2KW2A

Solution nmr of the specialized acyl carrier protein (rpa2022) from rhodopseudomonas palustris, northeast structural genomics consortium target rpr324
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
101
structure length
101
Chain Sequence
MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Specialized acyl carrier protein
publication title Structure of a specialized acyl carrier protein essential for lipid A biosynthesis with very long-chain fatty acids in open and closed conformations.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Transferase
total genus 29
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2010-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kw2A00
2KG6A 1VKUA 1L0HA 2FVEA 3RG2A 2KG8A 2N5IA 2N5HA 5KP8B 2FHSC 2FVFA 2JU1A 2KG9A 2KOQA 3CE7A 2AF8A 1DV5A 3LMOA 1L0IA 2MF4A 2L0QA 2GDWA 2JU2A 2FQ1A 2QNWA 3EJBA 2XZ1C 1OR5A 2MVVA 2MD9A 2N50A 3GZLA 2CGQA 4BPHA 2FVAA 1X3OA 2L4BA 2KOSA 2LMLA 1F80D 1HQBA 2CNRA 2ROQA 2MR8A 2LIWA 2LTEA 2KOPA 2LOLA 2K0XA 2N98A 4H2XC 2MR7A 4H2WC 4PXHB 2N6YA 2KWLA 2PNGA 4CA3A 2EHSA 2GDYA 5HVCA 3EJDA 5EJDA 4H2YC 2KGCA 2MVUA 2GDXA 4PWVB 1T8KA 2JGPA 2KGEA 2EHTA 1KLPA 2KGAA 4MRTC 2K0YA 2KR5A 2LL8A 2XZ0D 2AFDA 2MY5A 2KW2A 3NY7B 2FAEA 2FQ0A 2VSQA 2L22A 2K2QA 2AVAA 3EJEA 2LPKA 2X2BA 4BPGA 2AFEA 2KORA 2FACA 2KOOA 4IZ6A 2KGDA 2LKIA 5KP6B 4NEOA 2K92A 2L9FA 2DNWA 3GZMA 2CG5B 2FADA 4HKGA 2N6ZA 5CZDB 2JQ4A 1NQ4A 2CQ8A 4BPFA 2LIUA 5HV8A 2K94A 1HY8A 2M5RA 1AF8A 1DNYA 5KP7B 1ACPA 2FQ2A 4DG9A 4R0MA 2K93A
chains in the Genus database with same CATH superfamily
1EMVA 1VKUA 1VQ7P 2QA4P 2FHSC 2PY8A 3G1GA 2GZFA 2JU2A 3CPWO 5HGNA 2EFJA 5HGOA 2XZ1C 2MD9A 3CC7P 2VLQA 2KODA 2EG5A 2XT1A 1BAJA 1YI2P 1QVFO 4F37A 2LMLA 1VQOP 5EW5E 2DGYA 3CCLP 3CCUP 2LTEA 2K0XA 4H2XC 4H2WC 4PXHB 1E6JP 3P05A 4XFZA 3CCVP 2GDYA 2KGCA 4WYMA 3H4EA 2MVUA 2QEXP 2Z44A 7CEIA 1IMQA 4UHPB 2LL8A 2AFDA 3G0VA 2L22A 2ERHA 2LPKA 2X2BA 2AFEA 1ZNVA 1Z6MA 4XFYA 2KGDA 4NEOA 2OARA 1A43A 3G21A 4HKGA 2N6ZA 1QVGO 1NQ4A 1K8AQ 2CQ8A 4BPFA 2PEJA 2M5RA 2GYKA 1AUMA 1VQNP 2PEQA 2K93A 2KG6A 1VQ5P 1W2BO 1L0HA 1M74A 