2KW2A

Solution nmr of the specialized acyl carrier protein (rpa2022) from rhodopseudomonas palustris, northeast structural genomics consortium target rpr324
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
101
structure length
101
Chain Sequence
MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Specialized acyl carrier protein
publication title Structure of a specialized acyl carrier protein essential for lipid A biosynthesis with very long-chain fatty acids in open and closed conformations.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
total genus 29
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2010-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kw2A00
2FVFA 2N5HA 4R0MA 2FVAA 2GDXA 4HKGA 2FADA 1ACPA 2MVVA 3CE7A 2N6YA 2LTEA 2N6ZA 2FQ1A 3RG2A 2JU2A 4NEOA 2FAEA 5CZDB 2LIUA 2LKIA 2MY5A 2L22A 5EJDA 4BPGA 2DNWA 2LIWA 2VSQA 1L0HA 4CA3A 2KOSA 2KOPA 2CG5B 1KLPA 2K0XA 2MR7A 2KOOA 2JQ4A 3EJBA 1OR5A 2K2QA 2FACA 2MVUA 2PNGA 2K0YA 2K92A 2N98A 4H2YC 2FHSC 2KG9A 3EJDA 2FVEA 2XZ1C 3LMOA 2ROQA 2KGCA 2QNWA 2CNRA 2KW2A 4BPHA 2K94A 5KP6B 2MR8A 2KORA 1AF8A 2L9FA 4H2WC 2AF8A 2XZ0D 5HVCA 2AFDA 2LOLA 3NY7B 2KGEA 2N5IA 2M5RA 3GZMA 2KG8A 2K93A 2AFEA 5KP7B 2MF4A 4IZ6A 2FQ0A 3EJEA 4PXHB 2AVAA 2KGAA 2EHSA 2JGPA 1F80D 4MRTC 2N50A 2KGDA 5HV8A 1DV5A 4DG9A 2FQ2A 2KG6A 2CQ8A 1NQ4A 1X3OA 5KP8B 2EHTA 1HY8A 2L4BA 4BPFA 1VKUA 2GDYA 3GZLA 4H2XC 1DNYA 2GDWA 2KR5A 1T8KA 2JU1A 2KOQA 2X2BA 2MD9A 2KWLA 4PWVB 2LL8A 1HQBA 2LMLA 2CGQA 2L0QA 2LPKA 1L0IA
chains in the Genus database with same CATH superfamily
2GZIA 2GZEA 2GDXA 2M8LA 1GXGA 2GZGA 1M90Q 3M1MA 1YI2P 3LRYA 1VQNP 2JU2A 3CD6P 2L22A 5EJDA 4BPGA 2BHVA 3G21A 4QKOA 1MZ8A 2K5XA 2EIAA 3G71P 2JQ4A 1IUQA 5JPAA 3I56P 1M6EX 3G6EP 2PY8A 1K30A 3MGEA 4UHPB 1QVGO 4XFXA 2CNRA 2E1MA 3P05A 4BPHA 1YJNP 2KORA 2AF8A 5HVCA 2LOLA 2KGEA 3U43A 2JYGA 3GZMA 1Z6MA 4IZ6A 1M6NA 2DGYA 2AVAA 2KGAA 3B5IA 4GR6A 1RO0A 1F80D 3DTJA 3I55P 2KGDA 1DV5A 3CCVP 1BAJA 1VQ9P 1GPJA 2FQ2A 2CQ8A 1NQ4A 5KP8B 1YITP 1HY8A 2PEKA 2GDYA 3DS0A 3HYBA 1D1DA 2GDWA 1VHNA 2X2BA 2KWLA 2LL8A 2CGQA 2LPKA 2KODA 