1VQ6P 1NTMG 2WT7B 2KGCA 2KSEA 2I1JA 5CBNA 3VP8A 3FGAD 2P1JA 1NTZJ 5CBOA 1PEMA 1KORA 1ZLLA 4PJ0H 1YYCA 3ZDMA 3EJBA 3KZIH 3FWLA 1T6AA 4JQ0D 5B66H 5H2FH 3H1JG 2L0QA 4BPGA 1IFIA 1DX7A 1U7JA 1CI6A 1FAVA 3Q1MA 1GZLA 5KAFE 1BCCD 3NFQA 3H1JE 4ASVA 1JTHB 4ZKUA 2OYHC 2FXPA 3PTZA 2PEOA 3EJEA 1BCCJ 2B89A 2E1MA 1LTJC 3D71A 3CMEP 1S9KD 3A3YB 3CXHD 1KYOE 3HE4B 1M74A 2Q9IA 2OTLP 2OYHA 1X0TA 2K93A 4ASWA 1FJPA 2XZRA 2KS1B 2GUSA 2JDIH 1NKNA 4UHPB 2BCCG 4HYTB 1NH4A 4PD4D 1LTBC 1SQQD 1OFCX 2JWDA 1OR5A 1MFTA 4XFJA 2XV6A 3USSA 4I7ZB 4ZNCA 1PL5A 3A0BE 1KB9H 5AW5B 2Z46A 3CX5I 3L37A 1DV5A 2BCCJ 2H89C 1E6JP 1N8RQ 3GLMA 2PENA 4IL6H 2K9JB 2O01J 1L0NK 2R44A 3VN0A 1TU3F 2J58A 1X79B 4U0DA 2BCCD 1IO4A 1KLPA 1WMKA 2AEFA 1M6EX 1OW6A 3L71G 4K3AA 4DT0A 1KFMA 3V2NA 4XRQA 3E1RA 4NEOA 2YKOA 2WZ7A 1H0TB 3HD7C 1CEIA 1H88A 1KQSO 2E5TA 1K8AQ 5KJ7D 2YMYA 5E79H 1NAYA 2IZ1A 1VF5C 3D6YA 2JYLA 3QWOC 5GTHH 2KG8A 2FVAA 4OGQD 3L75E 1VQ9P 3G28A 3H1JD 3MTUE 1USDA 2WPQA 1ZRTE 2KG9A 2AEJA 4PH1A 2PP6A 3DS5A 3SSUA 1K05A 1M8OB 1N73C 1MZ9A 1FDMA 5APYA 2R3SA 2XXMA 4RO0A 2UWJE 3H0DA 1ZMEC 2FYUK 1SQBK 4HB1A 2FXOA 2G3AA 2I8DA 1A8OA 2JAZA 2N50A 1KFNA 1RQUA 2LF4A 2L9FA 4OGQC 2PFXA 4R4LA 3H32A 1GU5A 3CCEP 1XTCC 2LKIA 2KORA 2PNGA 1RF1B 1SFCA 1KN7A 1JEKA 3M0DC 4U0EA 3ITKA 3VTPC 3TK1A 2PEJA 1JUNA 2BUOA 5KJ7C 2MD9A 5AVUB 5GTIH 1SQPG 3EQ2A 3P05A 2L4BA 5APQA 3EFGA 3B4QA 5CCHC 2KS1A 3AE4C 3CMAP 4H2YC 2WSEH 4PD4H 2XZ1C 2E76C 1GL2D 1VQLP 1BE3D 4JYCA 2GYKA 3L71J 3PHLA 1MKMA 3AE1C 5KLVE 4CA3A 2GZFA 2QE7H 3U59A 1LTJB 2FVEA 1RF0C 1SQXJ 3E2DA 1LGHB 1VQOP 2RMZA 1E0HA 3VP9A 4DOJA 4XFZA 1IMPA 1UNKA 4HKZH 2PRRA 1YIJP 1LWUA 2JU2A 1UJZA 2E42A 1LNQA 1N2DC 3BCCG 2N6YA 3M06A 1T8KA 2LXCB 5CCHD 1M57D 4Y99B 1NTMJ 1FZCA 1AQ5A 3L73G 2V4HA 3D6ZA 3TGUE 1VKUA 1UIIA 4GOFA 1L0NJ 2YKQA 3BRTB 1SP4A 2JO1A 1S3JA 2FYZA 1WRGA 3O6QA 3P8MC 3HTKB 3U1CA 3EWKA 2N1TA 3RK3C 2ZAEB 1PFIA 2EHTA 3V4WA 2A45I 1HJ0A 3E1IA 2KOQA 1QVFO 4U3FE 1K30A 2GZIA 5F2KA 1F80D 2LIWA 1SQPJ 3V2RA 4XFYA 2AXTH 1G2CA 2KGDA 4BPHA 4XE5B 3CCSP 1NTME 2XNDH 1W5CE 2KOGA 3RK2B 4Y28J 2XT1A 2MY5A 3L72G 1AQTA 2E75D 1BSNA 1T3JA 2L22A 3VMYA 1LT9C 5TJHA 1KILC 4N78D 1L2PA 3O8ZA 2IZ0A 4AYCA 4H13C 1Q82Q 1QL2A 3GF7A 1GXHA 1SQVG 1EXIA 4MRTC 2QIWA 1MUUA 1OXZA 3GG2A 2LMLA 3CXCO 4H13B 2J5UA 3HD7A 2WPSA 3CX5E 3L71E 5M1BA 1DIPA 3H1HD 4W7ZA 4LLHA 2QM7A 1J2JB 3HD7D 3IAOA 1HH0A 5HV8A 4N78E 2EHSA 2K5XA 3T97B 5AVTB 1X8YA 2RN0A 3TGUJ 2CPSA 2K37A 3L74G 3V4QA 2M3BA 1SQBJ 1JNMA 1LWUB 1BAJA 3B5NB 3N4XA 1LP1B 1VDFA 5APTA 4GIFA 4HKGA 4UB6H 1LP1A 3W68A 1SQVE 1OVRA 1Z56A 1M1JC 4K35A 1KILD 3LW5H 1OX3A 2IDBA 2K0DX 5GTIE 4PD4E 2NZ2A 1PGOA 4GOEA 2D2CC 3HZQA 3F5HA 3RBXA 2YKPA 1FE6A 2GDXA 2YXQB 3L73D 1OVVA 3L70D 2EIAA 2E74B 1JMMA 4H44B 1HUCA 2N1TD 1VQNP 4GDOA 1BE3G 2YIUC 4PV1D 4H0LC 2KZIA 5KLIC 3FX0A 2YO3A 1E79H 1NHLA 2N98A 3G0VA 3G9RA 1SFCB 3CC4P 2ZJSE 2GDWA 2M8LA 1WT6A 2FYUG 4L75A 1KMIZ 4BRYA 1CSBA 4ZMDA 5KAFH 2XV5A 4WWIA 1N7SD 2FACA 1NYHA 2IFNA 2H88C 2B88A 1VQ8P 2FQ1A 1AA0A 2IBZE 1RNIA 3SWFA 1PEQA 1OWAA 3JCUH 4HH2A 2K0XA 2BEZF 1EIAA 2K94A 2KB7P 3AEAC 2W6JH 3CWBE 4UB8E 3CC2P 1KTMA 1IUQA 1BDDA 1OVUA 3LIEA 2C0WA 1HWTC 2QSIA 5K5GB 2JJLA 3FXEA 3H1IJ 1FDIA 1GDTA 1U7MA 2IPPA 1JOCA 1OZHA 2E76D 2A45G 5CJ4A 5BVZA 3GHGB 4D6TE 3RK3E 2ZXXA 2MVVA 4H44C 2M8RA 1BDCA 2LR2A 2CPBA 2P10A 1X3OA 2WSCJ 3CX5H 1MV8A 5CMZA 1P84E 2M8NA 3AEFC 1PGPA 3VMAA 2WPRA 3L75D 3QH9A 1M1JB 3A0BH 1T8ZA 3DS3A 1HGZA 3L71D 2H7HA 1DD4A 1G1JA 2HLOA 3CCJP 1EDLA 