3RG2A 2N5IA 3GJNA 2N5HA 3U43A 5KP8B 2K5XA 1L0IA 2JYLA 2L0QA 2GDWA 2M8LA 3G4SP 2PENA 2Z46A 4XFXA 2FQ1A 2QNWA 3EJBA 3MGEA 2MVVA 4XROA 2CGQA 3OW2O 3DS0A 3M1MA 5DCKA 2GZIA 1X3OA 3CCRP 1VQ6P 2M8PA 3I55P 1GXHA 3G29A 3HYBA 2WPTA 1YIJP 3GKLC 1FR2A 2VLNA 1UJZA 5BS1A 2EIAA 5F2NA 3CC2P 5HVCA 5EJDA 4PH1A 1T8KA 3CMAP 1K9MQ 2KR5A 2XZ0D 3NY7B 5F2OA 2VSQA 5HGLA 2K2QA 4BPGA 4U0DA 3H0DA 2KORA 3CCJP 2KOOA 3RG6C 2LKIA 1KD1Q 1YJNP 2K92A 2JB0A 2FADA 2GZJA 3DS4A 1VQ9P 5CZDB 4U0AA 1Q82Q 2K94A 1Q86Q 1HY8A 1ACPA 2XV6A 2PEKA 1M6NA 1VQLP 2JYGA 1RO0A 1D1DA 2FVFA 2JU1A 2KG9A 5F2KA 3DS2A 2MF4A 3G26A 1Q81Q 5JPAA 2Z45A 4QKOA 3DS1A 4PH0A 1M1KQ 4COCA 1OR5A 2N50A 4BPHA 2FVAA 2E1MA 2L4BA 1VQPP 2JBGA 1K73Q 3B4QA 2KOSA 3DS3A 3CC4P 1HQBA 2LIWA 2GZEA 2KOPA 2LOLA 2N98A 1Q7YQ 2MR7A 1QRJA 2KWLA 3DPHA 1EOQA 1IUQA 1RO2A 2BHVA 3EJDA 3E2DA 4H2YC 3CCSP 2L6EA 2GZGA 4GR2A 2GDXA 4PWVB 2JGPA 4U0BA 2K0YA 1YJWP 1M90Q 4IPYA 1KQSO 2KW2A 1E0HA 2FAEA 2FQ0A 4U0EA 2AVAA 3EJEA 1IMPA 3CCQP 4IZ6A 4COPA 4QNBA 5KP6B 1YJ9P 3CCMP 1KC8Q 5HGMA 3G6EP 5BS2A 2CG5B 3H47A 3LRYA 1AYIA 2JQ4A 4U0CA 3Q20A 5HV8A 3WBHA 2ONTA 1VHNA 5KP7B 3G71P 2FQ2A 4R0MA 3CMEP 2FVEA 2KG8A 1YITP 4XRQA 2OTLP 1A8OA 2KOQA 3CE7A 2AF8A 1DV5A 3LMOA 3NTEA 1NJIQ 2PEMA 1UNKA 3GZLA 4GR6A 3HZQA 2JO0A 2CWOA 1K30A 2BUOA 1S72P 1VQMP 2P9XA 1EIAA 1GPJA 1F80D 2CNRA 2ROQA 1RNIA 2MR8A 2M8NA 2PEIA 1BXIA 1VQ4P 1VQKP 2N6YA 2PNGA 4CA3A 1M6EX 2EHSA 1MZ8A 3VRLC 2VLOA 1GXGA 2NO8A 2KGEA 2EHTA 2LF4A 1KLPA 2KGAA 4MRTC 2VLPA 3G1IA 2MY5A 1CEIA 2XXMA 3I56P 2JAZA 1YHQP 2OTJP 1ZMBA 2FACA 1VQ8P 3G28A 3DTJA 2L9FA 3CXCO 2DNWA 2K0DX 3GZMA 2PEOA 3DS5A 3B5IA 5I4TG 4M0IA 2LIUA 3CCEP 1JJ2O 1AF8A 1DNYA 4DG9A 3CD6P 4U0FA 1N8RQ
chains in the Genus database with same CATH topology
2KG6A 1VKUA 1L0HA 2FVEA 3RG2A 2KG8A 2N5IA 2N5HA 5KP8B 2FHSC 2FVFA 2JU1A 2KG9A 2KOQA 3CE7A 2AF8A 1DV5A 3LMOA 1L0IA 2MF4A 2L0QA 2GDWA 2JU2A 2FQ1A 2QNWA 3EJBA 2XZ1C 1OR5A 2MVVA 2MD9A 2N50A 3GZLA 2CGQA 4BPHA 2FVAA 1X3OA 2L4BA 2KOSA 2LMLA 1F80D 1HQBA 2CNRA 2ROQA 2MR8A 2LIWA 2LTEA 2KOPA 2LOLA 2K0XA 2N98A 4H2XC 2MR7A 4H2WC 4PXHB 2N6YA 2KWLA 2PNGA 4CA3A 2EHSA 2GDYA 5HVCA 