2KW2A

Solution nmr of the specialized acyl carrier protein (rpa2022) from rhodopseudomonas palustris, northeast structural genomics consortium target rpr324
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
101
structure length
101
Chain Sequence
MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a specialized acyl carrier protein essential for lipid A biosynthesis with very long-chain fatty acids in open and closed conformations.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Transferase
molecule keywords Specialized acyl carrier protein
total genus 29
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2010-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kw2A00
2N98A 2DNWA 1X3OA 2MVVA 2LL8A 2GDYA 2JGPA 2KOSA 1L0HA 2PNGA 5KP8B 2L9FA 2LIUA 2K0YA 2FVEA 4PXHB 2KR5A 3LMOA 2KG8A 2LIWA 2MR7A 2KG9A 2CNRA 2JU1A 2CQ8A 1L0IA 4BPFA 2KGAA 2CGQA 2XZ1C 2K93A 4DG9A 5HVCA 2GDWA 4H2YC 2CG5B 1AF8A 1T8KA 5KP7B 2JU2A 1DV5A 1OR5A 2FADA 2QNWA 4BPHA 2N5HA 3EJBA 2KWLA 2LOLA 1HY8A 2KG6A 2FAEA 2MF4A 2MVUA 4H2XC 2AVAA 4IZ6A 3RG2A 2EHTA 2KOQA 3EJEA 4HKGA 1ACPA 2KOPA 2L4BA 2KORA 2JQ4A 2K2QA 1VKUA 2FQ0A 2KGCA 4NEOA 2FHSC 4CA3A 3GZMA 4MRTC 2FVAA 2LKIA 2AFDA 1HQBA 2N5IA 2AF8A 2FQ2A 2L0QA 2KOOA 4BPGA 1NQ4A 1KLPA 2EHSA 2MY5A 2KGEA 1DNYA 2MD9A 3NY7B 2KW2A 2L22A 4R0MA 2N6YA 5KP6B 2GDXA 2FVFA 2K92A 2ROQA 2M5RA 4H2WC 5EJDA 2AFEA 2K94A 2KGDA 2X2BA 2VSQA 2LMLA 2LPKA 2N6ZA 2N50A 1F80D 5CZDB 3EJDA 2LTEA 2XZ0D 5HV8A 2MR8A 2FQ1A 2FACA 3CE7A 2K0XA 4PWVB 3GZLA
chains in the Genus database with same CATH superfamily
2DNWA 3H47A 1L0HA 2PEOA 2GZEA 5KP8B 1K9MQ 2K0YA 1YJNP 1VQ6P 3DS1A 3G4SP 2KG8A 2Z44A 2KG9A 1W2BO 2OARA 4BPFA 1VQ9P 2KGAA 2XZ1C 1YJ9P 2JBGA 2VLOA 1AF8A 5KP7B 4F37A 3DTJA 1M6EX 5BS2A 1IUQA 1M74A 1YI2P 2KG6A 1MZ8A 4H2XC 2AVAA 2EHTA 4HKGA 1KC8Q 1M6NA 2KODA 5F2KA 5HGOA 4COCA 1VQMP 5EW5E 1ACPA 2M8PA 2JQ4A 2K2QA 1VKUA 1CEIA 2FQ0A 4MRTC 1D1DA 1E6JP 2LKIA 3G71P 1IMQA 2AFDA 1EMVA 2AF8A 3I55P 2KOOA 4BPGA 1NQ4A 2XT1A 2KGEA 1BXIA 1Q86Q 1Q81Q 2VLQA 4R0MA 2ROQA 2K92A 4H2WC 4M0IA 2M8NA 2X2BA 1IMPA 2N50A 3EJDA 3RG6C 5JPAA 3CCRP 2XV6A 2MR8A 4XFZA 3OW2O 4PWVB 3DS3A 2N98A 4QNBA 4XFXA 2JGPA 3DS4A 4U0DA 2L9FA 1BAJA 2FVEA 3DPHA 2LF4A 1VHNA 4PH0A 5HVCA 4DG9A 2GDWA 3CCJP 2CG5B 3CMAP 1T8KA 2GYKA 2JB0A 2GZGA 2N5HA 2OTLP 1K73Q 1VQLP 2FAEA 2MF4A 2BHVA 2XXMA 2P9XA 3Q20A 4U0AA 1NJIQ 1M1KQ 3GKLC 1A8OA 2PENA 2PEKA 2PEIA 3P05A 3CCUP 2Z46A 3B5IA 1VQNP 4GR2A 3HZQA 1YHQP 1VQ8P 3NTEA 2WPTA 3U43A 2K5XA 5HGMA 1ZMBA 2MD9A 3CCVP 2KW2A 2ONTA 5KP6B 2FVFA 1JJ2O 2M5RA 4U0BA 5EJDA 1YIJP 1EIAA 2LMLA 5CZDB 2JO0A 3G1GA 1Q7YQ 2FQ1A 3CE7A 2K0XA 3GZLA 5F2NA 1K8AQ 3WBHA 1X3OA 4QKOA 2PEJA 1GXGA 2GDYA 4PH1A 4XFYA 2PNGA 2LIUA 3CCSP 1VQ4P 2KR5A 2LIWA 2MR7A 3HYBA 3CXCO 4GR6A 1VQOP 3G0VA 1L0IA 2BUOA 2EG5A 1QVGO 4XROA 2OTJP 2JU2A 1QRJA 2FADA 3CC4P 1HY8A 4WYMA 2PY8A 2ERHA 3EJEA 2E1MA 1M90Q 1RO2A 2KOPA 2L4BA 5I4TG 1AYIA 2KGCA 4NEOA 2FHSC 1KQSO 4CA3A 3GZMA 1AUMA 1ZNVA 1GPJA 2FVAA 3G29A 4COPA 2L0QA 3CD6P 3CC7P 3CCMP 3NY7B 2PEQA 3M1MA 1VQ5P 2GDXA 3E2DA 4UHPB 4U0CA 3MGEA 5F2OA 1UNKA 2Z45A 4U0FA 2AFEA 2VSQA 3VRLC 2N6ZA 1KD1Q 1F80D 1E0HA 5HV8A 2FACA 1GXHA 3LRYA 2MVVA 2LL8A 1N8RQ 2KOSA 2NO8A 2GZIA 2JYGA 5HGNA 3H4EA 1VQKP 4PXHB 1UJZA 3LMOA 2CNRA 2EFJA 2JU1A 3CPWO 2CQ8A 2CGQA 2CWOA 3CCEP 2QA4P 2K93A 4H2YC 4XRQA 3DS2A 3G28A 1DV5A 2PEMA 1OR5A 2DGYA 2GZFA 3H0DA 2QNWA 4BPHA 3EJBA 2KWLA 1RO0A 2LOLA 1Z6MA 5HGLA 2JAZA 2MVUA 4IZ6A 3RG2A 3G21A 3DS0A 2KOQA 3G26A 1EOQA 3CMEP 3G1IA 4U0EA 2JYLA 3G6EP 5DCKA 2K0DX 2KORA 3B4QA 1YITP 3DS5A 1A43A 2GZJA 3CC2P 7CEIA 2QEXP 1HQBA 1QVFO 2N5IA 1Q82Q 2FQ2A 1VQPP 2M8LA 1K30A 1KLPA 2EHSA 2MY5A 2EIAA 1DNYA 3CCLP 2L22A 1FR2A 1VQ7P 2N6YA 2VLPA 3CCQP 2K94A 2KGDA 5BS1A 4IPYA 2LPKA 1S72P 2L6EA 2LTEA 2XZ0D 1RNIA 2VLNA 3GJNA 1YJWP 3I56P
chains in the Genus database with same CATH topology
2N98A 2DNWA 1X3OA 2MVVA 2LL8A 2GDYA 2JGPA 2KOSA 1L0HA 2PNGA 5KP8B 2L9FA 2LIUA 2K0YA 2FVEA 4PXHB 2KR5A 3LMOA 2KG8A 2LIWA 2MR7A 2KG9A 2CNRA 2JU1A 2CQ8A 1L0IA 4BPFA 2KGAA 2CGQA 2XZ1C 2K93A 4DG9A 5HVCA 2GDWA 4H2YC 2CG5B 1AF8A 1T8KA 5KP7B 2JU2A 1DV5A 1OR5A 2FADA 2QNWA 4BPHA 2N5HA 3EJBA 2KWLA 2LOLA 1HY8A 2KG6A 2FAEA 2MF4A 2MVUA 4H2XC 2AVAA 4IZ6A 3RG2A 2EHTA 2KOQA 3EJEA 4HKGA 