3CMEP

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cmeP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cmeP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cmeP02
1YJ9P 1YHQP 1VQKP 1VQLP 3G71P 1YITP 3CC2P 3CC4P 1Q86Q 1VQ6P 3G4SP 1Q81Q 1VQ7P 1VQ5P 1VQOP 1K8AQ 1QVGO 3CCUP 1Q82Q 1KQSO 3CD6P 3CCLP 3CXCO 3CMAP 2QEXP 1YJWP 1K9MQ 2OTJP 3CPWO 3CC7P 1KD1Q 3OW2O 3I56P 1N8RQ 3G6EP 3CCSP 1YIJP 1W2BO 1NJIQ 3CCEP 1QVFO 3I55P 3CCJP 1YI2P 1YJNP 1Q7YQ 3CCVP 2OTLP 2QA4P 3CMEP 1VQ4P 3CCRP 1VQMP 3CCQP 1VQ9P 1VQPP 1KC8Q 1M90Q 1M1KQ 1VQ8P 1VQNP 1JJ2O 1S72P 3CCMP 1K73Q
chains in the Genus database with same CATH superfamily
2XZ1C 1NTKG 2M5AB 1USEA 3KPEA 4WY4A 1HQBA 3RG2A 3DPHA 2XU6A 2RMZA 3EJEA 1GMJA 1GK4A 5TISH 1HVVA 4OGQC 2XNXA 4WY4D 4QKOA 1SP4A 1X3OA 3FXEA 1NAFA 1NTZJ 1RF0A 1JM0A 3LIEA 2KOOA 5TJHA 4U3FD 1IUQA 1RO0A 2FYNC 3EFGA 1L2PA 4BWNA 1YITP 3PTZA 2ZYAA 1G2CB 1T3JA 1URQC 5AW0B 2K37A 4GODA 1KD1Q 4AQRD 4ZMDA 3M0AA 3V5BA 2WWWA 3VMYA 2CWOA 2QA4P 4COCA 2N9YB 2W83C 2Y0EA 1L0LK 4BPGA 3L73J 3M9BA 5L8RJ 2N1TA 2E1MA 4PJ0H 2O01J 1Z56A 1HBWA 1LTAC 1LP1B 2R5BA 2N1TD 2P2UA 5AVWB 2JYGA 3A7OA 1L4AB 1NU1D 2N6ZA 1SFCD 2GZJA 1BCCG 2M8RA 2FY8A 1PP9D 3H1JJ 2Z5HA 3CX5E 4HB1A 2JQ4A 4BPHA 3N7NA 4PH1A 1Y8AA 5EJDA 1PPJG 4DOJA 1KILB 4ZKPA 1USDA 1IJDB 5KLVJ 1KYOD 1GPJA 2QVAA 1VQMP 2E74D 2BQ1E 2GDXA 3TGUG 2ERHA 1BSNA 1LT9B 2SPZA 3PH0A 1HGVA 2VLOA 2ONTA 2Y9ZA 1J1EC 1JO5A 3B5NC 4OH8B 3L35A 2WTYA 2HPCA 3H1HJ 5AW6B 2KB7P 1NTKD 1UNKA 2WPQA 1HTLC 5HGOA 3CCVP 1FZCB 3MIWA 2KLVA 2Q3IA 1R5LA 1NGMB 3L70E 2MVUA 1VQLP 2BCCE 3L74E 2KR5A 2FVEA 1GZLA 4N3YB 4YXDC 2BHVA 1Z6MA 1LWUB 2H88C 1PGQA 2E76C 2ZVOB 1T6AA 1RE4A 2UWJE 2WPRA 1JMMA 4C7RA 2KOGA 1L0NE 1MZ9A 3L36A 1LTSC 4H2WC 4U3FJ 2WITA 2K9JB 3L75D 1VQ6P 1QEXA 2BEQD 2IYPA 3VP9A 3M0DC 1NQ4A 2H8PD 4C7NB 1LJ2A 1MFZA 4H0LB 2XV6A 1M57D 3NY7B 5B5EE 3TK1A 3SWYA 1MFTA 2K88A 3G26A 2R44A 2OGUA 2QE7H 1D7MA 3G29A 4UB6E 4PV1C 1BCCD 1FZFA 2W6JH 1SQVE 2GUSA 2QJYC 4W7YA 3HD7A 4U0EA 3Q2YA 4M3LA 1BAJA 1JMBA 1SQXK 4GR2A 1PPJD 1NU1J 5CJ0A 4L75A 1OW6A 2KNCA 1N73A 1PGPA 4BPFA 2G3AA 1PGJA 2QM7A 3L70G 2JAZA 2P9XA 2LF4A 4IL6H 4JQ0D 3P7KA 3TSIA 3OW2O 1XTGB 2R5DA 1YQ4C 4HJGH 1L0NG 2HODA 3WBHA 1LTJA 3KQGA 2FVFA 3L37A 2J59M 1T2KD 1FBMA 3PRJA 2FFDB 1NTKJ 3I56P 3PHLA 2KIKA 2AF8A 1CI6B 1JCDA 1FAVA 1MV8A 3U1AA 1NTMG 1M1JC 2FYUK 2YNYA 1YTZI 3HUSA 3RK3E 1Q86Q 2XNDH 5KJ7D 1AQ5A 4K35A 1GU5A 2IBZE 2NPSA 3CX5D 1FOSE 5AVUB 1IFDA 2NPSD 1X22A 3FXDA 2IYOA 3L75J 2Z4EA 5HVCA 1ACPA 2Z44A 4BRYA 3JCUH 5BVZA 2WQYC 2R3SA 1PEQA 3A0BH 2LIUA 1HJ0A 1W2BO 3CCEP 2DNWA 4WY4B 3U1CA 1K30A 3M1MA 5KLIB 1SQBG 3G1IA 2P7JA 4ASWA 2KGEA 3P32A 1VQ8P 2I1JA 1L4AC 1E79H 1BCCJ 5KLVE 2PY8A 1E5WA 1U57A 3L70D 4U0AA 4EDFA 4EOTA 5KAIH 4K3AA 1N8RQ 1OZHA 1KILC 3P8CE 2FQ1A 3RL0D 3V2PA 1BDDA 3A5TA 2HG5D 1L0ND 1KZUB 2AEMA 1URQB 2XDJA 1LT9C 4C46A 2BUOA 1X9VA 2N1TB 1KYOH 2FXPA 4D6TG 2GZFA 2CNRA 3I55P 3B71A 2P58A 3CX5I 3AEGC 1J2JB 5APXA 3HE4A 2JEEA 5APVA 4PD4H 5GTHH 1JNMA 2GZGA 2QJPB 1FZCC 2C9LY 1NTMD 2P10A 4B86A 3AEEC 1N7SC 1DIPA 1SQPE 5CZDB 2WSFJ 5DCKA 2DW3A 1KB9I 2Q5UA 4H2XC 2YO2A 2QJKC 2CK3H 3O8ZA 4ZKUA 1X8YA 1AF8A 2OYOA 1OXZA 3PP5A 2KOSA 4EIJA 1KFNA 3CMAP 3M06A 2CQ8A 2E75B 2HPCB 2ZT9B 1LGHB 1RE3A 2HR3A 3E1IA 2YMKA 1DD4A 2KZIA 4H0LC 2FQ2A 1PEMA 1M1KQ 1PGOA 1H0TA 2O01N 1QRJA 1SQBD 1VQKP 3FWLA 4U0DA 1BE3E 2V7QJ 2I1KA 1SQVK 1M8OB 1NU1E 3WUTA 4H13D 1PP9E 2ZAEB 1GL2A 1IC2A 2OTLP 4NEOA 2HYNA 3Q1MA 4PH0A 2C9NY 1P84H 1JY3O 1GL2D 5E79H 3G0VA 3D71A 2KG6A 2MKVA 1K8AQ 1M7LA 1KMIZ 1SQPG 3L70J 2CPBA 1ZNVA 3RK3D 4COPA 2FVAA 2NO8A 4D6TD 2Q3EA 1UJZA 1OWAA 2BEZF 1L0NJ 2YXQB 2LL8A 2PEOA 4YTPC 1NTKE 2JBGA 4DJGA 4YPCA 2DGYA 1SQQG 3IR9A 2QSIA 5CMZA 3MUDA 1JY2P 1NTZK 1QGKB 