3EJDA 5EJDA 4H2YC 2KGCA 2MVUA 2GDXA 4PWVB 1T8KA 2JGPA 2KGEA 2EHTA 1KLPA 2KGAA 4MRTC 2K0YA 2KR5A 2LL8A 2XZ0D 2AFDA 2MY5A 2KW2A 3NY7B 2FAEA 2FQ0A 2VSQA 2L22A 2K2QA 2AVAA 3EJEA 2LPKA 2X2BA 4BPGA 2AFEA 2KORA 2FACA 2KOOA 4IZ6A 2KGDA 2LKIA 5KP6B 4NEOA 2K92A 2L9FA 2DNWA 3GZMA 2CG5B 2FADA 4HKGA 2N6ZA 5CZDB 2JQ4A 1NQ4A 2CQ8A 4BPFA 2LIUA 5HV8A 2K94A 1HY8A 2M5RA 1AF8A 1DNYA 5KP7B 1ACPA 2FQ2A 4DG9A 4R0MA 2K93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG6 A;  1VKU A;  1L0H A;  2FVE A;  3RG2 A;  2KG8 A;  2N5I A;  2N5H A;  5KP8 B;  2FHS C;  2FVF A;  2JU1 A;  2KG9 A;  2KOQ A;  3CE7 A;  2AF8 A;  1DV5 A;  3LMO A;  1L0I A;  2MF4 A;  2L0Q A;  2GDW A;  2JU2 A;  2FQ1 A;  2QNW A;  3EJB A;  2XZ1 C;  1OR5 A;  2MVV A;  2MD9 A;  2N50 A;  3GZL A;  2CGQ A;  4BPH A;  2FVA A;  1X3O A;  2L4B A;  2KOS A;  2LML A;  1F80 D;  1HQB A;  2CNR A;  2ROQ A;  2MR8 A;  2LIW A;  2LTE A;  2KOP A;  2LOL A;  2K0X A;  2N98 A;  4H2X C;  2MR7 A;  4H2W C;  4PXH B;  2N6Y A;  2KWL A;  2PNG A;  4CA3 A;  2EHS A;  2GDY A;  5HVC A;  3EJD A;  5EJD A;  4H2Y C;  2KGC A;  2MVU A;  2GDX A;  4PWV B;  1T8K A;  2JGP A;  2KGE A;  2EHT A;  1KLP A;  2KGA A;  4MRT C;  2K0Y A;  2KR5 A;  2LL8 A;  2XZ0 D;  2AFD A;  2MY5 A;  2KW2 A;  3NY7 B;  2FAE A;  2FQ0 A;  2VSQ A;  2L22 A;  2K2Q A;  2AVA A;  3EJE A;  2LPK A;  2X2B A;  4BPG A;  2AFE A;  2KOR A;  2FAC A;  2KOO A;  4IZ6 A;  2KGD A;  2LKI A;  5KP6 B;  4NEO A;  2K92 A;  2L9F A;  2DNW A;  3GZM A;  2CG5 B;  2FAD A;  4HKG A;  2N6Z A;  5CZD B;  2JQ4 A;  1NQ4 A;  2CQ8 A;  4BPF A;  2LIU A;  5HV8 A;  2K94 A;  1HY8 A;  2M5R A;  1AF8 A;  1DNY A;  5KP7 B;  1ACP A;  2FQ2 A;  4DG9 A;  4R0M A;  2K93 A; 
#chains in the Genus database with same CATH topology
 1EMV A;  1VKU A;  1VQ7 P;  2QA4 P;  2FHS C;  2PY8 A;  3G1G A;  2GZF A;  2JU2 A;  3CPW O;  5HGN A;  2EFJ A;  5HGO A;  2XZ1 C;  2MD9 A;  3CC7 P;  2VLQ A;  2KOD A;  2EG5 A;  2XT1 A;  1BAJ A;  1YI2 P;  1QVF O;  4F37 A;  2LML A;  1VQO P;  5EW5 E;  2DGY A;  3CCL P;  3CCU P;  2LTE A;  2K0X A;  4H2X C;  4H2W C;  4PXH B;  1E6J P;  3P05 A;  4XFZ A;  3CCV P;  2GDY A;  2KGC A;  4WYM