2KW2A

Solution nmr of the specialized acyl carrier protein (rpa2022) from rhodopseudomonas palustris, northeast structural genomics consortium target rpr324
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
101
structure length
101
Chain Sequence
MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a specialized acyl carrier protein essential for lipid A biosynthesis with very long-chain fatty acids in open and closed conformations.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Transferase
molecule keywords Specialized acyl carrier protein
total genus 29
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2010-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kw2A00
2KOSA 2CG5B 2LL8A 2L9FA 5KP7B 1VKUA 4HKGA 1HY8A 2L0QA 5HV8A 2JGPA 2KOPA 2FQ1A 4CA3A 2K2QA 2GDWA 2LTEA 2CQ8A 2MD9A 2N5IA 3GZMA 1DNYA 3LMOA 2N6ZA 2KG6A 2N98A 1AF8A 1NQ4A 2MVVA 2XZ1C 3CE7A 2FVFA 1ACPA 1T8KA 2CGQA 2LKIA 2X2BA 2QNWA 2KG9A 2KR5A 2JQ4A 2CNRA 2KGAA 5KP8B 2JU1A 1OR5A 4R0MA 2K93A 4IZ6A 2EHTA 2LOLA 3EJBA 1F80D 4H2XC 2AVAA 2K0YA 3RG2A 2EHSA 2KGCA 2XZ0D 2LIUA 2N50A 2MR7A 2N5HA 2AFDA 3GZLA 3NY7B 2AFEA 2N6YA 4PWVB 2PNGA 2KOOA 2K0XA 1L0HA 2FHSC 2GDYA 1HQBA 2K92A 2KORA 2ROQA 4H2YC 2VSQA 2MY5A 4NEOA 2KWLA 2LIWA 5CZDB 1X3OA 4BPGA 2FQ0A 3EJEA 5EJDA 2MR8A 2LMLA 2FACA 2MVUA 2GDXA 2FVEA 2FQ2A 2FAEA 5KP6B 2KG8A 2M5RA 2KOQA 1KLPA 2KGEA 1DV5A 2FADA 5HVCA 2L22A 2AF8A 4BPHA 2KGDA 1L0IA 2KW2A 2JU2A 2K94A 4MRTC 4DG9A 4PXHB 2LPKA 4H2WC 4BPFA 2L4BA 3EJDA 2MF4A 2FVAA 2DNWA
chains in the Genus database with same CATH superfamily
2M8PA 1VKUA 1GXGA 2EFJA 5F2KA 2L0QA 1K73Q 2ONTA 1RO2A 1Q82Q 3G4SP 2JYLA 1E0HA 3P05A 3E2DA 2K2QA 2GDWA 1E6JP 2GYKA 2JO0A 1DNYA 1RO0A 1EIAA 1VQ6P 1QVFO 1NQ4A 3CE7A 4QNBA 2FVFA 1T8KA 2CGQA 3MGEA 4U0BA 2PEJA 2CNRA 1Q86Q 2LOLA 1JJ2O 1F80D 2KGCA 4UHPB 2E1MA 4GR6A 2PY8A 3GZLA 3NY7B 1AYIA 1VQ9P 2K0XA 3CMEP 2K92A 4H2YC 1VQMP 4NEOA 3DS0A 1YIJP 3HYBA 1K9MQ 3CCQP 1KC8Q 2MR8A 2Z45A 1KLPA 2KGEA 1NJIQ 3M1MA 3LRYA 1A43A 3CCMP 2JU2A 7CEIA 3I56P 2JB0A 1D1DA 2LPKA 3G21A 3HZQA 4GR2A 3EJDA 2MF4A 2FVAA 3CPWO 3GKLC 3CD6P 1AUMA 2KOSA 