3HD7B 2W27A 2M3BA 3IFMA 2Z46A 5KKZB 1AFOA 1RF1A 2L4BA 4NPDA 1N73B 3FGAD 1NTMJ 3FWNA 2W90A 5JPAA 1BE3G 3CXCO 4JPZB 3IF4A 4WVZA 3DS4A 1SQVJ 4JYBA 1LTBC 3V4QA 2KG9A 3DS0A 2J5UA 2RH0A 2K0YA 2HODB 1A8OA 1ZMBA 3HE5A 1LTJB 4I1LA 1IFMA 4UB8E 2VSQA 3H1LE 3LIDA 1WRGA 1Y47A 4WY4C 1VF5B 5KLIC 1JJ2O 1S72P 1GXHA 3M9QA 5AVYB 3IN6A 2PRRA 1UIXA 3E1RA 3HUSB 1PPJE 1RF0C 5KLVK 1AUMA 5CBNA 1ZXGA 1FR2A 4WB4A 3G6EP 5H2FE 2L22A 1SQPD 2NPSB 1M1JB 1LT1A 3TGUE 1A02J 2KSJA 3CXHE 1GDTA 4MN4C 3TDKA 4AUWA 4Y28J 5HGMA 1VQ7P 2IFMA 1JCCA 1EDJA 2OYHA 3SWFA 5GTIE 3W67A 2XXMA 4BRYB 1AQTA 1JY3N 3VMAA 1QVFO 5F2NA 3AE7C 1OMIA 1SQQD 3EJBA 2N1TC 4H44B 2OYIA 3A0HE 1ZN5A 4ZNCA 1N2DC 2JB0A 4U0BA 3L71E 1Q81Q 4I2LC 4OGQD 2PEIA 2QJPC 1SQXG 1SFCA 2LOLA 2AXTE 1BE3D 5AW7B 3H25A 4EI2A 3U43A 3PJSK 5B5EH 3H1LG 1VQ9P 3RL0B 4GT1A 2PEJA 2WT7A 2E74C 1S9KD 3B4QA 3RK2B 1L0HA 1AV1A 3CCUP 4IFMA 2JWAA 4A7PA 3AEDC 3KDPB 1K9MQ 1L0IA 2M3EA 3C9IA 2GZEA 2Q1KA 2E75C 5DJUB 3DS1A 2ZT9C 1KB9E 5K5GB 3EWKA 3E7KA 1W5CE 4Z1MH 3CD6P 3GF7A 4JYCA 1BXIA 1NU1K 2FYZA 2VLQA 3FX0A 3VRLC 4XROA 5DJTB 2P1JA 1EDIA 2JDIH 2JU1A 1EXIA 2FADA 1DNYA 1N7SB 1RE4C 3N4XA 3L71G 1ZRTE 1PFIA 5AW2B 2N98A 3ZDMA 3WU2H 5TISE 2E42A 3IAOA 2QJKB 2YKQA 4MRTC 3T97A 1GW4A 1SQPJ 3P05A 3B5ND 1KTMA 1Q90D 1H0TB 1NTKK 1NH4A 2KI7B 1IO4A 1IFJA 2A45H 2CPSA 1T8ZA 3AE6C 1SQQJ 3NXSA 1M6NA 2D2CD 1NHLA 1NTME 3H1KE 4RJTA 2BASA 1FC2C 2M0BA 3HD7C 1NWQA 2O01H 3H1LD 4NPEA 2E76D 2W8ZA 5KKZC 4TT3H 2PEMA 3KHUA 3RK3B 1N73C 1U7MA 1LNQA 1BE3J 2FACA 3BRTB 3D6ZA 3Q5PA 3DTJA 4ASVA 2JGPA 2HFED 1PP9J 3AEBC 2VLPA 2GZIA 4DG9A 1QL2A 2XZRA 3TGUD 3CXHD 5KAFH 3OA7A 1ZLLA 2AEFA 1MZ8A 3KYQA 1LTJC 2RKLA 4M0IA 4U0FA 1SQBE 1EZVE 1SS1A 4OWFA 5CCHA 1IK7A 2NRGA 3GHGA 2XT1A 2V4HA 5CHXA 5CCHD 1VF5C 1RF1B 1WMKA 3MP7B 1CSBA 3O6QA 1NVOA 3L71D 1FDMA 3HUSC 1OW8A 3TF5A 3H1KG 5KJ7A 2NPSC 2K0XA 3RBZA 3VP8A 4H2YC 3CWBE 3G21A 4GDOA 2ZYDA 1CW5A 3SSUA 1PEUA 3HE5B 4D6TE 3D70A 2MJZA 1YBKA 2WSSH 3MD0A 2FXMA 1H88A 1KQGB 2B9BA 3V4WA 4H44C 1OVVA 4AYCA 3B8EB 2WPSA 2O3JA 5EW5E 2HLOA 1KB9D 3GG2A 1EXJA 3CXHI 3C1LA 5CBOA 1FDOA 5AVSB 1EZVG 2Y0DA 3BRVB 3MHVA 2PENA 2YMYA 3H1LJ 3RL0C 2OTKE 1NKZB 2FBWC 3GJNA 3RK2C 2OYHB 1ZRTD 1GU4A 4F37A 1SVFA 1G1IA 4L74A 1T3UA 4RESB 2OYIB 1JY3P 3G1GA 3BASA 2MY5A 3S4RA 3TGUJ 1BGYE 4TLFA 3CWBG 1NTZG 2OTJP 4R0MA 3G3ZA 1L4AD 1SFCB 1VQ4P 3AE5C 3HRNA 3CCQP 4QNBA 3HZQA 4I7ZB 5BS1A 3TNUA 2KXPB 1YJ9P 1XTCC 2WT7B 4N78E 3H1KD 3VMXA 5B66H 2H89C 3L71J 1L0LE 1FZBA 5CCGA 2E74B 4N6JA 4XA4A 2FQ0A 1L0NK 4KJMA 2AXCA 5CCGD 4R4MA 1DD3A 1VQOP 1RE3C 2KK7A 3DS5A 2KSEA 1SQQE 3QH9A 2PP6A 3BATA 4IZ6A 1FS0E 2A06G 3H1JG 2E43A 2K3RA 2KGAA 1RY3A 2LXCB 2N9BA 2H7HA 2XZ0D 1NO4A 1NTMK 1LWUA 2K0DX 1EZVD 4L73A 1KORA 1GL2C 2WSEJ 4DZOA 5HGLA 1BGYG 5AW3B 1U7JA 1FU1A 1S9KE 3RK3C 4IOIH 2PEKA 4YXWH 5KP7B 2PAJA 4IFFA 1LTIC 1Q82Q 1OX3A 2LXBA 1G1JA 2YXRB 1YJWP 2M5RA 1FZAA 4H0LD 3CE7A 1L0LG 2D2CB 3CWBD 2IZ0A 4OVNF 4GKGA 2C0XA 1SQBK 1K73Q 3GW6A 2JJLA 1MUUA 1DEBA 3MUDC 1KQSO 1D1DA 3H32A 1AA0A 3GMAA 2M8NA 1RF1C 1Q2NA 3G9RA 4LC1A 4RKUJ 3KXDA 3BCCE 2B87A 4QMAA 1FZGA 2N6YA 2KNCB 1RH5B 2KORA 2QNWA 2WSFH 3H1KJ 1EZVI 4JF7A 3RG6C 2JKVA 2KOPA 2ZJSE 1NYHA 1T8KA 4U7JA 3RL0g 1HH0A 1VL2A 2A06D 1IK9A 3H1JD 1K04A 3LRYA 1NKNA 4EYYQ 2N50A 2OQQA 3S9OA 2O1JA 2AFEA 2VRSA 1UIIA 3GHGB 2FFDA 4R4LA 3CX5H 1VHNA 3CCLP 1CI6A 3VOPA 1SQXE 2IX7C 1CZQA 5C39A 2PFXA 3EJDA 1BGYD 3O6QB 3VYIA 5EFWB 3V2RA 1EDKA 1EQ7A 1LTGC 1FDIA 1NAYA 3HTKA 1YHQP 1SQBJ 2V7QH 1YYCA 1KB9H 2O1KA 4HYTB 2EHSA 4HH2A 3AE2C 2LIWA 4N78D 1OVUA 1M56D 1PZQA 3I5CA 1P84E 2JR8A 2OYHC 3BCCG 3VN0A 1L0LD 1FJPA 3Q5SA 4I6MC 4WBAA 2OYIC 2XKMA 1GXGA 3CC7P 1VPCA 3CL3D 1J1DB 3CCSP 1RQVA 2AEJA 3GF3A 2GA1A 3CWBJ 1FE6A 1S5LE 1DV5A 2FYUE 1IMPA 1PL5A 3AEAC 