4WYMA 2HFED 1JTHA 1LT1A 1T2KD 1KYOH 1SQPE 2HODA 2ZT9C 4GODA 5KP8B 1YQ3C 4IZ6A 1X22A 1KC8Q 1VPCA 2FQ2A 1A43A 3SWKA 1BGYE 2O01H 1PP9G 1IFNA 1RE4C 2Y0EA 3B71A 3GJNA 3V2PA 1NAFA 5KKZC 1EDIA 1GK4A 2YO2A 3NTNA 1CZQA 3HUSC 4YXDC 5F2OA 2WSEJ 1SQQG 3DS1A 2OYIA 4D6TD 4UB6E 1N7SB 3VYIA 2VLNA 1JCCA 1KB9I 1SQVD 1FZGA 4EOTA 1VL2A 2X2BA 3G1GA 3LMOA 4HJGH 1QGKB 3H1LD 1SQVJ 5CCHA 4U0BA 2FYUE 5AVWB 3LRYA 4PWVB 1L0LJ 5HVCA 5KP7B 2OYIC 5AW4B 1ZNVA 4U0AA 4GR2A 1RE3C 4COPA 1S4XA 3CCLP 4IFFA 3I55P 4C46A 1BGYG 1YITP 3L74J 1N86A 3WU2H 2WQYC 1J1DB 2ONTA 1LWUC 2QJKB 2IBZI 4WY4B 1LTGC 4YTPC 5AW1B 3V2QA 3PRJA 2V7QH 2FYUD 2KIKA 1LTTC 2QVAA 2OTJP 1NTKE 3EJDA 2NPSA 3AECC 2AXTE 2AVAA 5BU5A 3NY7B 3O6QB 1BCCG 4H2WC 3OA7A 1BE3E 2O1JA 2XU6A 3GW6A 4ZKPA 3GKLC 2JU1A 1P84D 2BEQD 2Z4EA 3DS0A 1M1KQ 1AJYA 1PEUA 1YQ4C 3CXHI 1JM0A 2Q3EA 3I5CA 2JKVA 3B5NC 2M0BA 1AFOA 3EFFK 3L36A 3PP5A 5AVSB 3DTJA 1K9MQ 2Z45A 1R5LA 3HE5B 1IFDA 2FHSC 3Q3DA 4H0LD 3CLQA 4N3YB 5EFWB 1J1DC 5L8RJ 1USEA 1SQPD 3TNUA 1N7SA 2FXMA 1BSHA 1NTZD 3A2AA 2FY8A 5CCGC 2KR5A 2ZVNB 5KLVK 5TISE 2GDYA 3HRNA 3KXDA 1L0NE 2ZT9D 3L73J 3L72D 4YXWH 4Y99C 3DPHA 2OGUA 5B5EE 1J1EC 3H1IG 1VHNA 1FZCC 1FZAA 1L0NG 5KJ7A 3V6IA 3CCVP 3CI9A 5HGNA 3NMDA 1BXIA 5E79E 2MR8A 3H1IE 2FYNC 1D7MA 4U3FG 4IL6X 2CG5B 5KLVD 1L4AC 1IMQA 2POHA 1JJ2O 3B5NA 1KB9E 2WPVB 4OH8B 4BPFA 1IK7A 3CCQP 1RO0A 3AE8C 1AVYA 4DG9A 2Q1KA 2K9YA 2PAJA 2CQ8A 4H2XC 1YI2P 2MVUA 1PV3A 3GF3A 3BCCD 1NVOA 4XA4A 3AE7C 2E76B 5HGMA 3B5IA 2K3RA 1KYOD 2LTEA 1L0LE 1KILE 4U7JA 5AVXB 1EZVE 2KODA 2BCCE 1PPJG 3SFEC 1HQBA 1KD1Q 1KQLA 1SQXE 3RL0D 1AV1A 4RKUJ 4KJMA 3L4FA 1NTKD 1Q86Q 3M9QA 2BHVA 4JPZB 2KGEA 3A5TA 1HGVA 3P8CD 3M91A 2OYOA 3BCCE 3KZIE 1RH5B 1JY2P 3L70E 2B9BA 3L73E 3RGUA 2BASA 4UB8H 3P32A 1FOSE 2R5BA 3Q5PA 3H1LG 2M5AA 1DD3A 2H8PD 5KAIE 2ZYGA 4PV1C 3CXHE 3H1LE 3H1JJ 1EZVG 5KP6B 4TT3H 1YTZI 2ITAA 1JCDA 2XKMA 3OW2O 2D2CD 1A02J 3S1KA 4PH0A 1AUMA 2QJYB 1PP9E 2E43A 1IFJA 1SLQA 2O1KA 3Q5RA 3L72E 3R4YA 1H0TA 1AVOA 2E5YA 3C8VA 1PP9D 4OGQB 2Y0CA 4IL6E 3AE2C 1DNYA 2AEMA 3CE7A 1QL1A 2QRXA 3BRVB 2AFEA 2GZGA 1IK9A 5APVA 1GXGA 4JYBA 4GKGA 3WMM0 5AW7B 1ZOYC 3Q5SA 2K1AA 1NJIQ 1GL2C 1P84I 1URQD 5AW3B 4W7YA 1N73B 3RL0g 4BWNA 3B8EB 2JYGA 4NPDA 4M0IA 2YXRB 1LTJA 3VRLC 5BS2A 3VOPA 1E5WA 2FADA 1L4AD 2PY8A 2G8YA 3K5BA 3M0DA 2CWOA 4C7RA 3CWBJ 4I7ZC 2QNWA 2XDJA 1R8EA 2VRSA 1NGMB 2PEIA 2WSCH 3PH0A 2W6BA 2ZXEB 4EDFA 1PGJA 3GHGA 3C1LA 3A0HE 2KXPB 1L0IA 3VMZA 2L5GB 5CZDB 3GMAA 1W2EA 1GL2A 1S9KE 2M8PA 2HPCB 2W8ZA 3CWBG 1Q90D 3RG6C 5APXA 2WTYA 3HD7B 3B4SA 3L75G 5HGOA 4F37A 5KTBA 1VQ4P 2W6AA 1SQXK 1RF0A 2KLVA 2HODB 1OW7A 1PPJE 3IF4A 3S9OA 3AE5C 3GZMA 1SQQE 2CGQA 1LTSC 2AFDA 3WBHA 4PJ0E 1VQMP 2QG4A 1H89A 3AEDC 1GD2E 2KK7A 5APWA 2OQQA 1FJKA 4U0FA 3MZWB 4U0CA 4PXHB 2PEKA 1L0ND 2FQ0A 1M90Q 1ZMBA 1H8AA 4H0LB 1HF9A 2GUVA 2JQ4A 1Y9BA 2KOOA 5AVVB 1JY3O 2HR3A 1S72P 2IYPA 1JY2O 2WSFJ 1JO5A 2N6ZA 1NTZE 2D2CB 3AE6C 4KT0J 5AVRB 1J1EB 2QJYC 1EDJA 1OW8A 1KV4A 2KNCA 4XROA 1Y8AA 2LKMA 5DCKA 1KQFB 4BRYB 3H47A 1NTZG 3TNUB 2N9BA 2QA4P 1G1IA 2GZJA 1GMJA 1FZFA 4H44D 3HYBA 1JB0J 3G29A 2JEEA 2Q5UA 3NXSA 4DCKA 4PV1B 1QLED 2Q6QA 1SQBE 1YJNP 4YPCA 3WUVA 1JMBA 4WY4A 2KYVA 1EC5A 2RKLA 2J59M 2FVFA 2M3EA 1NTKG 2FAEA 1PGQA 3C9IA 2Q7CA 4L74A 1UIXA 1URQB 1RE4A 2ZFCA 3L72J 1HVVA 1X9VA 2PGDA 2YIUB 1ZRTD 3CX5D 2LPKA 1L4AB 1VQ7P 1R5SA 2IYOA 3E7KA 3RK2D 2XZ0D 1NU1E 2JB0A 2KSJA 2O3JA 3VMXA 2E75B 5CJ0A 2CK3H 2KLUA 1S5LH 1S2EA 1RHZB 2FKWB 1PEOA 2QEXP 2OTKE 1KZUB 