1ACPA 2KOPA 2L4BA 2KORA 2JQ4A 2K2QA 1VKUA 2FQ0A 2KGCA 4NEOA 2FHSC 4CA3A 3GZMA 4MRTC 2FVAA 2LKIA 2AFDA 1HQBA 2N5IA 2AF8A 2FQ2A 2L0QA 2KOOA 4BPGA 1NQ4A 1KLPA 2EHSA 2MY5A 2KGEA 1DNYA 2MD9A 3NY7B 2KW2A 2L22A 4R0MA 2N6YA 5KP6B 2GDXA 2FVFA 2K92A 2ROQA 2M5RA 4H2WC 5EJDA 2AFEA 2K94A 2KGDA 2X2BA 2VSQA 2LMLA 2LPKA 2N6ZA 2N50A 1F80D 5CZDB 3EJDA 2LTEA 2XZ0D 5HV8A 2MR8A 2FQ1A 2FACA 3CE7A 2K0XA 4PWVB 3GZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N98 A;  2DNW A;  1X3O A;  2MVV A;  2LL8 A;  2GDY A;  2JGP A;  2KOS A;  1L0H A;  2PNG A;  5KP8 B;  2L9F A;  2LIU A;  2K0Y A;  2FVE A;  4PXH B;  2KR5 A;  3LMO A;  2KG8 A;  2LIW A;  2MR7 A;  2KG9 A;  2CNR A;  2JU1 A;  2CQ8 A;  1L0I A;  4BPF A;  2KGA A;  2CGQ A;  2XZ1 C;  2K93 A;  4DG9 A;  5HVC A;  2GDW A;  4H2Y C;  2CG5 B;  1AF8 A;  1T8K A;  5KP7 B;  2JU2 A;  1DV5 A;  1OR5 A;  2FAD A;  2QNW A;  4BPH A;  2N5H A;  3EJB A;  2KWL A;  2LOL A;  1HY8 A;  2KG6 A;  2FAE A;  2MF4 A;  2MVU A;  4H2X C;  2AVA A;  4IZ6 A;  3RG2 A;  2EHT A;  2KOQ A;  3EJE A;  4HKG A;  1ACP A;  2KOP A;  2L4B A;  2KOR A;  2JQ4 A;  2K2Q A;  1VKU A;  2FQ0 A;  2KGC A;  4NEO A;  2FHS C;  4CA3 A;  3GZM A;  4MRT C;  2FVA A;  2LKI A;  2AFD A;  1HQB A;  2N5I A;  2AF8 A;  2FQ2 A;  2L0Q A;  2KOO A;  4BPG A;  1NQ4 A;  1KLP A;  2EHS A;  2MY5 A;  2KGE A;  1DNY A;  2MD9 A;  3NY7 B;  2KW2 A;  2L22 A;  4R0M A;  2N6Y A;  5KP6 B;  2GDX A;  2FVF A;  2K92 A;  2ROQ A;  2M5R A;  4H2W C;  5EJD A;  2AFE A;  2K94 A;  2KGD A;  2X2B A;  2VSQ A;  2LML A;  2LPK A;  2N6Z A;  2N50 A;  1F80 D;  5CZD B;  3EJD A;  2LTE A;  2XZ0 D;  5HV8 A;  2MR8 A;  2FQ1 A;  2FAC A;  3CE7 A;  2K0X A;  4PWV B;  3GZL A; 
#chains in the Genus database with same CATH topology
 2DNW A;  3H47 A;  1L0H A;  2PEO A;  2GZE A;  5KP8 B;  1K9M Q;  2K0Y A;  1YJN P;  1VQ6 P;  3DS1 A;  3G4S P;  2KG8 A;  2Z44 A;  2KG9 A;  1W2B O;  2OAR A;  4BPF A;  1VQ9 P;  2KGA A;  2XZ1 C;  1YJ9 P;  2JBG A;  2VLO A;  1AF8 A;  5KP7 B;  4F37 A;  3DTJ A;  1M6E X;  5BS2 A;  1IUQ A;  1M74 A;  1YI2 P;  2KG6 A;  1MZ8 A;  4H2X C;  2AVA A;  2EHT A;  4HKG A;  1KC8 Q;  1M6N A;  2KOD A;  