1KC8Q 4D6TJ 2IFNA 3HYBA 2AFDA 3B4SA 1GTWA 2JWDA 1SFCC 1HGZA 1RQUA 4I7ZC 5AW8B 2M8PA 2G8YA 1ZP0C 3W68A 2GYKA 3RBXA 3USSA 4CPGA 1KN7A 2Q9IA 1JY2O 1SQPK 3CCJP 3L75G 1KQLA 1URQA 2FXOA 2JO1A 3H47A 1URQD 2FKWB 4UB6H 4BXLA 2KODA 2E5TA 2Y0CA 1DX7A 2L6EA 1GK6A 2C0WA 2ZVNB 1SQQK 3F89A 2KG8A 4KHXA 4GOFA 2MF4A 4Y99B 2QIWA 3R4YA 1YQ3C 1EDLA 2Z45A 3CC2P 3KZIE 3TNUB 3HE4B 4GOEA 1ZV8A 3M9HA 3CPWO 2R3CA 2KYVA 2LR2A 1MKMA 4W7ZA 1BGYJ 2Z5IA 4XE5B 1JOCA 1FJKA 4LGDE 2FYUG 1AYIA 5AW1B 5KTBA 4U0CA 1R8EA 1ZR2A 4PD4D 3BCCD 1RHZB 1QX8A 2ZXXA 3L4FA 4DCKA 1SLQA 1Y9BA 3B5NA 5HV8A 2E75D 2ZT9D 3GZLA 4KT0J 3QWOC 2D2CC 1L0LJ 4RO0A 3G71P 3K5BA 1ZR4A 3JSVC 2N5HA 2KS1A 1EOQA 3AE8C 2L9FA 2NZ2A 2ROQA 1A43A 2L0QA 4H13B 1IZNB 2RN0A 1JUNA 1Q7YQ 1IFPA 3GKLC 3ITKA 1S5LX 2Y9YA 2LKIA 1SQXD 2J58A 2LTEA 3V2NA 1GL2B 3CCMP 1KILE 4PJ0E 1JEKA 3H1IE 2PGDA 4IFDK 2POHA 2K1AA 2W6BA 3H6PA 1YIJP 1GD2E 5BU5A 1F80D 1KYOI 3M0DA 1PV3A 3L72E 3V2QA 3CCRP 5APQA 3WUUA 1M74A 1VQNP 1HWTC 1JY2N 2N5IA 1H8AA 2ZXEB 1P84D 5AW4B 1CEIA 1QVGO 1VDFA 4PD4I 3A2AA 1X79B 5BS2A 5CCHC 3GHGC 1T2KC 1NJIQ 3PLNA 2Q7CA 3H32B 3HD7D 3Q5RA 1DEEG 5BU8B 4PV1D 1AVYA 1GW3A 5APUA 3OAKA 2BCCG 3L74G 3OJAB 2B87B 2FYUD 1BDCA 1VQ5P 2QEXP 3GZMA 2KUBA 1FZEA 3A3YB 5KJ7C 1JTHA 1YJNP 2JYLA 2MVVA 5APTA 3CMEP 1R5SA 4HKZH 1VKUA 1S2EA 2CGQA 3WU2E 3E2DA 3F5HA 3BCCJ 1OIPA 3H1IG 1NTZE 2QM8A 2MD9A 2JP3A 1A02F 2KW2A 2KGDA 1IFIA 5AVVB 3L72G 2XV5A 2WPTA 1J1DC 5AW9B 1ZOYC 2M5AA 5KP6B 1VF5D 3NMDA 2K9YA 1SQVG 2PNGA 1P84I 2OARA 3HTKB 3Q3DA 4DT0A 2K2QA 1OVRA 1M1JA 2KOQA 3LW5J 4XFZA 3L73E 1RNIA 1M6EX 1FOSF 2ZFCA 1SQXJ 1G2CA 3VMZA 4CA3A 2FAEA 3CC4P 2P67A 2X2BA 5AVRB 2JU2A 2YIUB 1EC5A 2GDWA 2A06E 2KP8A 3H1JE 2LPKA 4O9BA 3WUVA 4GR6A 4H44D 3BVHA 1WT6A 3AE1C 1AJYA 1HY8A 1NOHA 1OW7A 1DH3A 3SWKA 4Y99C 2EHTA 3H4EA 1LP1A 3LMOA 5KAFE 3G4SP 4IL6E 1HJBA 4OGQB 3Q20A 2BCCD 1W2EA 1L4AA 2E5YA 3L74D 1TU3F 2L91A 3GLMA 1QLED 1YI2P 2FYNB 5AVTB 4NPFX 3RGUA 3C8VA 2WMMA 5M1BA 3CI9A 3H1HE 2LMLA 1KV4A 1KILA 3RK2D 2FYUJ 2YKOA 5CCGC 2A45G 1RO2A 3D6YA 2IBZG 1KILD 3H1ID 2GUVA 3L73G 1LT9A 3SFDC 1JB0J 1KFMA 2MR7A 3MZWB 1OR5A 5KP8B 3AE9C 4JBZA 5AVZB 3II6A 3L72D 2IDBA 3AE3C 1YTZT 3B5IA 1S3JA 2WSCJ 1LTTC 4XFXA 4WWIA 1SQVD 1E0HA 1FZCA 4U3FE 4UHPB 1LWUC 2WPVB 5CJ4A 1N7SA 1N7LA 2KZJA 5F2OA 1VQPP 1IMQA 4H13C 4XRQA 2KLUA 4IPYA 5AVQB 1OFCX 2GM4A 3JCUE 1HF9A 1N7SD 5KLVG 3A0BE 1S1CX 2B88A 3LW5H 3S1KA 1HUCA 3MTUE 2K92A 2IZ1A 2Q6QA 1AVOA 3R2PA 3WMM0 2K9JA 4UB8H 1J1EB 3T97B 1E6JP 3B5NB 1M90Q 2EFJA 3H1HG 4C7NA 3DS3A 5APYA 5AW5B 5AVXB 1PEOA 3SFEC 5KAIE 4L76A 3AECC 2KS1B 2ZYGA 3P8MC 2WVRA 5H2FH 2PEQA 1NTZD 1S4XA 3CLQA 4WYMA 1KQFB 3AE4C 2KGCA 1N86A 4XFYA 2B89A 2YO3A 4HKGA 2EIAA 2IPPA 4XFJA 3CXHH 2E76B 1KYOE 4IL6X 1EMVA 5APWA 2BCCJ 3L74J 3EQ2A 4LLHA 5APSA 4PWVB 5GTIH 4U3FG 2JO0A 2IBZD 4PD4E 5GTHE 3MGEA 2KWLA 1S5LH 1PIXA 3A0HH 3L73D 5B66E 3ABVC 2WZ7A 2ITAA 3UIAA 2L5GB 5F2KA 2MR8A 2VLNA 2K93A 3H1IJ 2I8DA 7CEIA 4PV1B 2FFDC 2AXTH 1QL1A 3NFQA 3H0DA 5I4TG 2AVAA 2M8LA 1ZW0A 2QJYB 2YKPA 3NTEA 3AEFC 1K05A 3L72J 3G28A 2WSCH 4PXHB 4W80A 1NU1G 3TYYA 1IFNA 2W6AA 5KLVD 3M91A 1PP9G 2QG4A 2EG5A 3L75E 2R32A 1X0TA 3JC22 1JTHB 5HGNA 1EIAA 3DS2A 2QRXA 2WSEH 1H89A 4GIFA 3P8CD 3V6IA 1ZMEC 3KZIH 1BSHA 3H1HD 3VTPC 2GDYA 3NTNA 3MGNA 2K94A 2CG5B 2YIUC 2FHSC 2LKMA 1BCCE 3EFFK 2A45I 1KLPA 5E79E 3U59A 2H43A 2K5XA 2IBZI
chains in the Genus database with same CATH topology