2NPSB 3BVHA 1FS0E 2OARA 1DEBA 2P7JA 3H1KG 2WWWA 2HPCA 3TGUD 1NTKK 1Y47A 4IFMA 3TGUG 5BS1A 2EG5A 3H1KD 3RL0B 1L0LK 4RJTA 2MKVA 1ZR4A 1PIXA 1XTGB 2KW2A 2QM8A 3CCMP 2YNYA 3OJAB 3MUDA 2FFDB 3H1KJ 1PZQA 3BCCJ 5CCGA 2LIUA 2N1TC 2R32A 3G3ZA 2V7QJ 4B86A 1MZ8A 4AUWA 3RK3B 1M56D 3LIDA 1NU1J 2NO8A 4U3FJ 3CXHH 1GU4A 2Y9YA 5AW8B 3DS4A 1NU1G 1SQXD 1NTKJ 3RL0C 1ZR2A 1NQ4A 3M1MA 1NU1D 2ZVOB 3CCRP 1NKZB 3L70J 3R2PA 2PEQA 3G71P 2AXCA 1FDOA 2FFDA 3H1KE 2LL8A 2DW3A 4KHXA 2RH0A 2LXBA 2SPZA 3GZLA 1KILB 2K92A 1VF5D 1EZVI 1IJDB 2B87B 2MF4A 1EXJA 1YJ9P 2P67A 1RF1A 2K2QA 1NU1K 5AW6B 2N1TB 3TDKA 3AE9C 5KLVJ 2KZJA 2K88A 1URQC 3I56P 2L6EA 3IFMA 4A7PA 2FFDC 2M5AB 4CPGA 1FBMA 1SQPK 3Q2YA 3U1AA 1AF8A 1L4AA 2A45H 4I1LA 3NTEA 3L74E 1ZW0A 3AE3C 4LC1A 4PD4I 3UIAA 5F2NA 1FZEA 3H4EA 1RF1C 2KOSA 5AW9B 4H13D 4BXLA 2ERHA 3FXDA 2DGYA 1SQQK 3CC7P 2E75C 4O9BA 3G21A 2W90A 1IFPA 7CEIA 1DH3A 1RQVA 5C39A 5APSA 2CNRA 5AW2B 3SFDC 1N7SC 5KKZB 2JWAA 4QMAA 1GL2B 2KG6A 2ZYDA 1W2BO 3N7NA 3H1HJ 2A06D 1ACPA 2JGPA 2N5IA 3B5ND 5JPAA 2W27A 2A06E 2KUBA 1BGYJ 3D70A 1FZBA 4L76A 1HY8A 2WSFH 3W67A 3H32B 1AYIA 3OAKA 1Q7YQ 5DJUB 1BGYD 1S5LX 1KYOI 2LOLA 2EFJA 1FR2A 4WBAA 4WB4A 2HYNA 2E74D 1M1JA 1IFMA 3G4SP 1VF5B 1MFZA 4NPFX 2WITA 1T3UA 2KP8A 2PEMA 2GZEA 3P7KA 3A0HH 2MR7A 1P84H 1SQVK 2JO0A 2Z5HA 4GR6A 3HUSB 1PP9J 3S4RA 4D6TJ 3GHGC 4D6TG 5EJDA 2QJPC 5H2FE 3HUSA 3MHVA 3Q20A 2P2UA 3F89A 1KQGB 3H6PA 2OYHB 1K04A 4OVNF 5CHXA 1RO2A 2C9LY 3H1LJ 3HE4A 3TYYA 3RG2A 4M3LA 1Z6MA 2Z44A 1D1DA 4DZOA 2AF8A 4MN4C 1QRJA 4OWFA 4QNBA 2ZT9B 1PPJD 1LTIC 1QEXA 2VLQA 3CCUP 3G6EP 3CD6P 3JSVC 3G1IA 4R0MA 1ZXGA 1M7LA 3CWBD 5KAIH 5B66E 1DEEG 2P9XA 3WUTA 3U43A 1JY3N 2WMMA 1EMVA 2KWLA 4R4MA 1NOHA 2FYUJ 1SQQJ 2NPSD 2DNWA 1HJBA 2Q3IA 1SQBG 4RESB 3H1HE 5CCGD 4QKOA 2VLPA 3P8CE 5KLVG
chains in the Genus database with same CATH topology
1RO0A 1PEOA 4PH0A 2EFJA 4XFXA 1PEQA 3H0DA 2QEXP 3WBHA 1AUMA 2BQ1E 3I56P 2L6EA 1VQMP 2OARA 3DS0A 1M1KQ 1EIAA 5F2OA 1YI2P 1A8OA 4U0FA 3G4SP 2XV6A 1K73Q 1PEUA 4U0CA 5BS1A 3G26A 2EG5A 3DS1A 2PEKA 3CC2P 1BAJA 2PEMA 3NTEA 1ZMBA 2Z46A 1M90Q 2LF4A 1QVGO 1IUQA 1E6JP 5HGMA 3B5IA 1YJWP 1S72P 1QVFO 1N8RQ 3CPWO 3CCMP 2JO0A 3CCEP 1VQ6P 1K30A 1EOQA 2PENA 3DTJA 5F2KA 4GR6A 1K9MQ 5F2NA 3G1GA 3H4EA 2Z45A 2KODA 4IPYA 4U0DA 4XFYA 4U0EA 1KD1Q 1VQKP 4XROA 1M6EX 3Q20A 4U0BA 2PEJA 2BUOA 1M6NA 5DCKA 3LRYA 2DGYA 3CCSP 1PEMA 1NJIQ 3H47A 1RO2A 4COCA 4U0AA 4GR2A 5HGLA 2XT1A 2QA4P 1Q86Q 3CC7P 3HZQA 3G21A 2JYGA 3HYBA 2BHVA 3G29A 3P05A 4M0IA 4XRQA 2Z44A 1D1DA 4COPA 3CMAP 3VRLC 3DS4A 3CCLP 1QRJA 2EIAA 3MGEA 5BS2A 3I55P 4QNBA 1KQSO 1VQNP 1YITP 1K8AQ 1VQLP 2PY8A 1YJNP 2CWOA 3M1MA 2M8NA 2ONTA 3CCRP 3CCUP 1Q82Q 3G6EP 2JYLA 3CD6P 2PEIA 3DPHA 3G0VA 3E2DA 2PEOA 3DS3A 3G1IA 1Q81Q 1W2BO 2PEQA 3G71P 3CC4P 1VQOP 2M8LA 2E1MA 3CCJP 4WYMA 5I4TG 1VQ9P 3CXCO 3CCVP 3CMEP 5HGNA 5JPAA 3DS2A 2P9XA 2M8PA 1VQPP 3G28A 1M74A 4XFZA 2OTJP 3RG6C 1YIJP 4PH1A 2OTLP 3DS5A 5HGOA 1VQ7P 1KC8Q 1VQ4P 1YHQP 1VQ5P 1A43A 1JJ2O 1YJ9P 1Q7YQ 1VQ8P 3CCQP 3OW2O 2XXMA 1RNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL P;  1VQP P;  1N8R Q;  1K9M Q;  2QEX P;  3I55 P;  2OTJ P;  1KQS O;  3I56 P;  1VQN P;  3CME P;  1YIT P;  1K8A Q;  1YIJ P;  1VQM P;  1VQL P;  1YJN P;  1M1K Q;  1KD1 Q;  1VQK P;  2OTL P;  3CCE P;  3CMA P;  3CCR P;  1YI2 P;  1VQ7 P;  3G4S P;  1K73 Q;  1KC8 Q;  3CCU P;  3CCS P;  1VQ4 P;  3CXC O;  1Q82 Q;  1NJI Q;  1YHQ P;  3G6E P;  1VQ5 P;  3CD6 P;  3CC2 P;  1M90 Q;  1JJ2 O;  1YJ9 P;  1Q7Y Q;  1W2B O;  1Q81 Q;  2QA4 P;  3G71 P;  1VQO P;  1Q86 Q;  1QVG O;  1VQ8 P;  3CC4 P;  3CC7 P;  3CCJ P;  3CCQ P;  1YJW P;  3OW2 O;  1S72 P;  3CPW O;  1QVF O;  1VQ9 P;  3CCM P;  3CCV P;  1VQ6 P; 