A;  3H4E A;  2MVU A;  2QEX P;  2Z44 A;  7CEI A;  1IMQ A;  4UHP B;  2LL8 A;  2AFD A;  3G0V A;  2L22 A;  2ERH A;  2LPK A;  2X2B A;  2AFE A;  1ZNV A;  1Z6M A;  4XFY A;  2KGD A;  4NEO A;  2OAR A;  1A43 A;  3G21 A;  4HKG A;  2N6Z A;  1QVG O;  1NQ4 A;  1K8A Q;  2CQ8 A;  4BPF A;  2PEJ A;  2M5R A;  2GYK A;  1AUM A;  1VQN P;  2PEQ A;  2K93 A;  2KG6 A;  1VQ5 P;  1W2B O;  1L0H A;  1M74 A;  3RG2 A;  2N5I A;  3GJN A;  2N5H A;  3U43 A;  5KP8 B;  2K5X A;  1L0I A;  2JYL A;  2L0Q A;  2GDW A;  2M8L A;  3G4S P;  2PEN A;  2Z46 A;  4XFX A;  2FQ1 A;  2QNW A;  3EJB A;  3MGE A;  2MVV A;  4XRO A;  2CGQ A;  3OW2 O;  3DS0 A;  3M1M A;  5DCK A;  2GZI A;  1X3O A;  3CCR P;  1VQ6 P;  2M8P A;  3I55 P;  1GXH A;  3G29 A;  3HYB A;  2WPT A;  1YIJ P;  3GKL C;  1FR2 A;  2VLN A;  1UJZ A;  5BS1 A;  2EIA A;  5F2N A;  3CC2 P;  5HVC A;  5EJD A;  4PH1 A;  1T8K A;  3CMA P;  1K9M Q;  2KR5 A;  2XZ0 D;  3NY7 B;  5F2O A;  2VSQ A;  5HGL A;  2K2Q A;  4BPG A;  4U0D A;  3H0D A;  2KOR A;  3CCJ P;  2KOO A;  3RG6 C;  2LKI A;  1KD1 Q;  1YJN P;  2K92 A;  2JB0 A;  2FAD A;  2GZJ A;  3DS4 A;  1VQ9 P;  5CZD B;  4U0A A;  1Q82 Q;  2K94 A;  1Q86 Q;  1HY8 A;  1ACP A;  2XV6 A;  2PEK A;  1M6N A;  1VQL P;  2JYG A;  1RO0 A;  1D1D A;  2FVF A;  2JU1 A;  2KG9 A;  5F2K A;  3DS2 A;  2MF4 A;  3G26 A;  1Q81 Q;  5JPA A;  2Z45 A;  4QKO A;  3DS1 A;  4PH0 A;  1M1K Q;  4COC A;  1OR5 A;  2N50 A;  4BPH A;  2FVA A;  2E1M A;  2L4B A;  1VQP P;  2JBG A;  1K73 Q;  3B4Q A;  2KOS A;  3DS3 A;  3CC4 P;  1HQB A;  2LIW A;  2GZE A;  2KOP A;  2LOL A;  2N98 A;  1Q7Y Q;  2MR7 A;  1QRJ A;  2KWL A;  3DPH A;  1EOQ A;  1IUQ A;  1RO2 A;  2BHV A;  3EJD A;  3E2D A;  4H2Y C;  3CCS P;  2L6E A;  2GZG A;  4GR2 A;  2GDX A;  4PWV B;  2JGP A;  4U0B A;  2K0Y A;  1YJW P;  1M90 Q;  4IPY A;  1KQS O;  2KW2 A;  1E0H A;  2FAE A;  2FQ0 A;  4U0E A;  2AVA A;  3EJE A;  1IMP A;  3CCQ P;  4IZ6 A;  4COP A;  4QNB A;  5KP6 B;  1YJ9 P;  3CCM P;  1KC8 Q;  5HGM A;  3G6E P;  5BS2 A;  2CG5 B;  3H47 A;  3LRY A;  1AYI A;  2JQ4 A;  4U0C A;  3Q20 A;  5HV8 A;  3WBH A;  2ONT A;  1VHN A;  5KP7 B;  3G71 P;  2FQ2 A;  4R0M A;  3CME P;  