1VQKP 2ONTA 3G71P 2EIAA 3E2DA 1A8OA 1ZMBA 2P9XA 4U0DA 2M8PA 1VQOP 3CCUP 1EOQA 3DS5A 2PY8A 2LF4A 1RO2A 3DPHA 3RG6C 2PEMA 1K9MQ 4U0AA 1A43A 3OW2O 1N8RQ 3CCJP 5HGOA 2JO0A 1Q7YQ 3CCVP 2OTLP 3DTJA 3MGEA 3WBHA 4PH0A 1IUQA 1RO0A 3DS1A 1S72P 1JJ2O 3LRYA 3CCMP 2PENA 3G0VA 3H47A 1VQLP 1YITP 2KODA 1K8AQ 2OARA 2BHVA 2BUOA 5HGLA 3CD6P 3B5IA 3CCLP 1AUMA 2L6EA 5F2KA 1KD1Q 4XFXA 3I56P 3G6EP 1YIJP 3I55P 4M0IA 4XFZA 4COPA 1RNIA 1M6EX 3VRLC 4U0FA 2CWOA 2QA4P 4XROA 4COCA 3CCRP 5F2OA 3H0DA 1VQPP 1M74A 5I4TG 2Z45A 1VQNP 4XRQA 2M8LA 2PEKA 4IPYA 3G1GA 3NTEA 2XT1A 1YHQP 2PEOA 3CC2P 3CC4P 1Q86Q 3G28A 1VQ6P 2E1MA 5HGMA 1VQ7P 2DGYA 1QVGO 1Q82Q 2XXMA 5DCKA 1YJWP 2OTJP 5BS2A 3CPWO 2JYGA 1QVFO 1NJIQ 2XV6A 5F2NA 2EG5A 4GR6A 1VQ4P 3G26A 3CCQP 4QNBA 3HZQA 3P05A 1E6JP 2Z46A 5BS1A 1M90Q 3G29A 5HGNA 2EFJA 1EIAA 4U0BA 1YJ9P 1K73Q 3DS2A 3H4EA 4U0CA 2Z44A 3DS3A 3G4SP 1Q81Q 1VQ5P 5JPAA 1KQSO 3G21A 4PH1A 2PEIA 1PEOA 3CXCO 3CMAP 3Q20A 1PEQA 1D1DA 2QEXP 1PEUA 3CC7P 4U0EA 2M8NA 3DS4A 3CCSP 1W2BO 3CCEP 1BAJA 4XFYA 1K30A 3M1MA 1YI2P 1YJNP 2JYLA 4GR2A 1M6NA 3G1IA 3CMEP 3DS0A 2PEQA 1VQMP 1VQ9P 2BQ1E 4WYMA 1KC8Q 1PEMA 1VQ8P 1M1KQ 2PEJA 3HYBA 1QRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 P;  1YHQ P;  1VQK P;  1VQL P;  3G71 P;  1YIT P;  3CC2 P;  3CC4 P;  1Q86 Q;  1VQ6 P;  3G4S P;  1Q81 Q;  1VQ7 P;  1VQ5 P;  1VQO P;  1K8A Q;  1QVG O;  3CCU P;  1Q82 Q;  1KQS O;  3CD6 P;  3CCL P;  3CXC O;  3CMA P;  2QEX P;  1YJW P;  1K9M Q;  2OTJ P;  3CPW O;  3CC7 P;  1KD1 Q;  3OW2 O;  3I56 P;  1N8R Q;  3G6E P;  3CCS P;  1YIJ P;  1W2B O;  1NJI Q;  3CCE P;  1QVF O;  3I55 P;  3CCJ P;  1YI2 P;  1YJN P;  1Q7Y Q;  3CCV P;  2OTL P;  2QA4 P;  3CME P;  1VQ4 P;  3CCR P;  1VQM P;  3CCQ P;  1VQ9 P;  1VQP P;  1KC8 Q;  1M90 Q;  1M1K Q;  1VQ8 P;  1VQN P;  1JJ2 O;  1S72 P;  3CCM P;  1K73 Q; 
#chains in the Genus database with same CATH topology
 2XZ1 C;  1NTK G;  2M5A B;  1USE A;  3KPE A;  4WY4 A;  1HQB A;  3RG2 A;  3DPH A;  2XU6 A;  2RMZ A;  3EJE A;  1GMJ A;  1GK4 A;  5TIS H;  1HVV A;  4OGQ C;  2XNX A;  4WY4 D;  4QKO A;  1SP4 A;  1X3O A;  3FXE A;  1NAF A;  1NTZ J;  1RF0 A;  1JM0 A;  3LIE A;  2KOO A;  5TJH A;  4U3F D;  1IUQ A;  1RO0 A;  2FYN C;  3EFG A;  1L2P A;  4BWN A;  1YIT P;  3PTZ A;  2ZYA A;  1G2C B;  1T3J A;  1URQ C;  5AW0 B;  2K37 A;  4GOD A;  1KD1 Q;  4AQR D;  4ZMD A;  3M0A A;  3V5B A;  2WWW A;  3VMY A;  2CWO A;  2QA4 P;  4COC A;  2N9Y B;  2W83 C;  2Y0E A;  1L0L K;  4BPG A;  3L73 J;  3M9B A;  5L8R J;  2N1T A;  2E1M A;  4PJ0 H;  2O01 J;  1Z56 A;  1HBW A;  1LTA C;  1LP1 B;  2R5B A;  2N1T D;  2P2U A;  5AVW B;  2JYG A;  3A7O A;  1L4A B;  1NU1 D;  2N6Z A;  1SFC D;  2GZJ A;  1BCC G;  2M8R A;  2FY8 A;  1PP9 D;  3H1J J;  2Z5H A;  3CX5 E;  4HB1 A;  2JQ4 A;  4BPH A;  3N7N A;  4PH1 A;  1Y8A A;  5EJD A;  1PPJ G;  4DOJ A;  1KIL B;  4ZKP A;  1USD A;  1IJD B;  5KLV J;  1KYO D;  1GPJ A;  2QVA A;  1VQM P;  2E74 D;  2BQ1 E;  2GDX A;  3TGU G;  2ERH A;  1BSN A;  1LT9 B;  2SPZ A;  3PH0 A;  1HGV A;  2VLO A;  2ONT A;  2Y9Z A;  1J1E C;  1JO5 A;  3B5N C;  4OH8 B;  3L35 A;  2WTY A;  2HPC A;  3H1H J;  5AW6 B;  2KB7 P;  1NTK D;  1UNK A;  2WPQ A;  1HTL C;  5HGO A;  3CCV P;  1FZC B;  3MIW A;  2KLV A;  2Q3I A;  1R5L A;  1NGM B;  3L70 E;  2MVU A;  1VQL P;  2BCC E;  3L74 E;  2KR5 A;  2FVE A;  1GZL A;  4N3Y B;  4YXD C;  2BHV A;  1Z6M A;  1LWU B;  2H88 C;  1PGQ A;  2E76 C;  2ZVO B;  1T6A A;  1RE4 A;  2UWJ E;  2WPR A;  1JMM A;  4C7R A;  2KOG A;  1L0N E;  1MZ9 A;  3L36 A;  1LTS C;  4H2W C;  4U3F J;  2WIT A;  2K9J B;  3L75 D;  1VQ6 P;  1QEX A;  2BEQ D;  2IYP A;  3VP9 A;  3M0D C;  1NQ4 A;  2H8P D;  4C7N B;  1LJ2 A;  1MFZ A;  4H0L B;  2XV6 A;  1M57 D;  3NY7 B;  5B5E E;  3TK1 A;  3SWY A;  1MFT A;  2K88 A;  3G26 A;  2R44 A;  2OGU A;  2QE7 H;  1D7M A;  3G29 A;  4UB6 E;  4PV1 C;  1BCC D;  1FZF A;  2W6J H;  1SQV E;  2GUS A;  2QJY C;  4W7Y A;  3HD7 A;  4U0E A;  3Q2Y A;  4M3L A;  1BAJ A;  1JMB A;  1SQX K;  4GR2 A;  1PPJ D;  1NU1 J;  5CJ0 A;  4L75 A;  1OW6 A;  2KNC A;  1N73 A;  1PGP A;  4BPF A;  2G3A