#chains in the Genus database with same CATH topology
 1BCC E;  1IC2 A;  2QJP B;  5KLI B;  3H25 A;  3H1H G;  1ZP0 C;  4WY4 D;  1FOS F;  1JY3 P;  3JCU E;  1EQ7 A;  5AVQ B;  1OMI A;  3H1I D;  4EYY Q;  1EZV D;  1OIP A;  3PJS K;  1QX8 A;  2I1K A;  2N5H A;  1GW4 A;  1EOQ A;  3IN6 A;  3RK3 D;  3KQG A;  3AEB C;  1L0H A;  2P58 A;  4JBZ A;  2M5R A;  1VQK P;  3MD0 A;  2VSQ A;  3MP7 B;  1GPJ A;  1S1C X;  3II6 A;  2A06 G;  2IX7 C;  4COC A;  5HGL A;  4WVZ A;  3M0A A;  3RBZ A;  1YBK A;  3L75 J;  1IZN B;  1G2C B;  2C0X A;  2WSS H;  2R5D A;  4I2L C;  3RK2 C;  3ABV C;  1NTZ K;  5AW0 B;  2Y0D A;  1L0L G;  3TSI A;  1Q81 Q;  1SFC C;  1RE3 A;  1SQX G;  3HTK A;  2B87 A;  4N6J A;  1SFC D;  1SVF A;  3LW5 J;  3BAT A;  5EW5 E;  1A02 F;  2R3C A;  2E74 C;  1NTM D;  1ZV8 A;  1NWQ A;  2VLO A;  1GW3 A;  4EIJ A;  1RY3 A;  1YHQ P;  1FZC B;  1LTA C;  3AEG C;  3MIW A;  3KHU A;  1KB9 D;  4I6M C;  1U57 A;  3L70 G;  2KGA A;  4C7N B;  1ZN5 A;  4XFX A;  2K0Y A;  2L91 A;  2BQ1 E;  2ROQ A;  1N73 A;  4EI2 A;  3HE5 A;  1N7L A;  2N9Y B;  5BU8 B;  1NTM K;  2XNX A;  1NO4 A;  2IFM A;  1Q2N A;  2ZYA A;  1QVG O;  4IOI H;  1LT9 B;  1CI6 B;  3V5B A;  2H43 A;  3CPW O;  4C7N A;  1L0L D;  5B5E H;  5TIS H;  1URQ A;  1GTW A;  2W83 C;  4IPY A;  1GK6 A;  2FBW C;  4WY4 C;  3L35 A;  2IBZ D;  1M6N A;  1HBW A;  2WPT A;  2KI7 B;  3T97 A;  3MUD C;  2YMK A;  1BE3 J;  3SWY A;  3L74 D;  1FU1 A;  3KPE A;  2WT7 A;  1S5L E;  1CW5 A;  3MGN A;  2C9N Y;  3MGE A;  2Y9Z A;  3JC2 2;  2FYN B;  2MJZ A;  4AQR D;  2NPS C;  4DJG A;  4W80 A;  3CL3 D;  3AEE C;  3KYQ A;  4U3F D;  3M9B A;  4NPE A;  5AVY B;  3FWN A;  1EDK A;  2KNC B;  2KOP A;  1T2K C;  5DJT B;  1JY2 N;  2JP3 A;  2GM4 A;  1KIL A;  4L73 A;  2JR8 A;  3PLN A;  3WUU A;  3IR9 A;  5I4T G;  4GT1 A;  3DS2 A;  1VQP P;  2WVR A;  2HG5 D;  2JBG A;  1YTZ T;  2O01 N;  3BAS A;  4TLF A;  1VQ5 P;  5APU A;  1FC2 C;  1LT9 A;  4JF7 A;  5AVZ B;  2NRG A;  2K9J A;  1SQB D;  3WU2 E;  2QJK C;  3A7O A;  4LGD E;  3M9H A;  1HTL C;  2GA1 A;  1SS1 A;  2IBZ G;  4Z1M H;  3KDP B;  1K73 Q;  4IFD K;  3G26 A;  5GTH E;  2Z5I A;  1LJ2 A;  2OYI B;  3TF5 A;  1YJW P;  1VQ6 P;  1NTM G;  2WT7 B;  2KGC A;  2KSE A;  2I1J A;  5CBN A;  3VP8 A;  3FGA D;  2P1J A;  1NTZ J;  5CBO A;  1PEM A;  1KOR A;  1ZLL A;  4PJ0 H;  1YYC A;  3ZDM A;  3EJB A;  3KZI H;  3FWL A;  1T6A A;  4JQ0 D;  5B66 H;  5H2F H;  3H1J G;  2L0Q A;  4BPG A;  1IFI A;  1DX7 A;  1U7J A;  1CI6 A;  1FAV A;  3Q1M A;  1GZL A;  5KAF E;  1BCC D;  3NFQ A;  3H1J E;  4ASV A;  1JTH B;  4ZKU A;  2OYH C;  2FXP A;  3PTZ A;  2PEO A;  3EJE A;  1BCC J;  2B89 A;  2E1M A;  1LTJ C;  3D71 A;  3CME P;  1S9K D;  3A3Y B;  3CXH D;  1KYO E;  3HE4 B;  1M74 A;  2Q9I A;  2OTL P;  2OYH A;  1X0T A;  2K93 A;  4ASW A;  1FJP A;  2XZR A;  2KS1 B;  2GUS A;  2JDI H;  1NKN A;  4UHP B;  2BCC G;  4HYT B;  1NH4 A;  4PD4 D;  1LTB C;  1SQQ D;  1OFC X;  2JWD A;  1OR5 A;  1MFT A;  4XFJ A;  2XV6 A;  3USS A;  4I7Z B;  4ZNC A;  1PL5 A;  3A0B E;  1KB9 H;  5AW5 B;  2Z46 A;  3CX5 I;  3L37 A;  1DV5 A;  2BCC J;  2H89 C;  1E6J P;  1N8R Q;  3GLM A;  2PEN A;  4IL6 H;  2K9J B;  2O01 J;  1L0N K;  2R44 A;  3VN0 A;  1TU3 F;  2J58 A;  1X79 B;  4U0D A;  2BCC D;  1IO4 A;  1KLP A;  1WMK A;  2AEF A;  