2KW2A

Solution nmr of the specialized acyl carrier protein (rpa2022) from rhodopseudomonas palustris, northeast structural genomics consortium target rpr324
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
101
structure length
101
Chain Sequence
MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Specialized acyl carrier protein
publication title Structure of a specialized acyl carrier protein essential for lipid A biosynthesis with very long-chain fatty acids in open and closed conformations.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Transferase
total genus 29
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2010-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kw2A00
1VKUA 4BPHA 2JQ4A 2AFEA 2XZ0D 2KGAA 2N5HA 2JGPA 1AF8A 2N5IA 2CGQA 2PNGA 2VSQA 4H2XC 2DNWA 2LIUA 2N50A 2K92A 2LTEA 2AF8A 1ACPA 2LOLA 2K93A 4BPFA 2KR5A 2KOSA 2FAEA 2LIWA 2M5RA 2XZ1C 2LMLA 2FADA 1L0IA 2LKIA 5KP8B 4BPGA 2CQ8A 2K0YA 4CA3A 2GDXA 2KG9A 2L0QA 4PWVB 2LPKA 1HQBA 2MD9A 2L4BA 2MR7A 1NQ4A 3GZMA 2QNWA 2LL8A 2FQ1A 2FVFA 2KOPA 2FVAA 1X3OA 2MR8A 4H2WC 1KLPA 2KGDA 2L9FA 2AFDA 2CG5B 2KGEA 2GDYA 2AVAA 5KP6B 2FVEA 1DNYA 2KWLA 2X2BA 2KORA 3GZLA 2JU1A 4PXHB 2KGCA 2FQ2A 2K94A 3LMOA 2FACA 2JU2A 2N98A 5HV8A 3EJBA 3EJDA 1T8KA 4HKGA 2K0XA 3CE7A 4R0MA 2KOQA 2MY5A 1HY8A 2MVVA 4MRTC 2K2QA 3EJEA 4H2YC 3NY7B 4DG9A 5CZDB 2ROQA 4IZ6A 5EJDA 2EHSA 1L0HA 2KG8A 2KW2A 1DV5A 4NEOA 1F80D 2EHTA 2KOOA 2KG6A 2GDWA 2FQ0A 2CNRA 5HVCA 1OR5A 2FHSC 2L22A 2N6YA 2MF4A 3RG2A 2MVUA 5KP7B 2N6ZA
chains in the Genus database with same CATH superfamily
3HYBA 1Q81Q 2JQ4A 4U0BA 2XZ0D 1Z6MA 2M8PA 2N5HA 3I56P 3DS1A 1IMQA 4U0FA 2PEQA 4QNBA 2JAZA 3G21A 1QVFO 4BPFA 2KR5A 2DGYA 1EMVA 1JJ2O 3G29A 3CCQP 4UHPB 4XROA 2L0QA 1YJ9P 4PWVB 2LPKA 1VQPP 2MD9A 1NQ4A 3H47A 1BAJA 2P9XA 2FVAA 3NTEA 3HZQA 1KLPA 2L9FA 2AFDA 2KGEA 2VLPA 3CMEP 3LRYA 1UJZA 2KORA 3GZLA 2PEIA 3GJNA 2JU1A 2KGCA 2K94A 2GZIA 4QKOA 2OTJP 3EJBA 3EJDA 2K0DX 1T8KA 4HKGA 2BHVA 2KODA 3DS3A 1W2BO 2K2QA 1M6EX 5CZDB 4U0AA 1D1DA 5BS2A 5DCKA 5EJDA 1K30A 2KW2A 3RG6C 7CEIA 1YI2P 5HGMA 5BS1A 2FQ0A 3P05A 3B4QA 