A;  1PGJ A;  2QM7 A;  3L70 G;  2JAZ A;  2P9X A;  2LF4 A;  4IL6 H;  4JQ0 D;  3P7K A;  3TSI A;  3OW2 O;  1XTG B;  2R5D A;  1YQ4 C;  4HJG H;  1L0N G;  2HOD A;  3WBH A;  1LTJ A;  3KQG A;  2FVF A;  3L37 A;  2J59 M;  1T2K D;  1FBM A;  3PRJ A;  2FFD B;  1NTK J;  3I56 P;  3PHL A;  2KIK A;  2AF8 A;  1CI6 B;  1JCD A;  1FAV A;  1MV8 A;  3U1A A;  1NTM G;  1M1J C;  2FYU K;  2YNY A;  1YTZ I;  3HUS A;  3RK3 E;  1Q86 Q;  2XND H;  5KJ7 D;  1AQ5 A;  4K35 A;  1GU5 A;  2IBZ E;  2NPS A;  3CX5 D;  1FOS E;  5AVU B;  1IFD A;  2NPS D;  1X22 A;  3FXD A;  2IYO A;  3L75 J;  2Z4E A;  5HVC A;  1ACP A;  2Z44 A;  4BRY A;  3JCU H;  5BVZ A;  2WQY C;  2R3S A;  1PEQ A;  3A0B H;  2LIU A;  1HJ0 A;  1W2B O;  3CCE P;  2DNW A;  4WY4 B;  3U1C A;  1K30 A;  3M1M A;  5KLI B;  1SQB G;  3G1I A;  2P7J A;  4ASW A;  2KGE A;  3P32 A;  1VQ8 P;  2I1J A;  1L4A C;  1E79 H;  1BCC J;  5KLV E;  2PY8 A;  1E5W A;  1U57 A;  3L70 D;  4U0A A;  4EDF A;  4EOT A;  5KAI H;  4K3A A;  1N8R Q;  1OZH A;  1KIL C;  3P8C E;  2FQ1 A;  3RL0 D;  3V2P A;  1BDD A;  3A5T A;  2HG5 D;  1L0N D;  1KZU B;  2AEM A;  1URQ B;  2XDJ A;  1LT9 C;  4C46 A;  2BUO A;  1X9V A;  2N1T B;  1KYO H;  2FXP A;  4D6T G;  2GZF A;  2CNR A;  3I55 P;  3B71 A;  2P58 A;  3CX5 I;  3AEG C;  1J2J B;  5APX A;  3HE4 A;  2JEE A;  5APV A;  4PD4 H;  5GTH H;  1JNM A;  2GZG A;  2QJP B;  1FZC C;  2C9L Y;  1NTM D;  2P10 A;  4B86 A;  3AEE C;  1N7S C;  1DIP A;  1SQP E;  5CZD B;  2WSF J;  5DCK A;  2DW3 A;  1KB9 I;  2Q5U A;  4H2X C;  2YO2 A;  2QJK C;  2CK3 H;  3O8Z A;  4ZKU A;  1X8Y A;  1AF8 A;  2OYO A;  1OXZ A;  3PP5 A;  2KOS A;  4EIJ A;  1KFN A;  3CMA P;  3M06 A;  2CQ8 A;  2E75 B;  2HPC B;  2ZT9 B;  1LGH B;  1RE3 A;  2HR3 A;  3E1I A;  2YMK A;  1DD4 A;  2KZI A;  4H0L C;  2FQ2 A;  1PEM A;  1M1K Q;  1PGO A;  1H0T A;  2O01 N;  1QRJ A;  1SQB D;  1VQK P;  3FWL A;  4U0D A;  1BE3 E;  2V7Q J;  2I1K A;  1SQV K;  1M8O B;  1NU1 E;  3WUT A;  4H13 D;  1PP9 E;  2ZAE B;  1GL2 A;  1IC2 A;  2OTL P;  4NEO A;  2HYN A;  3Q1M A;  4PH0 A;  2C9N Y;  1P84 H;  1JY3 O;  1GL2 D;  5E79 H;  3G0V A;  3D71 A;  2KG6 A;  2MKV A;  1K8A Q;  1M7L A;  1KMI Z;  1SQP G;  3L70 J;  2CPB A;  1ZNV A;  3RK3 D;  4COP A;  2FVA A;  2NO8 A;  4D6T D;  2Q3E A;  1UJZ A;  1OWA A;  2BEZ F;  1L0N J;  2YXQ B;  2LL8 A;  2PEO A;  4YTP C;  1NTK E;  2JBG A;  4DJG A;  4YPC A;  2DGY A;  1SQQ G;  3IR9 A;  2QSI A;  5CMZ A;  3MUD A;  1JY2 P;  1NTZ K;  1QGK B;  3HD7 B;  2W27 A;  2M3B A;  3IFM A;  2Z46 A;  5KKZ B;  1AFO A;  1RF1 A;  2L4B A;  4NPD A;  1N73 B;  3FGA D;  1NTM J;  3FWN A;  2W90 A;  5JPA A;  1BE3 G;  3CXC O;  4JPZ B;  3IF4 A;  4WVZ A;  3DS4 A;  1SQV J;  4JYB A;  1LTB C;  3V4Q A;  2KG9 A;  3DS0 A;  2J5U A;  2RH0 A;  2K0Y A;  2HOD B;  1A8O A;  1ZMB A;  3HE5 A;  1LTJ B;  4I1L A;  1IFM A;  4UB8 E;  2VSQ A;  3H1L E;  3LID A;  1WRG A;  1Y47 A;  4WY4 C;  1VF5 B;  5KLI C;  1JJ2 O;  1S72 P;  1GXH A;  3M9Q A;  5AVY B;  3IN6 A;  2PRR A;  1UIX A;  3E1R A;  3HUS B;  1PPJ E;  1RF0 C;  5KLV K;  1AUM A;  5CBN A;  1ZXG A;  1FR2 A;  4WB4 A;  3G6E P;  5H2F E;  2L22 A;  1SQP D;  2NPS B;  1M1J B;  1LT1 A;  3TGU E;  1A02 J;  2KSJ A;  3CXH E;  1GDT A;  4MN4 C;  3TDK A;  4AUW A;  4Y28 J;  5HGM A;  1VQ7 P;  2IFM A;  1JCC A;  1EDJ A;  2OYH A;  3SWF A;  5GTI E;  3W67 A;  2XXM A;  4BRY B;  1AQT A;  1JY3 N;  3VMA A;  1QVF O;  5F2N A;  3AE7 C;  1OMI A;  1SQQ D;  3EJB A;  2N1T C;  4H44 B;  2OYI A;  3A0H E;  1ZN5 A;  4ZNC A;  1N2D C;  2JB0 A;  4U0B A;  3L71 E;  1Q81 Q;  4I2L C;  4OGQ D;  2PEI A;  2QJP C;  1SQX G;  1SFC A;  2LOL A;  2AXT E;  1BE3 D;  5AW7 B;  3H25 A;  4EI2 A;  3U43 A;  3PJS K;  5B5E H;  3H1L G;  1VQ9 P;  3RL0 B;  4GT1 A;  2PEJ A;  2WT7 A;  2E74 C;  1S9K D;  3B4Q A;  3RK2 