1M6E X;  1OW6 A;  3L71 G;  4K3A A;  4DT0 A;  1KFM A;  3V2N A;  4XRQ A;  3E1R A;  4NEO A;  2YKO A;  2WZ7 A;  1H0T B;  3HD7 C;  1CEI A;  1H88 A;  1KQS O;  2E5T A;  1K8A Q;  5KJ7 D;  2YMY A;  5E79 H;  1NAY A;  2IZ1 A;  1VF5 C;  3D6Y A;  2JYL A;  3QWO C;  5GTH H;  2KG8 A;  2FVA A;  4OGQ D;  3L75 E;  1VQ9 P;  3G28 A;  3H1J D;  3MTU E;  1USD A;  2WPQ A;  1ZRT E;  2KG9 A;  2AEJ A;  4PH1 A;  2PP6 A;  3DS5 A;  3SSU A;  1K05 A;  1M8O B;  1N73 C;  1MZ9 A;  1FDM A;  5APY A;  2R3S A;  2XXM A;  4RO0 A;  2UWJ E;  3H0D A;  1ZME C;  2FYU K;  1SQB K;  4HB1 A;  2FXO A;  2G3A A;  2I8D A;  1A8O A;  2JAZ A;  2N50 A;  1KFN A;  1RQU A;  2LF4 A;  2L9F A;  4OGQ C;  2PFX A;  4R4L A;  3H32 A;  1GU5 A;  3CCE P;  1XTC C;  2LKI A;  2KOR A;  2PNG A;  1RF1 B;  1SFC A;  1KN7 A;  1JEK A;  3M0D C;  4U0E A;  3ITK A;  3VTP C;  3TK1 A;  2PEJ A;  1JUN A;  2BUO A;  5KJ7 C;  2MD9 A;  5AVU B;  5GTI H;  1SQP G;  3EQ2 A;  3P05 A;  2L4B A;  5APQ A;  3EFG A;  3B4Q A;  5CCH C;  2KS1 A;  3AE4 C;  3CMA P;  4H2Y C;  2WSE H;  4PD4 H;  2XZ1 C;  2E76 C;  1GL2 D;  1VQL P;  1BE3 D;  4JYC A;  2GYK A;  3L71 J;  3PHL A;  1MKM A;  3AE1 C;  5KLV E;  4CA3 A;  2GZF A;  2QE7 H;  3U59 A;  1LTJ B;  2FVE A;  1RF0 C;  1SQX J;  3E2D A;  1LGH B;  1VQO P;  2RMZ A;  1E0H A;  3VP9 A;  4DOJ A;  4XFZ A;  1IMP A;  1UNK A;  4HKZ H;  2PRR A;  1YIJ P;  1LWU A;  2JU2 A;  1UJZ A;  2E42 A;  1LNQ A;  1N2D C;  3BCC G;  2N6Y A;  3M06 A;  1T8K A;  2LXC B;  5CCH D;  1M57 D;  4Y99 B;  1NTM J;  1FZC A;  1AQ5 A;  3L73 G;  2V4H A;  3D6Z A;  3TGU E;  1VKU A;  1UII A;  4GOF A;  1L0N J;  2YKQ A;  3BRT B;  1SP4 A;  2JO1 A;  1S3J A;  2FYZ A;  1WRG A;  3O6Q A;  3P8M C;  3HTK B;  3U1C A;  3EWK A;  2N1T A;  3RK3 C;  2ZAE B;  1PFI A;  2EHT A;  3V4W A;  2A45 I;  1HJ0 A;  3E1I A;  2KOQ A;  1QVF O;  4U3F E;  1K30 A;  2GZI A;  5F2K A;  1F80 D;  2LIW A;  1SQP J;  3V2R A;  4XFY A;  2AXT H;  1G2C A;  2KGD A;  4BPH A;  4XE5 B;  3CCS P;  1NTM E;  2XND H;  1W5C E;  2KOG A;  3RK2 B;  4Y28 J;  2XT1 A;  2MY5 A;  3L72 G;  1AQT A;  2E75 D;  1BSN A;  1T3J A;  2L22 A;  3VMY A;  1LT9 C;  5TJH A;  1KIL C;  4N78 D;  1L2P A;  3O8Z A;  2IZ0 A;  4AYC A;  4H13 C;  1Q82 Q;  1QL2 A;  3GF7 A;  1GXH A;  1SQV G;  1EXI A;  4MRT C;  2QIW A;  1MUU A;  1OXZ A;  3GG2 A;  2LML A;  3CXC O;  4H13 B;  2J5U A;  3HD7 A;  2WPS A;  3CX5 E;  3L71 E;  5M1B A;  1DIP A;  3H1H D;  4W7Z A;  4LLH A;  2QM7 A;  1J2J B;  3HD7 D;  3IAO A;  1HH0 A;  5HV8 A;  4N78 E;  2EHS A;  2K5X A;  3T97 B;  5AVT B;  1X8Y A;  2RN0 A;  3TGU J;  2CPS A;  2K37 A;  3L74 G;  3V4Q A;  2M3B A;  1SQB J;  1JNM A;  1LWU B;  1BAJ A;  3B5N B;  3N4X A;  1LP1 B;  1VDF A;  5APT A;  4GIF A;  4HKG A;  4UB6 H;  1LP1 A;  3W68 A;  1SQV E;  1OVR A;  1Z56 A;  1M1J C;  4K35 A;  1KIL D;  3LW5 H;  1OX3 A;  2IDB A;  2K0D X;  5GTI E;  4PD4 E;  2NZ2 A;  1PGO A;  4GOE A;  2D2C C;  3HZQ A;  3F5H A;  3RBX A;  2YKP A;  1FE6 A;  2GDX A;  2YXQ B;  3L73 D;  1OVV A;  3L70 D;  2EIA A;  2E74 B;  1JMM A;  4H44 B;  1HUC A;  2N1T D;  1VQN P;  4GDO A;  1BE3 G;  2YIU C;  4PV1 D;  4H0L C;  2KZI A;  5KLI C;  3FX0 A;  2YO3 A;  1E79 H;  1NHL A;  2N98 A;  3G0V A;  3G9R A;  1SFC B;  3CC4 P;  2ZJS E;  2GDW A;  2M8L A;  1WT6 A;  2FYU G;  4L75 A;  1KMI Z;  4BRY A;  1CSB A;  4ZMD A;  5KAF H;  2XV5 A;  4WWI A;  1N7S D;  2FAC A;  1NYH A;  2IFN A;  2H88 C;  2B88 A;  1VQ8 P;  2FQ1 A;  1AA0 A;  2IBZ E;  1RNI A;  3SWF A;  1PEQ A;  1OWA A;  3JCU H;  4HH2 A;  2K0X A;  