3CCUP 1GXHA 2Z44A 1EIAA 2JO0A 3CE7A 2LTEA 3RG2A 4U0DA 5EW5E 3G1IA 2LKIA 3G4SP 3CMAP 4QNBA 1L0HA 2OARA 2KOSA 2L6EA 5F2OA 2CG5B 1KLPA 1JJ2O 2MR7A 2JB0A 1BXIA 4XRQA 3CCQP 1OR5A 3G1GA 2PEMA 5HGOA 2GZJA 2VLOA 4COCA 4PH1A 1Q7YQ 3CXCO 1K73Q 2FVEA 2ROQA 3DS5A 3G0VA 2ERHA 2JBGA 1YJWP 3CMEP 2WPTA 1AF8A 2L9FA 4H2WC 2AFDA 2KG8A 2FQ0A 2EHSA 2JGPA 2Z45A 3E2DA 1RNIA 2M8PA 5HGLA 2XV6A 4U0BA 3H0DA 5HGNA 4GR2A 2PEJA 2OTJP 1X3OA 2K0DX 2L4BA 4BPFA 4H2XC 2KR5A 2JU1A 2GYKA 2L0QA 3G29A 5I4TG 1L0IA 2FVFA 4R0MA 2FVAA 3G28A 1Q86Q 1ACPA 2MVVA 2VLPA 2VLQA 2N6YA 2XXMA 2FQ1A 1UNKA 4NEOA 3DS2A 5CZDB 2LIUA 3G26A 1A8OA 1IMPA 3H47A 2VSQA 3CCMP 1E0HA 2JAZA 1M74A 2K0XA 1AYIA 1M1KQ 2K0YA 3RG6C 4H2YC 1UJZA 1VQOP 4U0AA 1KD1Q 2XZ1C 1FR2A 1VQ4P 4XFYA 1EMVA 4U0CA 1VQLP 1NJIQ 2KW2A 2EG5A 5HGMA 2PENA 1ZNVA 4COPA 1Q81Q 2MR8A 3CC2P 3GJNA 3NY7B 2N5IA 2M5RA 2AFEA 5KP7B 1K9MQ 1VQ7P 2XT1A 4MRTC 2N50A 5F2KA 1ZMBA 2P9XA 2EFJA 3VRLC 4DG9A 1E6JP 3WBHA 3GZLA 1DNYA 3DS4A 1Q82Q 5BS1A 4F37A 2KOQA 5F2NA 1AUMA 3DS1A 1YJ9P 4XROA 2CWOA 2VLNA 2JYLA 2GZFA 2N5HA 4HKGA 2FADA 2ONTA 1EOQA 3CCJP 2N6ZA 2FAEA 2MY5A 3B4QA 1QVFO 2DNWA 4IPYA 2LIWA 1K8AQ 1VQ8P 4CA3A 2KOPA 2KOOA 3EJBA 2LF4A 2K2QA 2FACA 2MVUA 2PNGA 2K92A 2N98A 2FHSC 3H4EA 2KG9A 3EJDA 2PEIA 1KQSO 2NO8A 2QA4P 3LMOA 2KGCA 2QNWA 1QRJA 2BUOA 2PEQA 3CCSP 2K94A 1VQ5P 5KP6B 1VQPP 2OTLP 1YIJP 4PH0A 1A43A 3NTEA 2XZ0D 7CEIA 2K93A 1IMQA 4M0IA 3HZQA 2MF4A 3EJEA 3OW2O 1VQ6P 4PXHB 2M8NA 2Z46A 3DPHA 4WYMA 3CPWO 1RO2A 3CCRP 5HV8A 3CC7P 1KC8Q 5BS2A 2KG6A 4XFZA 2QEXP 2EHTA 3CCEP 3DS3A 3CC4P 1VKUA 1VQKP 1T8KA 3Q20A 3CCLP 2MD9A 4U0EA 5DCKA 1CEIA 4PWVB 3GKLC 1S72P 1HQBA 1N8RQ 1VQMP 2PEOA 2LMLA 1W2BO 1YHQP 4U0FA
chains in the Genus database with same CATH topology
2FVFA 2N5HA 4R0MA 2FVAA 2GDXA 4HKGA 2FADA 1ACPA 2MVVA 3CE7A 2N6YA 2LTEA 2N6ZA 2FQ1A 3RG2A 2JU2A 4NEOA 2FAEA 5CZDB 2LIUA 2LKIA 2MY5A 2L22A 5EJDA 4BPGA 2DNWA 2LIWA 2VSQA 1L0HA 4CA3A 2KOSA 2KOPA 2CG5B 1KLPA 2K0XA 2MR7A 2KOOA 2JQ4A 3EJBA 1OR5A 2K2QA 2FACA 2MVUA 2PNGA 2K0YA 2K92A 2N98A 4H2YC 2FHSC 2KG9A 3EJDA 2FVEA 2XZ1C 3LMOA 2ROQA 2KGCA 2QNWA 2CNRA 2KW2A 4BPHA 2K94A 5KP6B 