2QA4P 2LL8A 3G1GA 4XFZA 2L9FA 1M74A 3CC4P 1HY8A 5HV8A 2JGPA 4U0EA 3DS5A 1IMPA 1IUQA 4XRQA 2CQ8A 2OARA 3B5IA 1FR2A 5EW5E 2KODA 2PEMA 3LMOA 2N6ZA 2KG6A 1ZMBA 1AF8A 2XZ1C 2BUOA 1ACPA 2XT1A 2LKIA 2QNWA 1M90Q 2JQ4A 2M8LA 4WYMA 3DS4A 4XFXA 3RG2A 2EHSA 4F37A 2N50A 2MR7A 2N5HA 3NTEA 1K30A 2AFDA 4COPA 5DCKA 2CWOA 3VRLC 2PEIA 2ROQA 1YJNP 1UNKA 3CCLP 1IMQA 2FQ0A 3EJEA 3H4EA 5EJDA 5HGLA 3G29A 1CEIA 2PEQA 2OTLP 2GDXA 2JAZA 5KP6B 2GZIA 1EOQA 3CCUP 2M5RA 2KOQA 3GJNA 2OTJP 1DV5A 3CCVP 2PEOA 1Q7YQ 2DGYA 2KW2A 1KQSO 2K94A 1YJ9P 4U0CA 4MRTC 1MZ8A 4BPFA 2DNWA 5HGOA 3Q20A 1QVGO 4QKOA 4HKGA 3CMAP 2FQ1A 3CXCO 2GZJA 2LTEA 2MD9A 1BAJA 1EMVA 3DS1A 3GZMA 2M8NA 5HGMA 2ERHA 1M1KQ 3CCJP 2QEXP 2KGAA 2JU1A 1OR5A 3EJBA 1K8AQ 2BHVA 4H2XC 3RG6C 4U0AA 2LIUA 1YHQP 1Q81Q 2PEKA 1BXIA 2AFEA 2N6YA 3B4QA 5JPAA 3CCEP 2VLOA 2Z46A 1HQBA 2EIAA 5F2OA 2VSQA 1VQ5P 1M6EX 1M6NA 2KWLA 2LIWA 5CZDB 2NO8A 3H0DA 3OW2O 1VQKP 2LMLA 2FACA 2MVUA 3CCRP 2P9XA 1A8OA 1YJWP 1N8RQ 2WPTA 1GPJA 2FADA 4BPHA 5BS2A 5I4TG 1ZNVA 3G0VA 1L0IA 3G26A 1KD1Q 2LF4A 2VLPA 3G6EP 3DS3A 1VQPP 4IPYA 2JYGA 4XROA 3WBHA 3G71P 2GZFA 2EG5A 2CG5B 1VQOP 5KP7B 5F2NA 2XV6A 2XXMA 2KOPA 2K0DX 1VQLP 4CA3A 1Z6MA 1VQ4P 3DPHA 1UJZA 1VQ8P 2N5IA 3I55P 2N98A 2MVVA 4COCA 3U43A 2GZEA 3CC2P 2X2BA 3DS2A 2KG9A 2KR5A 5KP8B 2GZGA 4PH0A 4R0MA 3G1IA 2K93A 4IZ6A 2EHTA 2JBGA 2AVAA 2K0YA 2L6EA 3CCSP 2XZ0D 5BS1A 5HGNA 2VLQA 4PWVB 2PNGA 1YI2P 2KOOA 1S72P 1L0HA 2FHSC 2GDYA 2KORA 2K5XA 2MY5A 1VQ7P 4U0FA 2PENA 3H47A 1X3OA 4PH1A 4BPGA 1W2BO 3G28A 2FVEA 2VLNA 2FAEA 2FQ2A 3CC7P 3DTJA 2KG8A 1QRJA 5HVCA 2L22A 4XFYA 1YITP 2AF8A 1VQNP 1GXHA 2KGDA 4DG9A 4PXHB 4H2WC 2Z44A 1VHNA 2L4BA 4U0DA 1RNIA 4M0IA
chains in the Genus database with same CATH topology
2KOSA 2CG5B 2LL8A 2L9FA 5KP7B 1VKUA 4HKGA 1HY8A 2L0QA 5HV8A 2JGPA 2KOPA 2FQ1A 4CA3A 2K2QA 2GDWA 2LTEA 2CQ8A 2MD9A 2N5IA 3GZMA 1DNYA 3LMOA 2N6ZA 2KG6A 2N98A 1AF8A 1NQ4A 2MVVA 2XZ1C 3CE7A 2FVFA 1ACPA 1T8KA 2CGQA 2LKIA 2X2BA 2QNWA 2KG9A 2KR5A 2JQ4A 2CNRA 2KGAA 5KP8B 2JU1A 1OR5A 4R0MA 2K93A 4IZ6A 2EHTA 2LOLA 3EJBA 1F80D 4H2XC 2AVAA 2K0YA 3RG2A 2EHSA 2KGCA 2XZ0D 2LIUA 2N50A 