2KW2A

Solution nmr of the specialized acyl carrier protein (rpa2022) from rhodopseudomonas palustris, northeast structural genomics consortium target rpr324
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
101
structure length
101
Chain Sequence
b'MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Specialized acyl carrier protein
publication title Structure of a specialized acyl carrier protein essential for lipid A biosynthesis with very long-chain fatty acids in open and closed conformations.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Transferase
total genus 29
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2010-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kw2A00
2LPKA 2K94A 2MD9A 2FQ0A 2AFEA 4BPGA 2EHTA 1DV5A 2AVAA 2MR7A 2KGAA 2K2QA 4H2YC 4CA3A 2MVUA 5CZDB 1DNYA 2LMLA 5KP7B 2FQ1A 1HQBA 2LIUA 4H2XC 2FACA 2L4BA 2KW2A 2N98A 2KORA 2L9FA 2JU2A 4MRTC 2M5RA 1HY8A 2L0QA 4PXHB 1VKUA 2PNGA 2KR5A 2LOLA 2CQ8A 1F80D 2KWLA 3RG2A 2XZ0D 5KP8B 2KOSA 1T8KA 2KG8A 2K92A 2LIWA 3EJDA 2FVAA 2KOQA 2KOOA 3EJEA 3NY7B 1KLPA 2LKIA 2MY5A 2N6YA 2FVFA 2KGDA 1ACPA 2FAEA 2MVVA 2CG5B 2JGPA 2MR8A 4IZ6A 2N5IA 4BPFA 4H2WC 5EJDA 2VSQA 2LL8A 4R0MA 2FQ2A 2MF4A 2N6ZA 2DNWA 2AF8A 2JQ4A 2CGQA 1NQ4A 2KOPA 2K0XA 2GDXA 3EJBA 4DG9A 1L0HA 2KG6A 4NEOA 5HV8A 1AF8A 2KGCA 2FADA 3LMOA 1X3OA 2JU1A 2GDYA 2KGEA 2X2BA 3GZLA 2CNRA 1OR5A 2K0YA 2AFDA 2XZ1C 2K93A 2N5HA 2FVEA 5KP6B 2LTEA 2EHSA 4PWVB 4BPHA 2QNWA 2N50A 1L0IA 5HVCA 4HKGA 2FHSC 3CE7A 2GDWA 3GZMA 2KG9A 2ROQA 2L22A
chains in the Genus database with same CATH superfamily
3VRLC 3CCLP 3CCRP 2AFEA 4BPGA 1MZ8A 2AVAA 5JPAA 4XFZA 2VLQA 3P05A 1KD1Q 1M6EX 4H2YC 1DNYA 1Q7YQ 2DGYA 1VQLP 2EIAA 1YJ9P 2FQ1A 3H4EA 2M8PA 4H2XC 5EW5E 2Z45A 4XFYA 1VQMP 1GPJA 2KODA 4QNBA 1CEIA 3G6EP 5BS2A 2PNGA 2LOLA 2PEOA 3DS1A 2CQ8A 2LF4A 2BHVA 2K0DX 2M8LA 1T8KA 2LIWA 2JYGA 3G29A 2LKIA 2MY5A 1S72P 1ACPA 3I56P 4BPFA 1VQ8P 1VQNP 2VSQA 2LL8A 2M8NA 5I4TG 3OW2O 3CCJP 2EG5A 2PEIA 5HGOA 1ZNVA 3HYBA 4DG9A 1AF8A 2JO0A 3LMOA 1K73Q 1YIJP 2JBGA 2BUOA 2KGEA 2AFDA 3G26A 5KP6B 2LTEA 1K9MQ 1VQ4P 3CC4P 3NTEA 4U0EA 