2BEZ F;  1EIA A;  2K94 A;  2KB7 P;  3AEA C;  2W6J H;  3CWB E;  4UB8 E;  3CC2 P;  1KTM A;  1IUQ A;  1BDD A;  1OVU A;  3LIE A;  2C0W A;  1HWT C;  2QSI A;  5K5G B;  2JJL A;  3FXE A;  3H1I J;  1FDI A;  1GDT A;  1U7M A;  2IPP A;  1JOC A;  1OZH A;  2E76 D;  2A45 G;  5CJ4 A;  5BVZ A;  3GHG B;  4D6T E;  3RK3 E;  2ZXX A;  2MVV A;  4H44 C;  2M8R A;  1BDC A;  2LR2 A;  2CPB A;  2P10 A;  1X3O A;  2WSC J;  3CX5 H;  1MV8 A;  5CMZ A;  1P84 E;  2M8N A;  3AEF C;  1PGP A;  3VMA A;  2WPR A;  3L75 D;  3QH9 A;  1M1J B;  3A0B H;  1T8Z A;  3DS3 A;  1HGZ A;  3L71 D;  2H7H A;  1DD4 A;  1G1J A;  2HLO A;  3CCJ P;  1EDL A;  4WYM A;  2HFE D;  1JTH A;  1LT1 A;  1T2K D;  1KYO H;  1SQP E;  2HOD A;  2ZT9 C;  4GOD A;  5KP8 B;  1YQ3 C;  4IZ6 A;  1X22 A;  1KC8 Q;  1VPC A;  2FQ2 A;  1A43 A;  3SWK A;  1BGY E;  2O01 H;  1PP9 G;  1IFN A;  1RE4 C;  2Y0E A;  3B71 A;  3GJN A;  3V2P A;  1NAF A;  5KKZ C;  1EDI A;  1GK4 A;  2YO2 A;  3NTN A;  1CZQ A;  3HUS C;  4YXD C;  5F2O A;  2WSE J;  1SQQ G;  3DS1 A;  2OYI A;  4D6T D;  4UB6 E;  1N7S B;  3VYI A;  2VLN A;  1JCC A;  1KB9 I;  1SQV D;  1FZG A;  4EOT A;  1VL2 A;  2X2B A;  3G1G A;  3LMO A;  4HJG H;  1QGK B;  3H1L D;  1SQV J;  5CCH A;  4U0B A;  2FYU E;  5AVW B;  3LRY A;  4PWV B;  1L0L J;  5HVC A;  5KP7 B;  2OYI C;  5AW4 B;  1ZNV A;  4U0A A;  4GR2 A;  1RE3 C;  4COP A;  1S4X A;  3CCL P;  4IFF A;  3I55 P;  4C46 A;  1BGY G;  1YIT P;  3L74 J;  1N86 A;  3WU2 H;  2WQY C;  1J1D B;  2ONT A;  1LWU C;  2QJK B;  2IBZ I;  4WY4 B;  1LTG C;  4YTP C;  5AW1 B;  3V2Q A;  3PRJ A;  2V7Q H;  2FYU D;  2KIK A;  1LTT C;  2QVA A;  2OTJ P;  1NTK E;  3EJD A;  2NPS A;  3AEC C;  2AXT E;  2AVA A;  5BU5 A;  3NY7 B;  3O6Q B;  1BCC G;  4H2W C;  3OA7 A;  1BE3 E;  2O1J A;  2XU6 A;  3GW6 A;  4ZKP A;  3GKL C;  2JU1 A;  1P84 D;  2BEQ D;  2Z4E A;  3DS0 A;  1M1K Q;  1AJY A;  1PEU A;  1YQ4 C;  3CXH I;  1JM0 A;  2Q3E A;  3I5C A;  2JKV A;  3B5N C;  2M0B A;  1AFO A;  3EFF K;  3L36 A;  3PP5 A;  5AVS B;  3DTJ A;  1K9M Q;  2Z45 A;  1R5L A;  3HE5 B;  1IFD A;  2FHS C;  3Q3D A;  4H0L D;  3CLQ A;  4N3Y B;  5EFW B;  1J1D C;  5L8R J;  1USE A;  1SQP D;  3TNU A;  1N7S A;  2FXM A;  1BSH A;  1NTZ D;  3A2A A;  2FY8 A;  5CCG C;  2KR5 A;  2ZVN B;  5KLV K;  5TIS E;  2GDY A;  3HRN A;  3KXD A;  1L0N E;  2ZT9 D;  3L73 J;  3L72 D;  4YXW H;  4Y99 C;  3DPH A;  2OGU A;  5B5E E;  1J1E C;  3H1I G;  1VHN A;  1FZC C;  1FZA A;  1L0N G;  5KJ7 A;  3V6I A;  3CCV P;  3CI9 A;  5HGN A;  3NMD A;  1BXI A;  5E79 E;  2MR8 A;  3H1I E;  2FYN C;  1D7M A;  4U3F G;  4IL6 X;  2CG5 B;  5KLV D;  1L4A C;  1IMQ A;  2POH A;  1JJ2 O;  3B5N A;  1KB9 E;  2WPV B;  4OH8 B;  4BPF A;  1IK7 A;  3CCQ P;  1RO0 A;  3AE8 C;  1AVY A;  4DG9 A;  2Q1K A;  2K9Y A;  2PAJ A;  2CQ8 A;  4H2X C;  1YI2 P;  2MVU A;  1PV3 A;  3GF3 A;  3BCC D;  1NVO A;  4XA4 A;  3AE7 C;  2E76 B;  5HGM A;  3B5I A;  2K3R A;  1KYO D;  2LTE A;  1L0L E;  1KIL E;  4U7J A;  5AVX B;  1EZV E;  2KOD A;  2BCC E;  1PPJ G;  3SFE C;  1HQB A;  1KD1 Q;  1KQL A;  1SQX E;  3RL0 D;  1AV1 A;  4RKU J;  4KJM A;  3L4F A;  1NTK D;  1Q86 Q;  3M9Q A;  2BHV A;  4JPZ B;  2KGE A;  3A5T A;  1HGV A;  3P8C D;  3M91 A;  2OYO A;  3BCC E;  3KZI E;  1RH5 B;  1JY2 P;  3L70 E;  2B9B A;  3L73 E;  3RGU A;  2BAS A;  4UB8 H;  3P32 A;  1FOS E;  2R5B A;  3Q5P A;  3H1L G;  2M5A A;  1DD3 A;  2H8P D;  5KAI E;  2ZYG A;  4PV1 C;  3CXH E;  3H1L E;  3H1J J;  1EZV G;  5KP6 B;  4TT3 H;  1YTZ I;  2ITA A;  1JCD A;  2XKM A;  3OW2 O;  