2MR8A 2KORA 1AF8A 2L9FA 4H2WC 2AF8A 2XZ0D 5HVCA 2AFDA 2LOLA 3NY7B 2KGEA 2N5IA 2M5RA 3GZMA 2KG8A 2K93A 2AFEA 5KP7B 2MF4A 4IZ6A 2FQ0A 3EJEA 4PXHB 2AVAA 2KGAA 2EHSA 2JGPA 1F80D 4MRTC 2N50A 2KGDA 5HV8A 1DV5A 4DG9A 2FQ2A 2KG6A 2CQ8A 1NQ4A 1X3OA 5KP8B 2EHTA 1HY8A 2L4BA 4BPFA 1VKUA 2GDYA 3GZLA 4H2XC 1DNYA 2GDWA 2KR5A 1T8KA 2JU1A 2KOQA 2X2BA 2MD9A 2KWLA 4PWVB 2LL8A 1HQBA 2LMLA 2CGQA 2L0QA 2LPKA 1L0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FVF A;  2N5H A;  4R0M A;  2FVA A;  2GDX A;  4HKG A;  2FAD A;  1ACP A;  2MVV A;  3CE7 A;  2N6Y A;  2LTE A;  2N6Z A;  2FQ1 A;  3RG2 A;  2JU2 A;  4NEO A;  2FAE A;  5CZD B;  2LIU A;  2LKI A;  2MY5 A;  2L22 A;  5EJD A;  4BPG A;  2DNW A;  2LIW A;  2VSQ A;  1L0H A;  4CA3 A;  2KOS A;  2KOP A;  2CG5 B;  1KLP A;  2K0X A;  2MR7 A;  2KOO A;  2JQ4 A;  3EJB A;  1OR5 A;  2K2Q A;  2FAC A;  2MVU A;  2PNG A;  2K0Y A;  2K92 A;  2N98 A;  4H2Y C;  2FHS C;  2KG9 A;  3EJD A;  2FVE A;  2XZ1 C;  3LMO A;  2ROQ A;  2KGC A;  2QNW A;  2CNR A;  2KW2 A;  4BPH A;  2K94 A;  5KP6 B;  2MR8 A;  2KOR A;  1AF8 A;  2L9F A;  4H2W C;  2AF8 A;  2XZ0 D;  5HVC A;  2AFD A;  2LOL A;  3NY7 B;  2KGE A;  2N5I A;  2M5R A;  3GZM A;  2KG8 A;  2K93 A;  2AFE A;  5KP7 B;  2MF4 A;  4IZ6 A;  2FQ0 A;  3EJE A;  4PXH B;  2AVA A;  2KGA A;  2EHS A;  2JGP A;  1F80 D;  4MRT C;  2N50 A;  2KGD A;  5HV8 A;  1DV5 A;  4DG9 A;  2FQ2 A;  2KG6 A;  2CQ8 A;  1NQ4 A;  1X3O A;  5KP8 B;  2EHT A;  1HY8 A;  2L4B A;  4BPF A;  1VKU A;  2GDY A;  3GZL A;  4H2X C;  1DNY A;  2GDW A;  2KR5 A;  1T8K A;  2JU1 A;  2KOQ A;  2X2B A;  2MD9 A;  2KWL A;  4PWV B;  2LL8 A;  1HQB A;  2LML A;  2CGQ A;  2L0Q A;  2LPK A;  1L0I A; 
#chains in the Genus database with same CATH topology
 2GZI A;  2GZE A;  2GDX A;  2M8L A;  1GXG A;  2GZG A;  1M90 Q;  3M1M A;  1YI2 P;  3LRY A;  1VQN P;  2JU2 A;  3CD6 P;  2L22 A;  5EJD A;  4BPG A;  2BHV A;  3G21 A;  4QKO A;  1MZ8 A;  2K5X A;  2EIA A;  3G71 P;  2JQ4 A;  1IUQ A;  5JPA A;  3I56 P;  1M6E X;  3G6E P;  2PY8 A;  1K30 A;  3MGE A;  4UHP B;  1QVG O;  4XFX A;  2CNR A;  2E1M A;  3P05 A;  4BPH A;  1YJN P;  2KOR A;  2AF8 