1AYIA 3CE7A 3GZMA 1YJNP 4U0FA 2ROQA 2LPKA 1VQ5P 1RO2A 1IUQA 1DV5A 2XV6A 5CZDB 3Q20A 3DPHA 1Q86Q 2LMLA 1FR2A 1A8OA 2KORA 5DCKA 2L9FA 1EIAA 2JU2A 1Q82Q 1HY8A 3B5IA 2L0QA 3G1GA 4PXHB 4PH0A 1VKUA 1M90Q 4IPYA 2KR5A 4WYMA 2GZIA 2XZ0D 2KOSA 1QVFO 3DS5A 3DS4A 2KOOA 3G21A 3NY7B 1IMPA 2N6YA 2FVFA 2MVVA 2JGPA 3M1MA 3H47A 7CEIA 1D1DA 5HGLA 4R0MA 1VQ9P 2AF8A 2DNWA 1VQ7P 1NQ4A 1Q81Q 3CC7P 1L0HA 3DS0A 4NEOA 1KC8Q 3G71P 2KGCA 4GR2A 2JU1A 2OTJP 2PEKA 4QKOA 2L6EA 3LRYA 1AUMA 2K0YA 3WBHA 4U0AA 2XZ1C 2E1MA 2N5HA 1EOQA 1GXGA 2EHSA 4PWVB 2XT1A 3GKLC 1JJ2O 3CPWO 5HVCA 3CMEP 2FHSC 2KG9A 3CMAP 5F2NA 2OTLP 3DTJA 2FQ0A 1VQOP 1Z6MA 2MR7A 4COPA 3MGEA 2VLNA 2KGAA 4CA3A 3DS3A 3I55P 5KP7B 1BAJA 1K8AQ 1HQBA 2FACA 2L4BA 4MRTC 2M5RA 4F37A 3CCSP 2PY8A 5F2KA 1F80D 2KWLA 2JB0A 5F2OA 2QA4P 3B4QA 5KP8B 2GYKA 1A43A 1W2BO 1YJWP 2KG8A 2K92A 2QEXP 2CWOA 3EJDA 2FVAA 1EMVA 2KOQA 3EJEA 1KLPA 4XROA 2KGDA 2CG5B 2MR8A 2VLOA 5EJDA 4U0CA 1N8RQ 3H0DA 2VLPA 2Z44A 2JQ4A 3HZQA 1E0HA 3CD6P 2GDXA 3G0VA 3CCMP 3EJBA 2KG6A 5HV8A 1E6JP 1M1KQ 2FADA 2Z46A 4M0IA 1UNKA 1NJIQ 2GDYA 3CCUP 1K30A 2CNRA 1OR5A 2GZEA 3GJNA 2K93A 3CCQP 1M74A 4BPHA 2N50A 1L0IA 4HKGA 1VQKP 3CCEP 4PH1A 2K94A 2MD9A 2EHTA 5HGNA 4COCA 2OARA 2K2QA 2MVUA 4XRQA 3G28A 2JYLA 3CCVP 3G1IA 2ONTA 4GR6A 2LIUA 2GZJA 2KW2A 2N98A 2PEJA 1M6NA 2PEQA 2XXMA 4UHPB 4U0BA 5HGMA 1VHNA 3RG2A 1YHQP 2PEMA 1GXHA 4XFXA 1BXIA 1KQSO 2ERHA 3E2DA 2FAEA 1RNIA 2GZFA 1VQ6P 4IZ6A 2N5IA 2NO8A 4H2WC 2P9XA 1QRJA 2FQ2A 2MF4A 2GZGA 2N6ZA 2EFJA 2K5XA 1YITP 2CGQA 3RG6C 3CXCO 3G4SP 3CC2P 2KOPA 2K0XA 1IMQA 1QVGO 1RO0A 1ZMBA 1X3OA 2JAZA 2PENA 2X2BA 4U0DA 3GZLA 2FVEA 1VQPP 2QNWA 1UJZA 3DS2A 3U43A 2GDWA 5BS1A 1YI2P 2WPTA 2L22A
chains in the Genus database with same CATH topology
2LPKA 2K94A 2MD9A 2FQ0A 2AFEA 4BPGA 2EHTA 1DV5A 2AVAA 2MR7A 2KGAA 2K2QA 4H2YC 4CA3A 2MVUA 5CZDB 1DNYA 2LMLA 5KP7B 2FQ1A 1HQBA 2LIUA 4H2XC 2FACA 2L4BA 2KW2A 2N98A 2KORA 2L9FA 2JU2A 4MRTC 2M5RA 1HY8A 2L0QA 4PXHB 1VKUA 2PNGA 2KR5A 2LOLA 2CQ8A 1F80D 2KWLA 3RG2A 2XZ0D 5KP8B 2KOSA 1T8KA 2KG8A 2K92A 2LIWA 3EJDA 2FVAA 2KOQA 2KOOA 3EJEA 3NY7B 1KLPA 2LKIA 2MY5A 2N6YA 