B;  1L0H A;  1AV1 A;  3CCU P;  4IFM A;  2JWA A;  4A7P A;  3AED C;  3KDP B;  1K9M Q;  1L0I A;  2M3E A;  3C9I A;  2GZE A;  2Q1K A;  2E75 C;  5DJU B;  3DS1 A;  2ZT9 C;  1KB9 E;  5K5G B;  3EWK A;  3E7K A;  1W5C E;  4Z1M H;  3CD6 P;  3GF7 A;  4JYC A;  1BXI A;  1NU1 K;  2FYZ A;  2VLQ A;  3FX0 A;  3VRL C;  4XRO A;  5DJT B;  2P1J A;  1EDI A;  2JDI H;  2JU1 A;  1EXI A;  2FAD A;  1DNY A;  1N7S B;  1RE4 C;  3N4X A;  3L71 G;  1ZRT E;  1PFI A;  5AW2 B;  2N98 A;  3ZDM A;  3WU2 H;  5TIS E;  2E42 A;  3IAO A;  2QJK B;  2YKQ A;  4MRT C;  3T97 A;  1GW4 A;  1SQP J;  3P05 A;  3B5N D;  1KTM A;  1Q90 D;  1H0T B;  1NTK K;  1NH4 A;  2KI7 B;  1IO4 A;  1IFJ A;  2A45 H;  2CPS A;  1T8Z A;  3AE6 C;  1SQQ J;  3NXS A;  1M6N A;  2D2C D;  1NHL A;  1NTM E;  3H1K E;  4RJT A;  2BAS A;  1FC2 C;  2M0B A;  3HD7 C;  1NWQ A;  2O01 H;  3H1L D;  4NPE A;  2E76 D;  2W8Z A;  5KKZ C;  4TT3 H;  2PEM A;  3KHU A;  3RK3 B;  1N73 C;  1U7M A;  1LNQ A;  1BE3 J;  2FAC A;  3BRT B;  3D6Z A;  3Q5P A;  3DTJ A;  4ASV A;  2JGP A;  2HFE D;  1PP9 J;  3AEB C;  2VLP A;  2GZI A;  4DG9 A;  1QL2 A;  2XZR A;  3TGU D;  3CXH D;  5KAF H;  3OA7 A;  1ZLL A;  2AEF A;  1MZ8 A;  3KYQ A;  1LTJ C;  2RKL A;  4M0I A;  4U0F A;  1SQB E;  1EZV E;  1SS1 A;  4OWF A;  5CCH A;  1IK7 A;  2NRG A;  3GHG A;  2XT1 A;  2V4H A;  5CHX A;  5CCH D;  1VF5 C;  1RF1 B;  1WMK A;  3MP7 B;  1CSB A;  3O6Q A;  1NVO A;  3L71 D;  1FDM A;  3HUS C;  1OW8 A;  3TF5 A;  3H1K G;  5KJ7 A;  2NPS C;  2K0X A;  3RBZ A;  3VP8 A;  4H2Y C;  3CWB E;  3G21 A;  4GDO A;  2ZYD A;  1CW5 A;  3SSU A;  1PEU A;  3HE5 B;  4D6T E;  3D70 A;  2MJZ A;  1YBK A;  2WSS H;  3MD0 A;  2FXM A;  1H88 A;  1KQG B;  2B9B A;  3V4W A;  4H44 C;  1OVV A;  4AYC A;  3B8E B;  2WPS A;  2O3J A;  5EW5 E;  2HLO A;  1KB9 D;  3GG2 A;  1EXJ A;  3CXH I;  3C1L A;  5CBO A;  1FDO A;  5AVS B;  1EZV G;  2Y0D A;  3BRV B;  3MHV A;  2PEN A;  2YMY A;  3H1L J;  3RL0 C;  2OTK E;  1NKZ B;  2FBW C;  3GJN A;  3RK2 C;  2OYH B;  1ZRT D;  1GU4 A;  4F37 A;  1SVF A;  1G1I A;  4L74 A;  1T3U A;  4RES B;  2OYI B;  1JY3 P;  3G1G A;  3BAS A;  2MY5 A;  3S4R A;  3TGU J;  1BGY E;  4TLF A;  3CWB G;  1NTZ G;  2OTJ P;  4R0M A;  3G3Z A;  1L4A D;  1SFC B;  1VQ4 P;  3AE5 C;  3HRN A;  3CCQ P;  4QNB A;  3HZQ A;  4I7Z B;  5BS1 A;  3TNU A;  2KXP B;  1YJ9 P;  1XTC C;  2WT7 B;  4N78 E;  3H1K D;  3VMX A;  5B66 H;  2H89 C;  3L71 J;  1L0L E;  1FZB A;  5CCG A;  2E74 B;  4N6J A;  4XA4 A;  2FQ0 A;  1L0N K;  4KJM A;  2AXC A;  5CCG D;  4R4M A;  1DD3 A;  1VQO P;  1RE3 C;  2KK7 A;  3DS5 A;  2KSE A;  1SQQ E;  3QH9 A;  2PP6 A;  3BAT A;  4IZ6 A;  1FS0 E;  2A06 G;  3H1J G;  2E43 A;  2K3R A;  2KGA A;  1RY3 A;  2LXC B;  2N9B A;  2H7H A;  2XZ0 D;  1NO4 A;  1NTM K;  1LWU A;  2K0D X;  1EZV D;  4L73 A;  1KOR A;  1GL2 C;  2WSE J;  4DZO A;  5HGL A;  1BGY G;  5AW3 B;  1U7J A;  1FU1 A;  1S9K E;  3RK3 C;  4IOI H;  2PEK A;  4YXW H;  5KP7 B;  2PAJ A;  4IFF A;  1LTI C;  1Q82 Q;  1OX3 A;  2LXB A;  1G1J A;  2YXR B;  1YJW P;  2M5R A;  1FZA A;  4H0L D;  3CE7 A;  1L0L G;  2D2C B;  3CWB D;  2IZ0 A;  4OVN F;  4GKG A;  2C0X A;  1SQB K;  1K73 Q;  3GW6 A;  2JJL A;  1MUU A;  1DEB A;  3MUD C;  1KQS O;  1D1D A;  3H32 A;  1AA0 A;  3GMA A;  2M8N A;  1RF1 C;  1Q2N A;  3G9R A;  4LC1 A;  4RKU J;  3KXD A;  3BCC E;  2B87 A;  4QMA A;  1FZG A;  2N6Y A;  2KNC B;  1RH5 B;  2KOR A;  2QNW A;  2WSF H;  3H1K J;  1EZV I;  4JF7 A;  3RG6 C;  2JKV A;  2KOP A;  2ZJS E;  1NYH A;  1T8K A;  4U7J A;  3RL0 g;  1HH0 A;  1VL2 A;  2A06 D;  1IK9 A;  3H1J D;  1K04 A;  3LRY A;  1NKN A;  4EYY Q;  2N50 A;  2OQQ A;  3S9O A;  2O1J A;  2AFE A;  2VRS A;  1UII A;  3GHG B;  2FFD A;  4R4L A;  3CX5 H;  1VHN A;  3CCL P;  1CI6 A;  3VOP A;  1SQX E;  2IX7 C;  1CZQ A;  5C39 A;  2PFX A;  3EJD A;  1BGY D;  3O6Q B;  3VYI A;  5EFW B;  3V2R A;  1EDK A;  1EQ7 A;  1LTG C;  1FDI A;  1NAY A;  3HTK A;  1YHQ P;  1SQB J;  2V7Q H;  1YYC A;  1KB9 H;  2O1K A;  4HYT B;  2EHS A;  4HH2 A;  3AE2 C;  2LIW A;  4N78 D;  1OVU A;  1M56 D;  1PZQ A;  3I5C A;  1P84 E;  2JR8 A;  2OYH C;  3BCC G;  3VN0 A;  1L0L D;  1FJP A;  3Q5S A;  4I6M C;  4WBA A;  2OYI C;  2XKM A;  1GXG A;  3CC7 P;  1VPC A;  3CL3 D;  1J1D B;  3CCS P;  1RQV A;  2AEJ A;  3GF3 A;  2GA1 A;  3CWB J;  1FE6 A;  1S5L E;  1DV5 A;  2FYU E;  1IMP A;  1PL5 A;  3AEA C;  1KC8 Q;  4D6T J;  2IFN A;  3HYB A;  2AFD A;  3B4S A;  1GTW A;  2JWD A;  1SFC C;  1HGZ A;  1RQU A;  4I7Z C;  5AW8 B;  2M8P A;  2G8Y A;  1ZP0 C;  3W68 A;  2GYK A;  3RBX A;  3USS A;  4CPG A;  1KN7 A;  2Q9I A;  1JY2 O;  1SQP K;  3CCJ P;  3L75 G;  1KQL A;  1URQ A;  2FXO A;  2JO1 A;  3H47 A;  1URQ D;  2FKW B;  4UB6 H;  4BXL A;  2KOD A;  2E5T A;  2Y0C A;  1DX7 A;  2L6E A;  1GK6 A;  2C0W A;  2ZVN B;  1SQQ K;  3F89 A;  2KG8 A;  4KHX A;  4GOF A;  2MF4 A;  4Y99 B;  2QIW A;  3R4Y A;  1YQ3 C;  1EDL A;  2Z45 A;  3CC2 P;  3KZI E;  3TNU B;  3HE4 B;  4GOE A;  1ZV8 A;  3M9H A;  3CPW O;  2R3C A;  2KYV A;  2LR2 A;  1MKM A;  4W7Z A;  1BGY J;  2Z5I A;  4XE5 B;  1JOC A;  1FJK A;  4LGD E;  2FYU G;  1AYI A;  5AW1 B;  5KTB A;  4U0C A;  1R8E A;  1ZR2 A;  4PD4 D;  3BCC D;  1RHZ B;  1QX8 A;  2ZXX A;  3L4F A;  4DCK A;  1SLQ A;  1Y9B A;  3B5N A;  5HV8 A;  2E75 D;  2ZT9 D;  3GZL A;  4KT0 J;  3QWO C;  2D2C C;  1L0L J;  4RO0 A;  3G71 P;  3K5B A;  1ZR4 A;  3JSV C;  2N5H A;  2KS1 A;  1EOQ A;  3AE8 C;  2L9F A;  2NZ2 A;  2ROQ A;  1A43 A;  2L0Q A;  4H13 B;  1IZN B;  2RN0 A;  1JUN A;  1Q7Y Q;  1IFP A;  3GKL C;  3ITK A;  1S5L X;  2Y9Y A;  2LKI A;  1SQX D;  2J58 A;  2LTE A;  3V2N A;  1GL2 B;  3CCM P;  1KIL E;  4PJ0 E;  1JEK A;  3H1I E;  2PGD A;  4IFD K;  2POH A;  2K1A A;  2W6B A;  3H6P A;  1YIJ P;  1GD2 E;  5BU5 A;  1F80 D;  1KYO I;  3M0D A;  1PV3 A;  3L72 E;  3V2Q A;  3CCR P;  5APQ A;  3WUU A;  1M74 A;  1VQN P;  1HWT C;  1JY2 N;  2N5I A;  1H8A A;  2ZXE B;  1P84 D;  5AW4 B;  1CEI A;  1QVG O;  1VDF A;  4PD4 I;  3A2A A;  1X79 B;  5BS2 A;  5CCH C;  3GHG C;  1T2K C;  1NJI Q;  3PLN A;  2Q7C A;  3H32 B;  3HD7 D;  3Q5R A;  1DEE G;  5BU8 B;  4PV1 D;  1AVY A;  1GW3 A;  5APU A;  3OAK A;  2BCC G;  3L74 G;  3OJA B;  2B87 B;  2FYU D;  1BDC A;  1VQ5 P;  2QEX P;  3GZM A;  2KUB A;  1FZE A;  3A3Y B;  5KJ7 C;  1JTH A;  1YJN P;  2JYL A;  2MVV A;  5APT A;  3CME P;  1R5S A;  4HKZ H;  1VKU A;  1S2E A;  2CGQ A;  3WU2 E;  3E2D A;  3F5H A;  3BCC J;  1OIP A;  3H1I G;  1NTZ E;  2QM8 A;  2MD9 A;  2JP3 A;  1A02 F;  2KW2 A;  2KGD A;  1IFI A;  5AVV B;  3L72 G;  2XV5 A;  2WPT A;  1J1D C;  5AW9 B;  1ZOY C;  2M5A A;  5KP6 B;  1VF5 D;  3NMD A;  2K9Y A;  1SQV G;  2PNG A;  1P84 I;  2OAR A;  3HTK B;  3Q3D A;  4DT0 A;  2K2Q A;  1OVR A;  1M1J A;  2KOQ A;  3LW5 J;  4XFZ A;  3L73 E;  1RNI A;  1M6E X;  1FOS F;  2ZFC A;  1SQX J;  1G2C A;  3VMZ A;  4CA3 A;  2FAE A;  3CC4 P;  2P67 A;  2X2B A;  5AVR B;  2JU2 A;  2YIU B;  1EC5 A;  2GDW A;  2A06 E;  2KP8 A;  3H1J E;  2LPK A;  4O9B A;  3WUV A;  4GR6 A;  4H44 D;  3BVH A;  1WT6 A;  3AE1 C;  1AJY A;  1HY8 A;  1NOH A;  1OW7 A;  1DH3 A;  3SWK A;  4Y99 C;  2EHT A;  3H4E A;  1LP1 A;  3LMO A;  5KAF E;  3G4S P;  4IL6 E;  1HJB A;  4OGQ B;  3Q20 A;  2BCC D;  1W2E A;  1L4A A;  2E5Y A;  3L74 D;  1TU3 F;  2L91 A;  3GLM A;  1QLE D;  1YI2 P;  2FYN B;  5AVT B;  4NPF X;  3RGU A;  3C8V A;  2WMM A;  5M1B A;  3CI9 A;  3H1H E;  2LML A;  1KV4 A;  1KIL A;  3RK2 D;  2FYU J;  2YKO A;  5CCG C;  2A45 G;  1RO2 A;  3D6Y A;  2IBZ G;  1KIL D;  3H1I D;  2GUV A;  3L73 G;  1LT9 A;  3SFD C;  1JB0 J;  1KFM A;  2MR7 A;  3MZW