2MR7A 2N5HA 2AFDA 3GZLA 3NY7B 2AFEA 2N6YA 4PWVB 2PNGA 2KOOA 2K0XA 1L0HA 2FHSC 2GDYA 1HQBA 2K92A 2KORA 2ROQA 4H2YC 2VSQA 2MY5A 4NEOA 2KWLA 2LIWA 5CZDB 1X3OA 4BPGA 2FQ0A 3EJEA 5EJDA 2MR8A 2LMLA 2FACA 2MVUA 2GDXA 2FVEA 2FQ2A 2FAEA 5KP6B 2KG8A 2M5RA 2KOQA 1KLPA 2KGEA 1DV5A 2FADA 5HVCA 2L22A 2AF8A 4BPHA 2KGDA 1L0IA 2KW2A 2JU2A 2K94A 4MRTC 4DG9A 4PXHB 2LPKA 4H2WC 4BPFA 2L4BA 3EJDA 2MF4A 2FVAA 2DNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOS A;  2CG5 B;  2LL8 A;  2L9F A;  5KP7 B;  1VKU A;  4HKG A;  1HY8 A;  2L0Q A;  5HV8 A;  2JGP A;  2KOP A;  2FQ1 A;  4CA3 A;  2K2Q A;  2GDW A;  2LTE A;  2CQ8 A;  2MD9 A;  2N5I A;  3GZM A;  1DNY A;  3LMO A;  2N6Z A;  2KG6 A;  2N98 A;  1AF8 A;  1NQ4 A;  2MVV A;  2XZ1 C;  3CE7 A;  2FVF A;  1ACP A;  1T8K A;  2CGQ A;  2LKI A;  2X2B A;  2QNW A;  2KG9 A;  2KR5 A;  2JQ4 A;  2CNR A;  2KGA A;  5KP8 B;  2JU1 A;  1OR5 A;  4R0M A;  2K93 A;  4IZ6 A;  2EHT A;  2LOL A;  3EJB A;  1F80 D;  4H2X C;  2AVA A;  2K0Y A;  3RG2 A;  2EHS A;  2KGC A;  2XZ0 D;  2LIU A;  2N50 A;  2MR7 A;  2N5H A;  2AFD A;  3GZL A;  3NY7 B;  2AFE A;  2N6Y A;  4PWV B;  2PNG A;  2KOO A;  2K0X A;  1L0H A;  2FHS C;  2GDY A;  1HQB A;  2K92 A;  2KOR A;  2ROQ A;  4H2Y C;  2VSQ A;  2MY5 A;  4NEO A;  2KWL A;  2LIW A;  5CZD B;  1X3O A;  4BPG A;  2FQ0 A;  3EJE A;  5EJD A;  2MR8 A;  2LML A;  2FAC A;  2MVU A;  2GDX A;  2FVE A;  2FQ2 A;  2FAE A;  5KP6 B;  2KG8 A;  2M5R A;  2KOQ A;  1KLP A;  2KGE A;  1DV5 A;  2FAD A;  5HVC A;  2L22 A;  2AF8 A;  4BPH A;  2KGD A;  1L0I A;  2KW2 A;  2JU2 A;  2K94 A;  4MRT C;  4DG9 A;  4PXH B;  2LPK A;  4H2W C;  4BPF A;  2L4B A;  3EJD A;  2MF4 A;  2FVA A;  2DNW A; 
#chains in the Genus database with same CATH topology
 2M8P A;  1VKU A;  1GXG A;  2EFJ A;  5F2K A;  2L0Q A;  1K73 Q;  2ONT A;  1RO2 A;  1Q82 Q;  3G4S P;  2JYL A;  1E0H A;  3P05 A;  3E2D A;  2K2Q A;  2GDW A;  1E6J P;  2GYK A;  2JO0 A;  1DNY A;  1RO0 A;  1EIA A;  1VQ6 P;  1QVF O;  1NQ4 A;  3CE7 A;  4QNB A;  2FVF A;  1T8K A;  2CGQ A;  3MGE A;  4U0B A;  2PEJ A;  2CNR A;  1Q86 Q;  2LOL A;  1JJ2 O;  1F80 D;  2KGC A;  4UHP B;  2E1M A;  