A;  5HVC A;  2LOL A;  2KGE A;  3U43 A;  2JYG A;  3GZM A;  1Z6M A;  4IZ6 A;  1M6N A;  2DGY A;  2AVA A;  2KGA A;  3B5I A;  4GR6 A;  1RO0 A;  1F80 D;  3DTJ A;  3I55 P;  2KGD A;  1DV5 A;  3CCV P;  1BAJ A;  1VQ9 P;  1GPJ A;  2FQ2 A;  2CQ8 A;  1NQ4 A;  5KP8 B;  1YIT P;  1HY8 A;  2PEK A;  2GDY A;  3DS0 A;  3HYB A;  1D1D A;  2GDW A;  1VHN A;  2X2B A;  2KWL A;  2LL8 A;  2CGQ A;  2LPK A;  2KOD A;  3CCU P;  1GXH A;  2Z44 A;  1EIA A;  2JO0 A;  3CE7 A;  2LTE A;  3RG2 A;  4U0D A;  5EW5 E;  3G1I A;  2LKI A;  3G4S P;  3CMA P;  4QNB A;  1L0H A;  2OAR A;  2KOS A;  2L6E A;  5F2O A;  2CG5 B;  1KLP A;  1JJ2 O;  2MR7 A;  2JB0 A;  1BXI A;  4XRQ A;  3CCQ P;  1OR5 A;  3G1G A;  2PEM A;  5HGO A;  2GZJ A;  2VLO A;  4COC A;  4PH1 A;  1Q7Y Q;  3CXC O;  1K73 Q;  2FVE A;  2ROQ A;  3DS5 A;  3G0V A;  2ERH A;  2JBG A;  1YJW P;  3CME P;  2WPT A;  1AF8 A;  2L9F A;  4H2W C;  2AFD A;  2KG8 A;  2FQ0 A;  2EHS A;  2JGP A;  2Z45 A;  3E2D A;  1RNI A;  2M8P A;  5HGL A;  2XV6 A;  4U0B A;  3H0D A;  5HGN A;  4GR2 A;  2PEJ A;  2OTJ P;  1X3O A;  2K0D X;  2L4B A;  4BPF A;  4H2X C;  2KR5 A;  2JU1 A;  2GYK A;  2L0Q A;  3G29 A;  5I4T G;  1L0I A;  2FVF A;  4R0M A;  2FVA A;  3G28 A;  1Q86 Q;  1ACP A;  2MVV A;  2VLP A;  2VLQ A;  2N6Y A;  2XXM A;  2FQ1 A;  1UNK A;  4NEO A;  3DS2 A;  5CZD B;  2LIU A;  3G26 A;  1A8O A;  1IMP A;  3H47 A;  2VSQ A;  3CCM P;  1E0H A;  2JAZ A;  1M74 A;  2K0X A;  1AYI A;  1M1K Q;  2K0Y A;  3RG6 C;  4H2Y C;  1UJZ A;  1VQO P;  4U0A A;  1KD1 Q;  2XZ1 C;  1FR2 A;  1VQ4 P;  4XFY A;  1EMV A;  4U0C A;  1VQL P;  1NJI Q;  2KW2 A;  2EG5 A;  5HGM A;  2PEN A;  1ZNV A;  4COP A;  1Q81 Q;  2MR8 A;  3CC2 P;  3GJN A;  3NY7 B;  2N5I A;  2M5R A;  2AFE A;  5KP7 B;  1K9M Q;  1VQ7 P;  2XT1 A;  4MRT C;  2N50 A;  5F2K A;  1ZMB A;  2P9X A;  2EFJ A;  3VRL C;  4DG9 A;  1E6J P;  3WBH A;  3GZL A;  1DNY A;  3DS4 A;  1Q82 Q;  5BS1 A;  4F37 A;  2KOQ A;  5F2N A;  1AUM A;  3DS1 A;  1YJ9 P;  4XRO A;  2CWO A;  2VLN A;  2JYL A;  2GZF A;  2N5H A;  4HKG A;  2FAD A;  2ONT A;  1EOQ A;  3CCJ P;  2N6Z A;  2FAE A;  2MY5 A;  3B4Q A;  1QVF O;  2DNW A;  4IPY A;  2LIW A;  