1AYIA 4COPA 1YJWP 2AFEA 1M1KQ 3G71P 1AF8A 2XT1A 2VSQA 4H2XC 2LIUA 4GR2A 1GPJA 2N50A 1VQOP 1VQKP 1ACPA 2OTLP 2K93A 3G0VA 2LF4A 4F37A 2GZJA 1VQ9P 3CD6P 2PENA 3G4SP 1E6JP 2FADA 5KP8B 4BPGA 2M8NA 1VQMP 1RO0A 2L4BA 2MR7A 1KD1Q 3U43A 1A43A 2Z44A 5HGOA 3CXCO 2WPTA 2KOPA 2M8LA 3G1IA 3G26A 2CG5B 1VQ5P 3GKLC 2PEKA 1VQ4P 2AVAA 4U0DA 1ZMBA 4M0IA 4XFZA 5EW5E 1DNYA 2KWLA 3H0DA 2VLNA 2VLQA 2X2BA 3CC2P 3CPWO 1M74A 2OARA 4PXHB 2FQ2A 3LMOA 5F2KA 2Z45A 2JU2A 4GR6A 2ONTA 5F2OA 2VLOA 2NO8A 2MY5A 1HY8A 2MVVA 4MRTC 2GYKA 3I55P 4H2YC 3DPHA 3NY7B 2ROQA 4IZ6A 1NJIQ 1YJNP 2EHSA 1L0HA 3CCSP 1DV5A 3CCRP 1VQ6P 2KG6A 1YHQP 1Q86Q 1QRJA 2QEXP 2CNRA 1UNKA 1K8AQ 5HVCA 2JO0A 1VQ8P 2MF4A 3RG2A 1VQ7P 4BPHA 5I4TG 3DS5A 3OW2O 2PNGA 2DNWA 1MZ8A 2K92A 1RNIA 2AF8A 2LOLA 4U0EA 1KC8Q 1VQLP 3M1MA 2M5RA 2LMLA 2BUOA 2LKIA 1BXIA 3WBHA 4CA3A 2GDXA 2GZGA 2KG9A 3CCLP 2JB0A 2JBGA 1QVGO 3GZMA 2QNWA 2LL8A 1A8OA 2FQ1A 3CCJP 2FVFA 3H4EA 1X3OA 1FR2A 2MR8A 5HGNA 3E2DA 3G28A 3CCMP 2GDYA 5KP6B 2FVEA 2EIAA 1CEIA 4WYMA 4XFYA 5HV8A 2EFJA 1IMPA 4R0MA 1EIAA 2JYLA 2PY8A 3MGEA 1N8RQ 3DS0A 4U0CA 2KG8A 5HGLA 4NEOA 2E1MA 2KOOA 1OR5A 2FHSC 2ERHA 1ZNVA 5JPAA 2Z46A 1VKUA 3CC7P 2KGAA 2GZEA 2XXMA 2JGPA 2N5IA 2CGQA 1M6NA 1VHNA 2LTEA 1EOQA 1GXGA 1YITP 2LIWA 2KOSA 2FAEA 2XZ1C 3G6EP 2QA4P 2JYGA 1L0IA 3CCVP 3CC4P 2CQ8A 2K0YA 1S72P 1HQBA 3CMAP 1RO2A 4COCA 2PEOA 3Q20A 1KQSO 4H2WC 2KGDA 2PEJA 3CCEP 4PH0A 1GXHA 1K9MQ 4XFXA 1Q7YQ 2CWOA 2EG5A 3VRLC 1IUQA 4IPYA 1K73Q 3DTJA 2GZFA 2XV6A 3G1GA 3CCUP 1Q82Q 2FACA 2N98A 2K5XA 5F2NA 2K0XA 3CE7A 4XRQA 2KOQA 1E0HA 1AUMA 4PH1A 3EJEA 4DG9A 1VQNP 3DS2A 1F80D 2EHTA 2L6EA 2GDWA 3B5IA 3DS4A 1M90Q 2L22A 2PEMA 1YIJP 2N6YA 2MVUA 5KP7B 2N6ZA
chains in the Genus database with same CATH topology
1VKUA 4BPHA 2JQ4A 2AFEA 2XZ0D 2KGAA 2N5HA 2JGPA 1AF8A 2N5IA 2CGQA 2PNGA 2VSQA 4H2XC 2DNWA 2LIUA 2N50A 2K92A 2LTEA 2AF8A 1ACPA 2LOLA 2K93A 4BPFA 2KR5A 2KOSA 2FAEA 2LIWA 2M5RA 2XZ1C 2LMLA 2FADA 1L0IA 2LKIA 5KP8B 4BPGA 2CQ8A 2K0YA 4CA3A 2GDXA 2KG9A 2L0QA 4PWVB 2LPKA 1HQBA 2MD9A 2L4BA 2MR7A 1NQ4A 3GZMA 2QNWA 2LL8A 2FQ1A 2FVFA 2KOPA 2FVAA 1X3OA 2MR8A 4H2WC 1KLPA 2KGDA 