2D2C D;  1A02 J;  3S1K A;  4PH0 A;  1AUM A;  2QJY B;  1PP9 E;  2E43 A;  1IFJ A;  1SLQ A;  2O1K A;  3Q5R A;  3L72 E;  3R4Y A;  1H0T A;  1AVO A;  2E5Y A;  3C8V A;  1PP9 D;  4OGQ B;  2Y0C A;  4IL6 E;  3AE2 C;  1DNY A;  2AEM A;  3CE7 A;  1QL1 A;  2QRX A;  3BRV B;  2AFE A;  2GZG A;  1IK9 A;  5APV A;  1GXG A;  4JYB A;  4GKG A;  3WMM 0;  5AW7 B;  1ZOY C;  3Q5S A;  2K1A A;  1NJI Q;  1GL2 C;  1P84 I;  1URQ D;  5AW3 B;  4W7Y A;  1N73 B;  3RL0 g;  4BWN A;  3B8E B;  2JYG A;  4NPD A;  4M0I A;  2YXR B;  1LTJ A;  3VRL C;  5BS2 A;  3VOP A;  1E5W A;  2FAD A;  1L4A D;  2PY8 A;  2G8Y A;  3K5B A;  3M0D A;  2CWO A;  4C7R A;  3CWB J;  4I7Z C;  2QNW A;  2XDJ A;  1R8E A;  2VRS A;  1NGM B;  2PEI A;  2WSC H;  3PH0 A;  2W6B A;  2ZXE B;  4EDF A;  1PGJ A;  3GHG A;  3C1L A;  3A0H E;  2KXP B;  1L0I A;  3VMZ A;  2L5G B;  5CZD B;  3GMA A;  1W2E A;  1GL2 A;  1S9K E;  2M8P A;  2HPC B;  2W8Z A;  3CWB G;  1Q90 D;  3RG6 C;  5APX A;  2WTY A;  3HD7 B;  3B4S A;  3L75 G;  5HGO A;  4F37 A;  5KTB A;  1VQ4 P;  2W6A A;  1SQX K;  1RF0 A;  2KLV A;  2HOD B;  1OW7 A;  1PPJ E;  3IF4 A;  3S9O A;  3AE5 C;  3GZM A;  1SQQ E;  2CGQ A;  1LTS C;  2AFD A;  3WBH A;  4PJ0 E;  1VQM P;  2QG4 A;  1H89 A;  3AED C;  1GD2 E;  2KK7 A;  5APW A;  2OQQ A;  1FJK A;  4U0F A;  3MZW B;  4U0C A;  4PXH B;  2PEK A;  1L0N D;  2FQ0 A;  1M90 Q;  1ZMB A;  1H8A A;  4H0L B;  1HF9 A;  2GUV A;  2JQ4 A;  1Y9B A;  2KOO A;  5AVV B;  1JY3 O;  2HR3 A;  1S72 P;  2IYP A;  1JY2 O;  2WSF J;  1JO5 A;  2N6Z A;  1NTZ E;  2D2C B;  3AE6 C;  4KT0 J;  5AVR B;  1J1E B;  2QJY C;  1EDJ A;  1OW8 A;  1KV4 A;  2KNC A;  4XRO A;  1Y8A A;  2LKM A;  5DCK A;  1KQF B;  4BRY B;  3H47 A;  1NTZ G;  3TNU B;  2N9B A;  2QA4 P;  1G1I A;  2GZJ A;  1GMJ A;  1FZF A;  4H44 D;  3HYB A;  1JB0 J;  3G29 A;  2JEE A;  2Q5U A;  3NXS A;  4DCK A;  4PV1 B;  1QLE D;  2Q6Q A;  1SQB E;  1YJN P;  4YPC A;  3WUV A;  1JMB A;  4WY4 A;  2KYV A;  1EC5 A;  2RKL A;  2J59 M;  2FVF A;  2M3E A;  1NTK G;  2FAE A;  1PGQ A;  3C9I A;  2Q7C A;  4L74 A;  1UIX A;  1URQ B;  1RE4 A;  2ZFC A;  3L72 J;  1HVV A;  1X9V A;  2PGD A;  2YIU B;  1ZRT D;  3CX5 D;  2LPK A;  1L4A B;  1VQ7 P;  1R5S A;  2IYO A;  3E7K A;  3RK2 D;  2XZ0 D;  1NU1 E;  2JB0 A;  2KSJ A;  2O3J A;  3VMX A;  2E75 B;  5CJ0 A;  2CK3 H;  2KLU A;  1S5L H;  1S2E A;  1RHZ B;  2FKW B;  1PEO A;  2QEX P;  2OTK E;  1KZU B;  2NPS B;  3BVH A;  1FS0 E;  2OAR A;  1DEB A;  2P7J A;  3H1K G;  2WWW A;  2HPC A;  3TGU D;  1NTK K;  1Y47 A;  4IFM A;  3TGU G;  5BS1 A;  2EG5 A;  3H1K D;  3RL0 B;  1L0L K;  4RJT A;  2MKV A;  1ZR4 A;  1PIX A;  1XTG B;  2KW2 A;  2QM8 A;  3CCM P;  2YNY A;  3OJA B;  3MUD A;  2FFD B;  3H1K J;  1PZQ A;  3BCC J;  5CCG A;  2LIU A;  2N1T C;  2R32 A;  3G3Z A;  2V7Q J;  4B86 A;  1MZ8 A;  4AUW A;  3RK3 B;  1M56 D;  3LID A;  1NU1 J;  2NO8 A;  4U3F J;  3CXH H;  1GU4 A;  2Y9Y A;  5AW8 B;  3DS4 A;  1NU1 G;  1SQX D;  1NTK J;  3RL0 C;  1ZR2 A;  1NQ4 A;  3M1M A;  1NU1 D;  2ZVO B;  3CCR P;  1NKZ B;  3L70 J;  3R2P A;  2PEQ A;  3G71 P;  2AXC A;  1FDO A;  2FFD A;  3H1K E;  2LL8 A;  2DW3 A;  4KHX A;  2RH0 A;  2LXB A;  2SPZ A;  3GZL A;  1KIL B;  2K92 A;  1VF5 D;  1EZV I;  1IJD B;  2B87 B;  2MF4 A;  1EXJ A;  1YJ9 P;  2P67 A;  1RF1 A;  2K2Q A;  1NU1 K;  5AW6 B;  2N1T B;  3TDK A;  3AE9 C;  5KLV J;  2KZJ A;  2K88 A;  1URQ C;  3I56 P;  2L6E A;  3IFM A;  4A7P A;  2FFD C;  2M5A B;  4CPG A;  1FBM A;  1SQP K;  3Q2Y A;  3U1A A;  1AF8 A;  1L4A A;  2A45 H;  4I1L A;  