4GR6 A;  2PY8 A;  3GZL A;  3NY7 B;  1AYI A;  1VQ9 P;  2K0X A;  3CME P;  2K92 A;  4H2Y C;  1VQM P;  4NEO A;  3DS0 A;  1YIJ P;  3HYB A;  1K9M Q;  3CCQ P;  1KC8 Q;  2MR8 A;  2Z45 A;  1KLP A;  2KGE A;  1NJI Q;  3M1M A;  3LRY A;  1A43 A;  3CCM P;  2JU2 A;  7CEI A;  3I56 P;  2JB0 A;  1D1D A;  2LPK A;  3G21 A;  3HZQ A;  4GR2 A;  3EJD A;  2MF4 A;  2FVA A;  3CPW O;  3GKL C;  3CD6 P;  1AUM A;  2KOS A;  2QA4 P;  2LL8 A;  3G1G A;  4XFZ A;  2L9F A;  1M74 A;  3CC4 P;  1HY8 A;  5HV8 A;  2JGP A;  4U0E A;  3DS5 A;  1IMP A;  1IUQ A;  4XRQ A;  2CQ8 A;  2OAR A;  3B5I A;  1FR2 A;  5EW5 E;  2KOD A;  2PEM A;  3LMO A;  2N6Z A;  2KG6 A;  1ZMB A;  1AF8 A;  2XZ1 C;  2BUO A;  1ACP A;  2XT1 A;  2LKI A;  2QNW A;  1M90 Q;  2JQ4 A;  2M8L A;  4WYM A;  3DS4 A;  4XFX A;  3RG2 A;  2EHS A;  4F37 A;  2N50 A;  2MR7 A;  2N5H A;  3NTE A;  1K30 A;  2AFD A;  4COP A;  5DCK A;  2CWO A;  3VRL C;  2PEI A;  2ROQ A;  1YJN P;  1UNK A;  3CCL P;  1IMQ A;  2FQ0 A;  3EJE A;  3H4E A;  5EJD A;  5HGL A;  3G29 A;  1CEI A;  2PEQ A;  2OTL P;  2GDX A;  2JAZ A;  5KP6 B;  2GZI A;  1EOQ A;  3CCU P;  2M5R A;  2KOQ A;  3GJN A;  2OTJ P;  1DV5 A;  3CCV P;  2PEO A;  1Q7Y Q;  2DGY A;  2KW2 A;  1KQS O;  2K94 A;  1YJ9 P;  4U0C A;  4MRT C;  1MZ8 A;  4BPF A;  2DNW A;  5HGO A;  3Q20 A;  1QVG O;  4QKO A;  4HKG A;  3CMA P;  2FQ1 A;  3CXC O;  2GZJ A;  2LTE A;  2MD9 A;  1BAJ A;  1EMV A;  3DS1 A;  3GZM A;  2M8N A;  5HGM A;  2ERH A;  1M1K Q;  3CCJ P;  2QEX P;  2KGA A;  2JU1 A;  1OR5 A;  3EJB A;  1K8A Q;  2BHV A;  4H2X C;  3RG6 C;  4U0A A;  2LIU A;  1YHQ P;  1Q81 Q;  2PEK A;  1BXI A;  2AFE A;  2N6Y A;  3B4Q A;  5JPA A;  3CCE P;  2VLO A;  2Z46 A;  1HQB A;  2EIA A;  5F2O A;  2VSQ A;  1VQ5 P;  1M6E X;  1M6N A;  2KWL A;  2LIW A;  5CZD B;  2NO8 A;  3H0D A;  3OW2 O;  1VQK P;  2LML A;  2FAC A;  2MVU A;  3CCR P;  2P9X A;  1A8O A;  1YJW P;  1N8R Q;  2WPT A;  1GPJ A;  2FAD A;  4BPH A;  5BS2 A;  5I4T G;  1ZNV A;  3G0V A;  1L0I A;  3G26 A;  1KD1 Q;  2LF4 A;  2VLP A;  3G6E P;  3DS3 A;  1VQP P;  4IPY A;  2JYG A;  4XRO A;  3WBH A;  3G71 P;  2GZF A;  2EG5 A;  2CG5 B;  1VQO P;  5KP7 B;  