2L9FA 2AFDA 2CG5B 2KGEA 2GDYA 2AVAA 5KP6B 2FVEA 1DNYA 2KWLA 2X2BA 2KORA 3GZLA 2JU1A 4PXHB 2KGCA 2FQ2A 2K94A 3LMOA 2FACA 2JU2A 2N98A 5HV8A 3EJBA 3EJDA 1T8KA 4HKGA 2K0XA 3CE7A 4R0MA 2KOQA 2MY5A 1HY8A 2MVVA 4MRTC 2K2QA 3EJEA 4H2YC 3NY7B 4DG9A 5CZDB 2ROQA 4IZ6A 5EJDA 2EHSA 1L0HA 2KG8A 2KW2A 1DV5A 4NEOA 1F80D 2EHTA 2KOOA 2KG6A 2GDWA 2FQ0A 2CNRA 5HVCA 1OR5A 2FHSC 2L22A 2N6YA 2MF4A 3RG2A 2MVUA 5KP7B 2N6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VKU A;  4BPH A;  2JQ4 A;  2AFE A;  2XZ0 D;  2KGA A;  2N5H A;  2JGP A;  1AF8 A;  2N5I A;  2CGQ A;  2PNG A;  2VSQ A;  4H2X C;  2DNW A;  2LIU A;  2N50 A;  2K92 A;  2LTE A;  2AF8 A;  1ACP A;  2LOL A;  2K93 A;  4BPF A;  2KR5 A;  2KOS A;  2FAE A;  2LIW A;  2M5R A;  2XZ1 C;  2LML A;  2FAD A;  1L0I A;  2LKI A;  5KP8 B;  4BPG A;  2CQ8 A;  2K0Y A;  4CA3 A;  2GDX A;  2KG9 A;  2L0Q A;  4PWV B;  2LPK A;  1HQB A;  2MD9 A;  2L4B A;  2MR7 A;  1NQ4 A;  3GZM A;  2QNW A;  2LL8 A;  2FQ1 A;  2FVF A;  2KOP A;  2FVA A;  1X3O A;  2MR8 A;  4H2W C;  1KLP A;  2KGD A;  2L9F A;  2AFD A;  2CG5 B;  2KGE A;  2GDY A;  2AVA A;  5KP6 B;  2FVE A;  1DNY A;  2KWL A;  2X2B A;  2KOR A;  3GZL A;  2JU1 A;  4PXH B;  2KGC A;  2FQ2 A;  2K94 A;  3LMO A;  2FAC A;  2JU2 A;  2N98 A;  5HV8 A;  3EJB A;  3EJD A;  1T8K A;  4HKG A;  2K0X A;  3CE7 A;  4R0M A;  2KOQ A;  2MY5 A;  1HY8 A;  2MVV A;  4MRT C;  2K2Q A;  3EJE A;  4H2Y C;  3NY7 B;  4DG9 A;  5CZD B;  2ROQ A;  4IZ6 A;  5EJD A;  2EHS A;  1L0H A;  2KG8 A;  2KW2 A;  1DV5 A;  4NEO A;  1F80 D;  2EHT A;  2KOO A;  2KG6 A;  2GDW A;  2FQ0 A;  2CNR A;  5HVC A;  1OR5 A;  2FHS C;  2L22 A;  2N6Y A;  2MF4 A;  3RG2 A;  2MVU A;  5KP7 B;  2N6Z A; 
#chains in the Genus database with same CATH topology
 3HYB A;  1Q81 Q;  2JQ4 A;  4U0B A;  2XZ0 D;  1Z6M A;  2M8P A;  2N5H A;  3I56 P;  3DS1 A;  1IMQ A;  4U0F A;  2PEQ A;  4QNB A;  2JAZ A;  3G21 A;  1QVF O;  4BPF A;  2KR5 A;  2DGY A;  1EMV A;  1JJ2 O;  3G29 A;  3CCQ P;  4UHP B;  4XRO A;  2L0Q A;  1YJ9 P;  4PWV B;  2LPK A;  1VQP P;  2MD9 A;  1NQ4 A;  3H47 A;  1BAJ A;  2P9X A;  2FVA A;  3NTE A;  3HZQ A;  1KLP A;  2L9F A;  