3NTE A;  3L74 E;  1ZW0 A;  3AE3 C;  4LC1 A;  4PD4 I;  3UIA A;  5F2N A;  1FZE A;  3H4E A;  1RF1 C;  2KOS A;  5AW9 B;  4H13 D;  4BXL A;  2ERH A;  3FXD A;  2DGY A;  1SQQ K;  3CC7 P;  2E75 C;  4O9B A;  3G21 A;  2W90 A;  1IFP A;  7CEI A;  1DH3 A;  1RQV A;  5C39 A;  5APS A;  2CNR A;  5AW2 B;  3SFD C;  1N7S C;  5KKZ B;  2JWA A;  4QMA A;  1GL2 B;  2KG6 A;  2ZYD A;  1W2B O;  3N7N A;  3H1H J;  2A06 D;  1ACP A;  2JGP A;  2N5I A;  3B5N D;  5JPA A;  2W27 A;  2A06 E;  2KUB A;  1BGY J;  3D70 A;  1FZB A;  4L76 A;  1HY8 A;  2WSF H;  3W67 A;  3H32 B;  1AYI A;  3OAK A;  1Q7Y Q;  5DJU B;  1BGY D;  1S5L X;  1KYO I;  2LOL A;  2EFJ A;  1FR2 A;  4WBA A;  4WB4 A;  2HYN A;  2E74 D;  1M1J A;  1IFM A;  3G4S P;  1VF5 B;  1MFZ A;  4NPF X;  2WIT A;  1T3U A;  2KP8 A;  2PEM A;  2GZE A;  3P7K A;  3A0H H;  2MR7 A;  1P84 H;  1SQV K;  2JO0 A;  2Z5H A;  4GR6 A;  3HUS B;  1PP9 J;  3S4R A;  4D6T J;  3GHG C;  4D6T G;  5EJD A;  2QJP C;  5H2F E;  3HUS A;  3MHV A;  3Q20 A;  2P2U A;  3F89 A;  1KQG B;  3H6P A;  2OYH B;  1K04 A;  4OVN F;  5CHX A;  1RO2 A;  2C9L Y;  3H1L J;  3HE4 A;  3TYY A;  3RG2 A;  4M3L A;  1Z6M A;  2Z44 A;  1D1D A;  4DZO A;  2AF8 A;  4MN4 C;  1QRJ A;  4OWF A;  4QNB A;  2ZT9 B;  1PPJ D;  1LTI C;  1QEX A;  2VLQ A;  3CCU P;  3G6E P;  3CD6 P;  3JSV C;  3G1I A;  4R0M A;  1ZXG A;  1M7L A;  3CWB D;  5KAI H;  5B66 E;  1DEE G;  2P9X A;  3WUT A;  3U43 A;  1JY3 N;  2WMM A;  1EMV A;  2KWL A;  4R4M A;  1NOH A;  2FYU J;  1SQQ J;  2NPS D;  2DNW A;  1HJB A;  2Q3I A;  1SQB G;  4RES B;  3H1H E;  5CCG D;  4QKO A;  2VLP A;  3P8C E;  5KLV G; 
#chains in the Genus database with same CATH homology
 1RO0 A;  1PEO A;  4PH0 A;  2EFJ A;  4XFX A;  1PEQ A;  3H0D A;  2QEX P;  3WBH A;  1AUM A;  2BQ1 E;  3I56 P;  2L6E A;  1VQM P;  2OAR A;  3DS0 A;  1M1K Q;  1EIA A;  5F2O A;  1YI2 P;  1A8O A;  4U0F A;  3G4S P;  2XV6 A;  1K73 Q;  1PEU A;  4U0C A;  5BS1 A;  3G26 A;  2EG5 A;  3DS1 A;  2PEK A;  3CC2 P;  1BAJ A;  2PEM A;  3NTE A;  1ZMB A;  2Z46 A;  1M90 Q;  2LF4 A;  1QVG O;  1IUQ A;  1E6J P;  5HGM A;  3B5I A;  1YJW P;  1S72 P;  1QVF O;  1N8R Q;  3CPW O;  3CCM P;  2JO0 A;  3CCE P;  1VQ6 P;  1K30 A;  1EOQ A;  2PEN A;  3DTJ A;  5F2K A;  4GR6 A;  1K9M Q;  5F2N A;  3G1G A;  3H4E A;  2Z45 A;  2KOD A;  4IPY A;  4U0D A;  4XFY A;  4U0E A;  1KD1 Q;  1VQK P;  4XRO A;  1M6E X;  3Q20 A;  4U0B A;  2PEJ A;  2BUO A;  1M6N A;  5DCK A;  3LRY A;  2DGY A;  3CCS P;  1PEM A;  1NJI Q;  3H47 A;  1RO2 A;  4COC A;  4U0A A;  4GR2 A;  5HGL A;  2XT1 A;  2QA4 P;  1Q86 Q;  3CC7 P;  3HZQ A;  3G21 A;  2JYG A;  3HYB A;  2BHV A;  3G29 A;  3P05 A;  4M0I A;  4XRQ A;  2Z44 A;  1D1D A;  4COP A;  3CMA P;  3VRL C;  3DS4 A;  3CCL P;  1QRJ A;  2EIA A;  3MGE A;  5BS2 A;  3I55 P;  4QNB A;  1KQS O;  1VQN P;  1YIT P;  1K8A Q;  1VQL P;  2PY8 A;  1YJN P;  2CWO A;  3M1M A;  2M8N A;  2ONT A;  3CCR P;  3CCU P;  1Q82 Q;  3G6E P;  2JYL A;  3CD6 P;  2PEI A;  3DPH A;  3G0V A;  3E2D A;  2PEO A;  3DS3 A;  3G1I A;  1Q81 Q;  1W2B O;  2PEQ A;  3G71 P;  3CC4 P;  1VQO P;  2M8L A;  2E1M A;  3CCJ P;  4WYM A;  5I4T G;  1VQ9 P;  3CXC O;  3CCV P;  3CME P;  5HGN A;  5JPA A;  3DS2 A;  2P9X A;  2M8P A;  1VQP P;  3G28 A;  1M74 A;  4XFZ A;  2OTJ P;  3RG6 C;  1YIJ P;  4PH1 A;  2OTL P;  3DS5 A;  5HGO A;  1VQ7 P;  1KC8 Q;  1VQ4 P;  1YHQ P;  1VQ5 P;  1A43 A;  1JJ2 O;  1YJ9 P;  1Q7Y Q;  1VQ8 P;  3CCQ P;  3OW2 O;  2XXM A;  1RNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...