1K8A Q;  1VQ8 P;  4CA3 A;  2KOP A;  2KOO A;  3EJB A;  2LF4 A;  2K2Q A;  2FAC A;  2MVU A;  2PNG A;  2K92 A;  2N98 A;  2FHS C;  3H4E A;  2KG9 A;  3EJD A;  2PEI A;  1KQS O;  2NO8 A;  2QA4 P;  3LMO A;  2KGC A;  2QNW A;  1QRJ A;  2BUO A;  2PEQ A;  3CCS P;  2K94 A;  1VQ5 P;  5KP6 B;  1VQP P;  2OTL P;  1YIJ P;  4PH0 A;  1A43 A;  3NTE A;  2XZ0 D;  7CEI A;  2K93 A;  1IMQ A;  4M0I A;  3HZQ A;  2MF4 A;  3EJE A;  3OW2 O;  1VQ6 P;  4PXH B;  2M8N A;  2Z46 A;  3DPH A;  4WYM A;  3CPW O;  1RO2 A;  3CCR P;  5HV8 A;  3CC7 P;  1KC8 Q;  5BS2 A;  2KG6 A;  4XFZ A;  2QEX P;  2EHT A;  3CCE P;  3DS3 A;  3CC4 P;  1VKU A;  1VQK P;  1T8K A;  3Q20 A;  3CCL P;  2MD9 A;  4U0E A;  5DCK A;  1CEI A;  4PWV B;  3GKL C;  1S72 P;  1HQB A;  1N8R Q;  1VQM P;  2PEO A;  2LML A;  1W2B O;  1YHQ P;  4U0F A; 
#chains in the Genus database with same CATH homology
 2FVF A;  2N5H A;  4R0M A;  2FVA A;  2GDX A;  4HKG A;  2FAD A;  1ACP A;  2MVV A;  3CE7 A;  2N6Y A;  2LTE A;  2N6Z A;  2FQ1 A;  3RG2 A;  2JU2 A;  4NEO A;  2FAE A;  5CZD B;  2LIU A;  2LKI A;  2MY5 A;  2L22 A;  5EJD A;  4BPG A;  2DNW A;  2LIW A;  2VSQ A;  1L0H A;  4CA3 A;  2KOS A;  2KOP A;  2CG5 B;  1KLP A;  2K0X A;  2MR7 A;  2KOO A;  2JQ4 A;  3EJB A;  1OR5 A;  2K2Q A;  2FAC A;  2MVU A;  2PNG A;  2K0Y A;  2K92 A;  2N98 A;  4H2Y C;  2FHS C;  2KG9 A;  3EJD A;  2FVE A;  2XZ1 C;  3LMO A;  2ROQ A;  2KGC A;  2QNW A;  2CNR A;  2KW2 A;  4BPH A;  2K94 A;  5KP6 B;  2MR8 A;  2KOR A;  1AF8 A;  2L9F A;  4H2W C;  2AF8 A;  2XZ0 D;  5HVC A;  2AFD A;  2LOL A;  3NY7 B;  2KGE A;  2N5I A;  2M5R A;  3GZM A;  2KG8 A;  2K93 A;  2AFE A;  5KP7 B;  2MF4 A;  4IZ6 A;  2FQ0 A;  3EJE A;  4PXH B;  2AVA A;  2KGA A;  2EHS A;  2JGP A;  1F80 D;  4MRT C;  2N50 A;  2KGD A;  5HV8 A;  1DV5 A;  4DG9 A;  2FQ2 A;  2KG6 A;  2CQ8 A;  1NQ4 A;  1X3O A;  5KP8 B;  2EHT A;  1HY8 A;  2L4B A;  4BPF A;  1VKU A;  2GDY A;  3GZL A;  4H2X C;  1DNY A;  2GDW A;  2KR5 A;  1T8K A;  2JU1 A;  2KOQ A;  2X2B A;  2MD9 A;  2KWL A;  4PWV B;  2LL8 A;  1HQB A;  2LML A;  2CGQ A;  2L0Q A;  2LPK A;  1L0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...