2FVE A;  2KG8 A;  1YIT P;  4XRQ A;  2OTL P;  1A8O A;  2KOQ A;  3CE7 A;  2AF8 A;  1DV5 A;  3LMO A;  3NTE A;  1NJI Q;  2PEM A;  1UNK A;  3GZL A;  4GR6 A;  3HZQ A;  2JO0 A;  2CWO A;  1K30 A;  2BUO A;  1S72 P;  1VQM P;  2P9X A;  1EIA A;  1GPJ A;  1F80 D;  2CNR A;  2ROQ A;  1RNI A;  2MR8 A;  2M8N A;  2PEI A;  1BXI A;  1VQ4 P;  1VQK P;  2N6Y A;  2PNG A;  4CA3 A;  1M6E X;  2EHS A;  1MZ8 A;  3VRL C;  2VLO A;  1GXG A;  2NO8 A;  2KGE A;  2EHT A;  2LF4 A;  1KLP A;  2KGA A;  4MRT C;  2VLP A;  3G1I A;  2MY5 A;  1CEI A;  2XXM A;  3I56 P;  2JAZ A;  1YHQ P;  2OTJ P;  1ZMB A;  2FAC A;  1VQ8 P;  3G28 A;  3DTJ A;  2L9F A;  3CXC O;  2DNW A;  2K0D X;  3GZM A;  2PEO A;  3DS5 A;  3B5I A;  5I4T G;  4M0I A;  2LIU A;  3CCE P;  1JJ2 O;  1AF8 A;  1DNY A;  4DG9 A;  3CD6 P;  4U0F A;  1N8R Q; 
#chains in the Genus database with same CATH homology
 2KG6 A;  1VKU A;  1L0H A;  2FVE A;  3RG2 A;  2KG8 A;  2N5I A;  2N5H A;  5KP8 B;  2FHS C;  2FVF A;  2JU1 A;  2KG9 A;  2KOQ A;  3CE7 A;  2AF8 A;  1DV5 A;  3LMO A;  1L0I A;  2MF4 A;  2L0Q A;  2GDW A;  2JU2 A;  2FQ1 A;  2QNW A;  3EJB A;  2XZ1 C;  1OR5 A;  2MVV A;  2MD9 A;  2N50 A;  3GZL A;  2CGQ A;  4BPH A;  2FVA A;  1X3O A;  2L4B A;  2KOS A;  2LML A;  1F80 D;  1HQB A;  2CNR A;  2ROQ A;  2MR8 A;  2LIW A;  2LTE A;  2KOP A;  2LOL A;  2K0X A;  2N98 A;  4H2X C;  2MR7 A;  4H2W C;  4PXH B;  2N6Y A;  2KWL A;  2PNG A;  4CA3 A;  2EHS A;  2GDY A;  5HVC A;  3EJD A;  5EJD A;  4H2Y C;  2KGC A;  2MVU A;  2GDX A;  4PWV B;  1T8K A;  2JGP A;  2KGE A;  2EHT A;  1KLP A;  2KGA A;  4MRT C;  2K0Y A;  2KR5 A;  2LL8 A;  2XZ0 D;  2AFD A;  2MY5 A;  2KW2 A;  3NY7 B;  2FAE A;  2FQ0 A;  2VSQ A;  2L22 A;  2K2Q A;  2AVA A;  3EJE A;  2LPK A;  2X2B A;  4BPG A;  2AFE A;  2KOR A;  2FAC A;  2KOO A;  4IZ6 A;  2KGD A;  2LKI A;  5KP6 B;  4NEO A;  2K92 A;  2L9F A;  2DNW A;  3GZM A;  2CG5 B;  2FAD A;  4HKG A;  2N6Z A;  5CZD B;  2JQ4 A;  1NQ4 A;  2CQ8 A;  4BPF A;  2LIU A;  5HV8 A;  2K94 A;  1HY8 A;  2M5R A;  1AF8 A;  1DNY A;  5KP7 B;  1ACP A;  2FQ2 A;  4DG9 A;  4R0M A;  2K93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...