B;  1OR5 A;  5KP8 B;  3AE9 C;  4JBZ A;  5AVZ B;  3II6 A;  3L72 D;  2IDB A;  3AE3 C;  1YTZ T;  3B5I A;  1S3J A;  2WSC J;  1LTT C;  4XFX A;  4WWI A;  1SQV D;  1E0H A;  1FZC A;  4U3F E;  4UHP B;  1LWU C;  2WPV B;  5CJ4 A;  1N7S A;  1N7L A;  2KZJ A;  5F2O A;  1VQP P;  1IMQ A;  4H13 C;  4XRQ A;  2KLU A;  4IPY A;  5AVQ B;  1OFC X;  2GM4 A;  3JCU E;  1HF9 A;  1N7S D;  5KLV G;  3A0B E;  1S1C X;  2B88 A;  3LW5 H;  3S1K A;  1HUC A;  3MTU E;  2K92 A;  2IZ1 A;  2Q6Q A;  1AVO A;  3R2P A;  3WMM 0;  2K9J A;  4UB8 H;  1J1E B;  3T97 B;  1E6J P;  3B5N B;  1M90 Q;  2EFJ A;  3H1H G;  4C7N A;  3DS3 A;  5APY A;  5AW5 B;  5AVX B;  1PEO A;  3SFE C;  5KAI E;  4L76 A;  3AEC C;  2KS1 B;  2ZYG A;  3P8M C;  2WVR A;  5H2F H;  2PEQ A;  1NTZ D;  1S4X A;  3CLQ A;  4WYM A;  1KQF B;  3AE4 C;  2KGC A;  1N86 A;  4XFY A;  2B89 A;  2YO3 A;  4HKG A;  2EIA A;  2IPP A;  4XFJ A;  3CXH H;  2E76 B;  1KYO E;  4IL6 X;  1EMV A;  5APW A;  2BCC J;  3L74 J;  3EQ2 A;  4LLH A;  5APS A;  4PWV B;  5GTI H;  4U3F G;  2JO0 A;  2IBZ D;  4PD4 E;  5GTH E;  3MGE A;  2KWL A;  1S5L H;  1PIX A;  3A0H H;  3L73 D;  5B66 E;  3ABV C;  2WZ7 A;  2ITA A;  3UIA A;  2L5G B;  5F2K A;  2MR8 A;  2VLN A;  2K93 A;  3H1I J;  2I8D A;  7CEI A;  4PV1 B;  2FFD C;  2AXT H;  1QL1 A;  3NFQ A;  3H0D A;  5I4T G;  2AVA A;  2M8L A;  1ZW0 A;  2QJY B;  2YKP A;  3NTE A;  3AEF C;  1K05 A;  3L72 J;  3G28 A;  2WSC H;  4PXH B;  4W80 A;  1NU1 G;  3TYY A;  1IFN A;  2W6A A;  5KLV D;  3M91 A;  1PP9 G;  2QG4 A;  2EG5 A;  3L75 E;  2R32 A;  1X0T A;  3JC2 2;  1JTH B;  5HGN A;  1EIA A;  3DS2 A;  2QRX A;  2WSE H;  1H89 A;  4GIF A;  3P8C D;  3V6I A;  1ZME C;  3KZI H;  1BSH A;  3H1H D;  3VTP C;  2GDY A;  3NTN A;  3MGN A;  2K94 A;  2CG5 B;  2YIU C;  2FHS C;  2LKM A;  1BCC E;  3EFF K;  2A45 I;  1KLP A;  5E79 E;  3U59 A;  2H43 A;  2K5X A;  2IBZ I; 
#chains in the Genus database with same CATH homology
 1VQK P;  2ONT A;  3G71 P;  2EIA A;  3E2D A;  1A8O A;  1ZMB A;  2P9X A;  4U0D A;  2M8P A;  1VQO P;  3CCU P;  1EOQ A;  3DS5 A;  2PY8 A;  2LF4 A;  1RO2 A;  3DPH A;  3RG6 C;  2PEM A;  1K9M Q;  4U0A A;  1A43 A;  3OW2 O;  1N8R Q;  3CCJ P;  5HGO A;  2JO0 A;  1Q7Y Q;  3CCV P;  2OTL P;  3DTJ A;  3MGE A;  3WBH A;  4PH0 A;  1IUQ A;  1RO0 A;  3DS1 A;  1S72 P;  1JJ2 O;  3LRY A;  3CCM P;  2PEN A;  3G0V A;  3H47 A;  1VQL P;  1YIT P;  2KOD A;  1K8A Q;  2OAR A;  2BHV A;  2BUO A;  5HGL A;  3CD6 P;  3B5I A;  3CCL P;  1AUM A;  2L6E A;  5F2K A;  1KD1 Q;  4XFX A;  3I56 P;  3G6E P;  1YIJ P;  3I55 P;  4M0I A;  4XFZ A;  4COP A;  1RNI A;  1M6E X;  3VRL C;  4U0F A;  2CWO A;  2QA4 P;  4XRO A;  4COC A;  3CCR P;  5F2O A;  3H0D A;  1VQP P;  1M74 A;  5I4T G;  2Z45 A;  1VQN P;  4XRQ A;  2M8L A;  2PEK A;  4IPY A;  3G1G A;  3NTE A;  2XT1 A;  1YHQ P;  2PEO A;  3CC2 P;  3CC4 P;  1Q86 Q;  3G28 A;  1VQ6 P;  2E1M A;  5HGM A;  1VQ7 P;  2DGY A;  1QVG O;  1Q82 Q;  2XXM A;  5DCK A;  1YJW P;  2OTJ P;  5BS2 A;  3CPW O;  2JYG A;  1QVF O;  1NJI Q;  2XV6 A;  5F2N A;  2EG5 A;  4GR6 A;  1VQ4 P;  3G26 A;  3CCQ P;  4QNB A;  3HZQ A;  3P05 A;  1E6J P;  2Z46 A;  5BS1 A;  1M90 Q;  3G29 A;  5HGN A;  2EFJ A;  1EIA A;  4U0B A;  1YJ9 P;  1K73 Q;  3DS2 A;  3H4E A;  4U0C A;  2Z44 A;  3DS3 A;  3G4S P;  1Q81 Q;  1VQ5 P;  5JPA A;  1KQS O;  3G21 A;  4PH1 A;  2PEI A;  1PEO A;  3CXC O;  3CMA P;  3Q20 A;  1PEQ A;  1D1D A;  2QEX P;  1PEU A;  3CC7 P;  4U0E A;  2M8N A;  3DS4 A;  3CCS P;  1W2B O;  3CCE P;  1BAJ A;  4XFY A;  1K30 A;  3M1M A;  1YI2 P;  1YJN P;  2JYL A;  4GR2 A;  1M6N A;  3G1I A;  3CME P;  3DS0 A;  2PEQ A;  1VQM P;  1VQ9 P;  2BQ1 E;  4WYM A;  1KC8 Q;  1PEM A;  1VQ8 P;  1M1K Q;  2PEJ A;  3HYB A;  1QRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...