2FVFA 2KGDA 1ACPA 2FAEA 2MVVA 2CG5B 2JGPA 2MR8A 4IZ6A 2N5IA 4BPFA 4H2WC 5EJDA 2VSQA 2LL8A 4R0MA 2FQ2A 2MF4A 2N6ZA 2DNWA 2AF8A 2JQ4A 2CGQA 1NQ4A 2KOPA 2K0XA 2GDXA 3EJBA 4DG9A 1L0HA 2KG6A 4NEOA 5HV8A 1AF8A 2KGCA 2FADA 3LMOA 1X3OA 2JU1A 2GDYA 2KGEA 2X2BA 3GZLA 2CNRA 1OR5A 2K0YA 2AFDA 2XZ1C 2K93A 2N5HA 2FVEA 5KP6B 2LTEA 2EHSA 4PWVB 4BPHA 2QNWA 2N50A 1L0IA 5HVCA 4HKGA 2FHSC 3CE7A 2GDWA 3GZMA 2KG9A 2ROQA 2L22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPK A;  2K94 A;  2MD9 A;  2FQ0 A;  2AFE A;  4BPG A;  2EHT A;  1DV5 A;  2AVA A;  2MR7 A;  2KGA A;  2K2Q A;  4H2Y C;  4CA3 A;  2MVU A;  5CZD B;  1DNY A;  2LML A;  5KP7 B;  2FQ1 A;  1HQB A;  2LIU A;  4H2X C;  2FAC A;  2L4B A;  2KW2 A;  2N98 A;  2KOR A;  2L9F A;  2JU2 A;  4MRT C;  2M5R A;  1HY8 A;  2L0Q A;  4PXH B;  1VKU A;  2PNG A;  2KR5 A;  2LOL A;  2CQ8 A;  1F80 D;  2KWL A;  3RG2 A;  2XZ0 D;  5KP8 B;  2KOS A;  1T8K A;  2KG8 A;  2K92 A;  2LIW A;  3EJD A;  2FVA A;  2KOQ A;  2KOO A;  3EJE A;  3NY7 B;  1KLP A;  2LKI A;  2MY5 A;  2N6Y A;  2FVF A;  2KGD A;  1ACP A;  2FAE A;  2MVV A;  2CG5 B;  2JGP A;  2MR8 A;  4IZ6 A;  2N5I A;  4BPF A;  4H2W C;  5EJD A;  2VSQ A;  2LL8 A;  4R0M A;  2FQ2 A;  2MF4 A;  2N6Z A;  2DNW A;  2AF8 A;  2JQ4 A;  2CGQ A;  1NQ4 A;  2KOP A;  2K0X A;  2GDX A;  3EJB A;  4DG9 A;  1L0H A;  2KG6 A;  4NEO A;  5HV8 A;  1AF8 A;  2KGC A;  2FAD A;  3LMO A;  1X3O A;  2JU1 A;  2GDY A;  2KGE A;  2X2B A;  3GZL A;  2CNR A;  1OR5 A;  2K0Y A;  2AFD A;  2XZ1 C;  2K93 A;  2N5H A;  2FVE A;  5KP6 B;  2LTE A;  2EHS A;  4PWV B;  4BPH A;  2QNW A;  2N50 A;  1L0I A;  5HVC A;  4HKG A;  2FHS C;  3CE7 A;  2GDW A;  3GZM A;  2KG9 A;  2ROQ A;  2L22 A; 
#chains in the Genus database with same CATH topology
 3VRL C;  3CCL P;  3CCR P;  2AFE A;  4BPG A;  1MZ8 A;  2AVA A;  5JPA A;  4XFZ A;  2VLQ A;  3P05 A;  1KD1 Q;  1M6E X;  4H2Y C;  1DNY A;  1Q7Y Q;  2DGY A;  1VQL P;  2EIA A;  1YJ9 P;  2FQ1 A;  3H4E A;  2M8P A;  4H2X C;  5EW5 E;  2Z45 A;  4XFY A;  1VQM P;  1GPJ A;  2KOD A;  4QNB A;  1CEI A;  3G6E P;  5BS2 A;  2PNG A;  2LOL A;  2PEO A;  3DS1 A;  2CQ8 A;  2LF4 A;  2BHV A;  