5F2K A;  5HGO A;  4COC A;  1VQM P;  5EW5 E;  1ACP A;  2M8P A;  2JQ4 A;  2K2Q A;  1VKU A;  1CEI A;  2FQ0 A;  4MRT C;  1D1D A;  1E6J P;  2LKI A;  3G71 P;  1IMQ A;  2AFD A;  1EMV A;  2AF8 A;  3I55 P;  2KOO A;  4BPG A;  1NQ4 A;  2XT1 A;  2KGE A;  1BXI A;  1Q86 Q;  1Q81 Q;  2VLQ A;  4R0M A;  2ROQ A;  2K92 A;  4H2W C;  4M0I A;  2M8N A;  2X2B A;  1IMP A;  2N50 A;  3EJD A;  3RG6 C;  5JPA A;  3CCR P;  2XV6 A;  2MR8 A;  4XFZ A;  3OW2 O;  4PWV B;  3DS3 A;  2N98 A;  4QNB A;  4XFX A;  2JGP A;  3DS4 A;  4U0D A;  2L9F A;  1BAJ A;  2FVE A;  3DPH A;  2LF4 A;  1VHN A;  4PH0 A;  5HVC A;  4DG9 A;  2GDW A;  3CCJ P;  2CG5 B;  3CMA P;  1T8K A;  2GYK A;  2JB0 A;  2GZG A;  2N5H A;  2OTL P;  1K73 Q;  1VQL P;  2FAE A;  2MF4 A;  2BHV A;  2XXM A;  2P9X A;  3Q20 A;  4U0A A;  1NJI Q;  1M1K Q;  3GKL C;  1A8O A;  2PEN A;  2PEK A;  2PEI A;  3P05 A;  3CCU P;  2Z46 A;  3B5I A;  1VQN P;  4GR2 A;  3HZQ A;  1YHQ P;  1VQ8 P;  3NTE A;  2WPT A;  3U43 A;  2K5X A;  5HGM A;  1ZMB A;  2MD9 A;  3CCV P;  2KW2 A;  2ONT A;  5KP6 B;  2FVF A;  1JJ2 O;  2M5R A;  4U0B A;  5EJD A;  1YIJ P;  1EIA A;  2LML A;  5CZD B;  2JO0 A;  3G1G A;  1Q7Y Q;  2FQ1 A;  3CE7 A;  2K0X A;  3GZL A;  5F2N A;  1K8A Q;  3WBH A;  1X3O A;  4QKO A;  2PEJ A;  1GXG A;  2GDY A;  4PH1 A;  4XFY A;  2PNG A;  2LIU A;  3CCS P;  1VQ4 P;  2KR5 A;  2LIW A;  2MR7 A;  3HYB A;  3CXC O;  4GR6 A;  1VQO P;  3G0V A;  1L0I A;  2BUO A;  2EG5 A;  1QVG O;  4XRO A;  2OTJ P;  2JU2 A;  1QRJ A;  2FAD A;  3CC4 P;  1HY8 A;  4WYM A;  2PY8 A;  2ERH A;  3EJE A;  2E1M A;  1M90 Q;  1RO2 A;  2KOP A;  2L4B A;  5I4T G;  1AYI A;  2KGC A;  4NEO A;  2FHS C;  1KQS O;  4CA3 A;  3GZM A;  1AUM A;  1ZNV A;  1GPJ A;  2FVA A;  3G29 A;  4COP A;  2L0Q A;  3CD6 P;  3CC7 P;  3CCM P;  3NY7 B;  2PEQ A;  3M1M A;  1VQ5 P;  2GDX A;  3E2D A;  4UHP B;  4U0C A;  3MGE A;  5F2O A;  1UNK A;  2Z45 A;  4U0F A;  2AFE A;  2VSQ A;  3VRL C;  2N6Z A;  1KD1 Q;  1F80 D;  1E0H A;  5HV8 A;  2FAC A;  1GXH A;  3LRY A;  2MVV A;  2LL8 A;  1N8R Q;  2KOS A;  2NO8 A;  2GZI A;  2JYG A;  5HGN A;  3H4E A;  1VQK P;  4PXH B;  1UJZ A;  3LMO A;  2CNR A;  