2AFD A;  2KGE A;  2VLP A;  3CME P;  3LRY A;  1UJZ A;  2KOR A;  3GZL A;  2PEI A;  3GJN A;  2JU1 A;  2KGC A;  2K94 A;  2GZI A;  4QKO A;  2OTJ P;  3EJB A;  3EJD A;  2K0D X;  1T8K A;  4HKG A;  2BHV A;  2KOD A;  3DS3 A;  1W2B O;  2K2Q A;  1M6E X;  5CZD B;  4U0A A;  1D1D A;  5BS2 A;  5DCK A;  5EJD A;  1K30 A;  2KW2 A;  3RG6 C;  7CEI A;  1YI2 P;  5HGM A;  5BS1 A;  2FQ0 A;  3P05 A;  3B4Q A;  1AYI A;  4COP A;  1YJW P;  2AFE A;  1M1K Q;  3G71 P;  1AF8 A;  2XT1 A;  2VSQ A;  4H2X C;  2LIU A;  4GR2 A;  1GPJ A;  2N50 A;  1VQO P;  1VQK P;  1ACP A;  2OTL P;  2K93 A;  3G0V A;  2LF4 A;  4F37 A;  2GZJ A;  1VQ9 P;  3CD6 P;  2PEN A;  3G4S P;  1E6J P;  2FAD A;  5KP8 B;  4BPG A;  2M8N A;  1VQM P;  1RO0 A;  2L4B A;  2MR7 A;  1KD1 Q;  3U43 A;  1A43 A;  2Z44 A;  5HGO A;  3CXC O;  2WPT A;  2KOP A;  2M8L A;  3G1I A;  3G26 A;  2CG5 B;  1VQ5 P;  3GKL C;  2PEK A;  1VQ4 P;  2AVA A;  4U0D A;  1ZMB A;  4M0I A;  4XFZ A;  5EW5 E;  1DNY A;  2KWL A;  3H0D A;  2VLN A;  2VLQ A;  2X2B A;  3CC2 P;  3CPW O;  1M74 A;  2OAR A;  4PXH B;  2FQ2 A;  3LMO A;  5F2K A;  2Z45 A;  2JU2 A;  4GR6 A;  2ONT A;  5F2O A;  2VLO A;  2NO8 A;  2MY5 A;  1HY8 A;  2MVV A;  4MRT C;  2GYK A;  3I55 P;  4H2Y C;  3DPH A;  3NY7 B;  2ROQ A;  4IZ6 A;  1NJI Q;  1YJN P;  2EHS A;  1L0H A;  3CCS P;  1DV5 A;  3CCR P;  1VQ6 P;  2KG6 A;  1YHQ P;  1Q86 Q;  1QRJ A;  2QEX P;  2CNR A;  1UNK A;  1K8A Q;  5HVC A;  2JO0 A;  1VQ8 P;  2MF4 A;  3RG2 A;  1VQ7 P;  4BPH A;  5I4T G;  3DS5 A;  3OW2 O;  2PNG A;  2DNW A;  1MZ8 A;  2K92 A;  1RNI A;  2AF8 A;  2LOL A;  4U0E A;  1KC8 Q;  1VQL P;  3M1M A;  2M5R A;  2LML A;  2BUO A;  2LKI A;  1BXI A;  3WBH A;  4CA3 A;  2GDX A;  2GZG A;  2KG9 A;  3CCL P;  2JB0 A;  2JBG A;  1QVG O;  3GZM A;  2QNW A;  2LL8 A;  1A8O A;  2FQ1 A;  3CCJ P;  2FVF A;  3H4E A;  1X3O A;  1FR2 A;  2MR8 A;  5HGN A;  3E2D A;  3G28 A;  3CCM P;  2GDY A;  5KP6 B;  2FVE A;  2EIA A;  1CEI A;  4WYM A;  4XFY A;  5HV8 A;  2EFJ A;  1IMP A;  4R0M A;  1EIA A;  2JYL A;  2PY8 A;  3MGE A;  1N8R Q;  3DS0 A;  4U0C A;  2KG8 A;  5HGL A;  4NEO A;  2E1M A;  2KOO A;  1OR5 A;  2FHS C;  2ERH A;  1ZNV A;  