2K0D X;  2M8L A;  1T8K A;  2LIW A;  2JYG A;  3G29 A;  2LKI A;  2MY5 A;  1S72 P;  1ACP A;  3I56 P;  4BPF A;  1VQ8 P;  1VQN P;  2VSQ A;  2LL8 A;  2M8N A;  5I4T G;  3OW2 O;  3CCJ P;  2EG5 A;  2PEI A;  5HGO A;  1ZNV A;  3HYB A;  4DG9 A;  1AF8 A;  2JO0 A;  3LMO A;  1K73 Q;  1YIJ P;  2JBG A;  2BUO A;  2KGE A;  2AFD A;  3G26 A;  5KP6 B;  2LTE A;  1K9M Q;  1VQ4 P;  3CC4 P;  3NTE A;  4U0E A;  1AYI A;  3CE7 A;  3GZM A;  1YJN P;  4U0F A;  2ROQ A;  2LPK A;  1VQ5 P;  1RO2 A;  1IUQ A;  1DV5 A;  2XV6 A;  5CZD B;  3Q20 A;  3DPH A;  1Q86 Q;  2LML A;  1FR2 A;  1A8O A;  2KOR A;  5DCK A;  2L9F A;  1EIA A;  2JU2 A;  1Q82 Q;  1HY8 A;  3B5I A;  2L0Q A;  3G1G A;  4PXH B;  4PH0 A;  1VKU A;  1M90 Q;  4IPY A;  2KR5 A;  4WYM A;  2GZI A;  2XZ0 D;  2KOS A;  1QVF O;  3DS5 A;  3DS4 A;  2KOO A;  3G21 A;  3NY7 B;  1IMP A;  2N6Y A;  2FVF A;  2MVV A;  2JGP A;  3M1M A;  3H47 A;  7CEI A;  1D1D A;  5HGL A;  4R0M A;  1VQ9 P;  2AF8 A;  2DNW A;  1VQ7 P;  1NQ4 A;  1Q81 Q;  3CC7 P;  1L0H A;  3DS0 A;  4NEO A;  1KC8 Q;  3G71 P;  2KGC A;  4GR2 A;  2JU1 A;  2OTJ P;  2PEK A;  4QKO A;  2L6E A;  3LRY A;  1AUM A;  2K0Y A;  3WBH A;  4U0A A;  2XZ1 C;  2E1M A;  2N5H A;  1EOQ A;  1GXG A;  2EHS A;  4PWV B;  2XT1 A;  3GKL C;  1JJ2 O;  3CPW O;  5HVC A;  3CME P;  2FHS C;  2KG9 A;  3CMA P;  5F2N A;  2OTL P;  3DTJ A;  2FQ0 A;  1VQO P;  1Z6M A;  2MR7 A;  4COP A;  3MGE A;  2VLN A;  2KGA A;  4CA3 A;  3DS3 A;  3I55 P;  5KP7 B;  1BAJ A;  1K8A Q;  1HQB A;  2FAC A;  2L4B A;  4MRT C;  2M5R A;  4F37 A;  3CCS P;  2PY8 A;  5F2K A;  1F80 D;  2KWL A;  2JB0 A;  5F2O A;  2QA4 P;  3B4Q A;  5KP8 B;  2GYK A;  1A43 A;  1W2B O;  1YJW P;  2KG8 A;  2K92 A;  2QEX P;  2CWO A;  3EJD A;  2FVA A;  1EMV A;  2KOQ A;  3EJE A;  1KLP A;  4XRO A;  2KGD A;  2CG5 B;  2MR8 A;  2VLO A;  5EJD A;  4U0C A;  1N8R Q;  3H0D A;  2VLP A;  2Z44 A;  2JQ4 A;  3HZQ A;  1E0H A;  3CD6 P;  2GDX A;  3G0V A;  3CCM P;  3EJB A;  2KG6 A;  5HV8 A;  1E6J P;  1M1K Q;  2FAD A;  2Z46 A;  4M0I A;  1UNK A;  1NJI Q;  2GDY A;  3CCU P;  1K30 A;  2CNR A;  1OR5 A;  2GZE A;  3GJN A;  2K93 A;  3CCQ P;  1M74 A;  4BPH A;  2N50 A;  