5F2N A;  2XV6 A;  2XXM A;  2KOP A;  2K0D X;  1VQL P;  4CA3 A;  1Z6M A;  1VQ4 P;  3DPH A;  1UJZ A;  1VQ8 P;  2N5I A;  3I55 P;  2N98 A;  2MVV A;  4COC A;  3U43 A;  2GZE A;  3CC2 P;  2X2B A;  3DS2 A;  2KG9 A;  2KR5 A;  5KP8 B;  2GZG A;  4PH0 A;  4R0M A;  3G1I A;  2K93 A;  4IZ6 A;  2EHT A;  2JBG A;  2AVA A;  2K0Y A;  2L6E A;  3CCS P;  2XZ0 D;  5BS1 A;  5HGN A;  2VLQ A;  4PWV B;  2PNG A;  1YI2 P;  2KOO A;  1S72 P;  1L0H A;  2FHS C;  2GDY A;  2KOR A;  2K5X A;  2MY5 A;  1VQ7 P;  4U0F A;  2PEN A;  3H47 A;  1X3O A;  4PH1 A;  4BPG A;  1W2B O;  3G28 A;  2FVE A;  2VLN A;  2FAE A;  2FQ2 A;  3CC7 P;  3DTJ A;  2KG8 A;  1QRJ A;  5HVC A;  2L22 A;  4XFY A;  1YIT P;  2AF8 A;  1VQN P;  1GXH A;  2KGD A;  4DG9 A;  4PXH B;  4H2W C;  2Z44 A;  1VHN A;  2L4B A;  4U0D A;  1RNI A;  4M0I A; 
#chains in the Genus database with same CATH homology
 2KOS A;  2CG5 B;  2LL8 A;  2L9F A;  5KP7 B;  1VKU A;  4HKG A;  1HY8 A;  2L0Q A;  5HV8 A;  2JGP A;  2KOP A;  2FQ1 A;  4CA3 A;  2K2Q A;  2GDW A;  2LTE A;  2CQ8 A;  2MD9 A;  2N5I A;  3GZM A;  1DNY A;  3LMO A;  2N6Z A;  2KG6 A;  2N98 A;  1AF8 A;  1NQ4 A;  2MVV A;  2XZ1 C;  3CE7 A;  2FVF A;  1ACP A;  1T8K A;  2CGQ A;  2LKI A;  2X2B A;  2QNW A;  2KG9 A;  2KR5 A;  2JQ4 A;  2CNR A;  2KGA A;  5KP8 B;  2JU1 A;  1OR5 A;  4R0M A;  2K93 A;  4IZ6 A;  2EHT A;  2LOL A;  3EJB A;  1F80 D;  4H2X C;  2AVA A;  2K0Y A;  3RG2 A;  2EHS A;  2KGC A;  2XZ0 D;  2LIU A;  2N50 A;  2MR7 A;  2N5H A;  2AFD A;  3GZL A;  3NY7 B;  2AFE A;  2N6Y A;  4PWV B;  2PNG A;  2KOO A;  2K0X A;  1L0H A;  2FHS C;  2GDY A;  1HQB A;  2K92 A;  2KOR A;  2ROQ A;  4H2Y C;  2VSQ A;  2MY5 A;  4NEO A;  2KWL A;  2LIW A;  5CZD B;  1X3O A;  4BPG A;  2FQ0 A;  3EJE A;  5EJD A;  2MR8 A;  2LML A;  2FAC A;  2MVU A;  2GDX A;  2FVE A;  2FQ2 A;  2FAE A;  5KP6 B;  2KG8 A;  2M5R A;  2KOQ A;  1KLP A;  2KGE A;  1DV5 A;  2FAD A;  5HVC A;  2L22 A;  2AF8 A;  4BPH A;  2KGD A;  1L0I A;  2KW2 A;  2JU2 A;  2K94 A;  4MRT C;  4DG9 A;  4PXH B;  2LPK A;  4H2W C;  4BPF A;  2L4B A;  3EJD A;  2MF4 A;  2FVA A;  2DNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...