5JPA A;  2Z46 A;  1VKU A;  3CC7 P;  2KGA A;  2GZE A;  2XXM A;  2JGP A;  2N5I A;  2CGQ A;  1M6N A;  1VHN A;  2LTE A;  1EOQ A;  1GXG A;  1YIT P;  2LIW A;  2KOS A;  2FAE A;  2XZ1 C;  3G6E P;  2QA4 P;  2JYG A;  1L0I A;  3CCV P;  3CC4 P;  2CQ8 A;  2K0Y A;  1S72 P;  1HQB A;  3CMA P;  1RO2 A;  4COC A;  2PEO A;  3Q20 A;  1KQS O;  4H2W C;  2KGD A;  2PEJ A;  3CCE P;  4PH0 A;  1GXH A;  1K9M Q;  4XFX A;  1Q7Y Q;  2CWO A;  2EG5 A;  3VRL C;  1IUQ A;  4IPY A;  1K73 Q;  3DTJ A;  2GZF A;  2XV6 A;  3G1G A;  3CCU P;  1Q82 Q;  2FAC A;  2N98 A;  2K5X A;  5F2N A;  2K0X A;  3CE7 A;  4XRQ A;  2KOQ A;  1E0H A;  1AUM A;  4PH1 A;  3EJE A;  4DG9 A;  1VQN P;  3DS2 A;  1F80 D;  2EHT A;  2L6E A;  2GDW A;  3B5I A;  3DS4 A;  1M90 Q;  2L22 A;  2PEM A;  1YIJ P;  2N6Y A;  2MVU A;  5KP7 B;  2N6Z A; 
#chains in the Genus database with same CATH homology
 1VKU A;  4BPH A;  2JQ4 A;  2AFE A;  2XZ0 D;  2KGA A;  2N5H A;  2JGP A;  1AF8 A;  2N5I A;  2CGQ A;  2PNG A;  2VSQ A;  4H2X C;  2DNW A;  2LIU A;  2N50 A;  2K92 A;  2LTE A;  2AF8 A;  1ACP A;  2LOL A;  2K93 A;  4BPF A;  2KR5 A;  2KOS A;  2FAE A;  2LIW A;  2M5R A;  2XZ1 C;  2LML A;  2FAD A;  1L0I A;  2LKI A;  5KP8 B;  4BPG A;  2CQ8 A;  2K0Y A;  4CA3 A;  2GDX A;  2KG9 A;  2L0Q A;  4PWV B;  2LPK A;  1HQB A;  2MD9 A;  2L4B A;  2MR7 A;  1NQ4 A;  3GZM A;  2QNW A;  2LL8 A;  2FQ1 A;  2FVF A;  2KOP A;  2FVA A;  1X3O A;  2MR8 A;  4H2W C;  1KLP A;  2KGD A;  2L9F A;  2AFD A;  2CG5 B;  2KGE A;  2GDY A;  2AVA A;  5KP6 B;  2FVE A;  1DNY A;  2KWL A;  2X2B A;  2KOR A;  3GZL A;  2JU1 A;  4PXH B;  2KGC A;  2FQ2 A;  2K94 A;  3LMO A;  2FAC A;  2JU2 A;  2N98 A;  5HV8 A;  3EJB A;  3EJD A;  1T8K A;  4HKG A;  2K0X A;  3CE7 A;  4R0M A;  2KOQ A;  2MY5 A;  1HY8 A;  2MVV A;  4MRT C;  2K2Q A;  3EJE A;  4H2Y C;  3NY7 B;  4DG9 A;  5CZD B;  2ROQ A;  4IZ6 A;  5EJD A;  2EHS A;  1L0H A;  2KG8 A;  2KW2 A;  1DV5 A;  4NEO A;  1F80 D;  2EHT A;  2KOO A;  2KG6 A;  2GDW A;  2FQ0 A;  2CNR A;  5HVC A;  1OR5 A;  2FHS C;  2L22 A;  2N6Y A;  2MF4 A;  3RG2 A;  2MVU A;  5KP7 B;  2N6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...