1L0I A;  4HKG A;  1VQK P;  3CCE P;  4PH1 A;  2K94 A;  2MD9 A;  2EHT A;  5HGN A;  4COC A;  2OAR A;  2K2Q A;  2MVU A;  4XRQ A;  3G28 A;  2JYL A;  3CCV P;  3G1I A;  2ONT A;  4GR6 A;  2LIU A;  2GZJ A;  2KW2 A;  2N98 A;  2PEJ A;  1M6N A;  2PEQ A;  2XXM A;  4UHP B;  4U0B A;  5HGM A;  1VHN A;  3RG2 A;  1YHQ P;  2PEM A;  1GXH A;  4XFX A;  1BXI A;  1KQS O;  2ERH A;  3E2D A;  2FAE A;  1RNI A;  2GZF A;  1VQ6 P;  4IZ6 A;  2N5I A;  2NO8 A;  4H2W C;  2P9X A;  1QRJ A;  2FQ2 A;  2MF4 A;  2GZG A;  2N6Z A;  2EFJ A;  2K5X A;  1YIT P;  2CGQ A;  3RG6 C;  3CXC O;  3G4S P;  3CC2 P;  2KOP A;  2K0X A;  1IMQ A;  1QVG O;  1RO0 A;  1ZMB A;  1X3O A;  2JAZ A;  2PEN A;  2X2B A;  4U0D A;  3GZL A;  2FVE A;  1VQP P;  2QNW A;  1UJZ A;  3DS2 A;  3U43 A;  2GDW A;  5BS1 A;  1YI2 P;  2WPT A;  2L22 A; 
#chains in the Genus database with same CATH homology
 2LPK A;  2K94 A;  2MD9 A;  2FQ0 A;  2AFE A;  4BPG A;  2EHT A;  1DV5 A;  2AVA A;  2MR7 A;  2KGA A;  2K2Q A;  4H2Y C;  4CA3 A;  2MVU A;  5CZD B;  1DNY A;  2LML A;  5KP7 B;  2FQ1 A;  1HQB A;  2LIU A;  4H2X C;  2FAC A;  2L4B A;  2KW2 A;  2N98 A;  2KOR A;  2L9F A;  2JU2 A;  4MRT C;  2M5R A;  1HY8 A;  2L0Q A;  4PXH B;  1VKU A;  2PNG A;  2KR5 A;  2LOL A;  2CQ8 A;  1F80 D;  2KWL A;  3RG2 A;  2XZ0 D;  5KP8 B;  2KOS A;  1T8K A;  2KG8 A;  2K92 A;  2LIW A;  3EJD A;  2FVA A;  2KOQ A;  2KOO A;  3EJE A;  3NY7 B;  1KLP A;  2LKI A;  2MY5 A;  2N6Y A;  2FVF A;  2KGD A;  1ACP A;  2FAE A;  2MVV A;  2CG5 B;  2JGP A;  2MR8 A;  4IZ6 A;  2N5I A;  4BPF A;  4H2W C;  5EJD A;  2VSQ A;  2LL8 A;  4R0M A;  2FQ2 A;  2MF4 A;  2N6Z A;  2DNW A;  2AF8 A;  2JQ4 A;  2CGQ A;  1NQ4 A;  2KOP A;  2K0X A;  2GDX A;  3EJB A;  4DG9 A;  1L0H A;  2KG6 A;  4NEO A;  5HV8 A;  1AF8 A;  2KGC A;  2FAD A;  3LMO A;  1X3O A;  2JU1 A;  2GDY A;  2KGE A;  2X2B A;  3GZL A;  2CNR A;  1OR5 A;  2K0Y A;  2AFD A;  2XZ1 C;  2K93 A;  2N5H A;  2FVE A;  5KP6 B;  2LTE A;  2EHS A;  4PWV B;  4BPH A;  2QNW A;  2N50 A;  1L0I A;  5HVC A;  4HKG A;  2FHS C;  3CE7 A;  2GDW A;  3GZM A;  2KG9 A;  2ROQ A;  2L22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...