2EFJ A;  2JU1 A;  3CPW O;  2CQ8 A;  2CGQ A;  2CWO A;  3CCE P;  2QA4 P;  2K93 A;  4H2Y C;  4XRQ A;  3DS2 A;  3G28 A;  1DV5 A;  2PEM A;  1OR5 A;  2DGY A;  2GZF A;  3H0D A;  2QNW A;  4BPH A;  3EJB A;  2KWL A;  1RO0 A;  2LOL A;  1Z6M A;  5HGL A;  2JAZ A;  2MVU A;  4IZ6 A;  3RG2 A;  3G21 A;  3DS0 A;  2KOQ A;  3G26 A;  1EOQ A;  3CME P;  3G1I A;  4U0E A;  2JYL A;  3G6E P;  5DCK A;  2K0D X;  2KOR A;  3B4Q A;  1YIT P;  3DS5 A;  1A43 A;  2GZJ A;  3CC2 P;  7CEI A;  2QEX P;  1HQB A;  1QVF O;  2N5I A;  1Q82 Q;  2FQ2 A;  1VQP P;  2M8L A;  1K30 A;  1KLP A;  2EHS A;  2MY5 A;  2EIA A;  1DNY A;  3CCL P;  2L22 A;  1FR2 A;  1VQ7 P;  2N6Y A;  2VLP A;  3CCQ P;  2K94 A;  2KGD A;  5BS1 A;  4IPY A;  2LPK A;  1S72 P;  2L6E A;  2LTE A;  2XZ0 D;  1RNI A;  2VLN A;  3GJN A;  1YJW P;  3I56 P; 
#chains in the Genus database with same CATH homology
 2N98 A;  2DNW A;  1X3O A;  2MVV A;  2LL8 A;  2GDY A;  2JGP A;  2KOS A;  1L0H A;  2PNG A;  5KP8 B;  2L9F A;  2LIU A;  2K0Y A;  2FVE A;  4PXH B;  2KR5 A;  3LMO A;  2KG8 A;  2LIW A;  2MR7 A;  2KG9 A;  2CNR A;  2JU1 A;  2CQ8 A;  1L0I A;  4BPF A;  2KGA A;  2CGQ A;  2XZ1 C;  2K93 A;  4DG9 A;  5HVC A;  2GDW A;  4H2Y C;  2CG5 B;  1AF8 A;  1T8K A;  5KP7 B;  2JU2 A;  1DV5 A;  1OR5 A;  2FAD A;  2QNW A;  4BPH A;  2N5H A;  3EJB A;  2KWL A;  2LOL A;  1HY8 A;  2KG6 A;  2FAE A;  2MF4 A;  2MVU A;  4H2X C;  2AVA A;  4IZ6 A;  3RG2 A;  2EHT A;  2KOQ A;  3EJE A;  4HKG A;  1ACP A;  2KOP A;  2L4B A;  2KOR A;  2JQ4 A;  2K2Q A;  1VKU A;  2FQ0 A;  2KGC A;  4NEO A;  2FHS C;  4CA3 A;  3GZM A;  4MRT C;  2FVA A;  2LKI A;  2AFD A;  1HQB A;  2N5I A;  2AF8 A;  2FQ2 A;  2L0Q A;  2KOO A;  4BPG A;  1NQ4 A;  1KLP A;  2EHS A;  2MY5 A;  2KGE A;  1DNY A;  2MD9 A;  3NY7 B;  2KW2 A;  2L22 A;  4R0M A;  2N6Y A;  5KP6 B;  2GDX A;  2FVF A;  2K92 A;  2ROQ A;  2M5R A;  4H2W C;  5EJD A;  2AFE A;  2K94 A;  2KGD A;  2X2B A;  2VSQ A;  2LML A;  2LPK A;  2N6Z A;  2N50 A;  1F80 D;  5CZD B;  3EJD A;  2LTE A;  2XZ0 D;  5HV8 A;  2MR8 A;  2FQ1 A;  2FAC A;  3CE7 A;  2K0X A;  4PWV B;  3GZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...