3CMEP

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cmeP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cmeP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cmeP02
1VQMP 3CXCO 2QA4P 2QEXP 1YJ9P 3I56P 3G71P 1Q82Q 1VQ7P 1JJ2O 1VQOP 3CD6P 1M90Q 1KQSO 1KC8Q 3I55P 3G4SP 1VQLP 3CPWO 3CCUP 3CCEP 1Q86Q 3CMAP 1K73Q 3CMEP 3CC7P 1S72P 1K8AQ 3CC4P 3CCRP 3CCLP 3CCVP 1YJWP 1VQ4P 1VQ9P 1YI2P 1VQ5P 3CCJP 2OTJP 1Q7YQ 3OW2O 1N8RQ 1M1KQ 3CCMP 1VQ8P 3CCQP 1NJIQ 1QVGO 1QVFO 1YIJP 1W2BO 1VQKP 1K9MQ 1YITP 1Q81Q 3CCSP 1VQ6P 3G6EP 1YHQP 1VQNP 1VQPP 3CC2P 1KD1Q 2OTLP 1YJNP
chains in the Genus database with same CATH superfamily
1NGMB 2XZ0D 2H43A 2MVUA 2Y0EA 1GW3A 3VMXA 1G1IA 1M7LA 1NAFA 2FKWB 2J5UA 4MRTC 1SQVJ 1HJBA 2OYIB 1LWUB 1BCCG 1HTLC 1JUNA 2E75D 1JY2P 2MY5A 1NTZD 5BU8B 3EFFK 1UJZA 3RG6C 2I1JA 1LTTC 4WY4D 1KQSO 3D70A 3RL0g 1RF1C 1MZ8A 3K5BA 2QJKC 4BXLA 2Q5UA 4L73A 4M3LA 2D2CB 5AVZB 1M74A 2ROQA 1ZV8A 1BGYE 1KB9I 3DS3A 4D6TJ 3NTEA 3MUDC 3C9IA 3FWNA 5K5GB 1SQVK 2AF8A 2QIWA 3L71E 1N7SD 2E1MA 3CCVP 2KODA 1VQ5P 1X3OA 4U0AA 1EDIA 1BGYG 3SWYA 4N6JA 2YIUB 4I2LC 2BCCD 1L4AB 1U7JA 3HD7A 5KKZC 1OR5A 1SVFA 3U43A 3H1IJ 1URQC 2WSEH 1IFIA 1VQMP 1N73B 3L71G 1EIAA 5APXA 3GHGC 2K0DX 3G1IA 3SFEC 4UB6H 1AFOA 4AYCA 2P10A 2FAEA 3VN0A 1DEEG 3L36A 1NAYA 2C0XA 1J1EC 2YMYA 1VHNA 5CCGA 1NTMJ 1H0TB 1KQLA 1KB9D 5GTIE 3TDKA 4BWNA 5AVUB 1AF8A 2KI7B 3VMYA 1SFCD 3H1KE 3TNUA 2HODA 1YITP 1HUCA 2XKMA 3GF3A 4R0MA 2OTLP 3AE6C 4PJ0E 5AVWB 3FWLA 3E2DA 2PP6A 4IZ6A 2E76D 3H1KG 2CPSA 3IAOA 2EFJA 1KV4A 1OXZA 5CCHD 3MGEA 1NTMK 1S1CX 3GZLA 4H13D 1VQOP 3CD6P 1GW4A 1ZLLA 3M9HA 1GXGA 2N1TB 5CHXA 3SFDC 2GUVA 3CWBD 3M91A 2PAJA 4L76A 3HUSA 1T6AA 2IYOA 1X0TA 2VLNA 5BS2A 1M6EX 1NTKJ 1PP9D 2N6YA 1ZNVA 3CXHI 3R4YA 3DS4A 2XDJA 2X2BA 1GU4A 3S4RA 3SWFA 1KFMA 2Q6QA 2WSSH 5CCGD 1OVVA 2W6AA 1LT9C 4JF7A 3TF5A 3L75E 4GODA 2JO0A 2R5DA 1KTMA 2MVVA 2GYKA 1GK4A 4WVZA 3KPEA 2OYHB 5KLVJ 4HKGA 2W6JH 5KAFH 1PGJA 1S5LH 1A43A 2GZIA 3L75G 2BEZF 1NQ4A 2E75C 2KOSA 1NTKK 2H89C 4L74A 1BE3D 3V6IA 1A8OA 3CL3D 1GTWA 2QRXA 1NTZJ 4N78D 2WT7A 1LTJA 1NU1E 2YXQB 2GZGA 5M1BA 3T97A 1JMMA 2FFDA 3W68A 5KAIH 1R5LA 1WT6A 3P8MC 2P1JA 3E1RA 1JY2O 2EG5A 3G3ZA 2QSIA 5AVQB 2JP3A 2XV5A 3PLNA 2ITAA 4DT0A 1NU1G 3DTJA 2E43A 2E42A 3RK2C 2BQ1E 4I7ZB 1YJNP 1SQXE 2M5AA 1LTSC 1JJ2O 1ZMEC 2KGDA 1L4AD 1WMKA 1NTZK 4OGQC 3L74J 2YO3A 2KR5A 1SQXG 3IN6A 1KD1Q 3B5NB 1FZCA 1Z6MA 4C7NB 2L9FA 1OW7A 1PEUA 4DG9A 4Y99C 5B66E 1X79B 1W2BO 2YNYA 4PV1D 2YKOA 1VQ6P 4XE5B 3IR9A 1NKZB 5BU5A 4PD4H 5AW7B 3AEGC 2FQ1A 1HGVA 3EJBA 1RF1A 5AVTB 2BCCE 1FJKA 2O01H 1Q81Q 3G6EP 3CX5H 2KG6A 2LPKA 2E76C 2PEJA 2AEJA 1M1JC 2Z5IA 1NH4A 2XXMA 5B5EE 1IFJA 5CCHC 1SQPD 5H2FE 1M56D 1CZQA 2FXOA 5E79E 1SQVD 2PGDA 2FADA 3MHVA 2PFXA 2GDXA 2K2QA 2N1TD 1URQA 1KORA 3CXCO 2QA4P 1IFPA 3SSUA 3CWBJ 5AW9B 2KUBA 4XA4A 4WY4B 2KLUA 2UWJE 5KJ7D 2R3SA 5KP8B 1PP9J 4H44B 1QVFO 2HPCA 3TGUD 2G3AA 2M8LA 4D6TD 4ASVA 3JCUH 1Y47A 3CI9A 1S5LX 1E79H 2KOOA 3AE5C 3CCRP 3HTKA 3KDPB 2OTJP 1L0LD 1MV8A 3H1LE 5HV8A 3EQ2A 1N7SB 1K9MQ 2OYIC 1LWUC 4GOEA 4KT0J 1IMPA 1E5WA 5F2KA 3L37A 4N3YB 2JB0A 3U1AA 1MZ9A 2QVAA 2XNXA 3Q5RA 3CMEP 1ZP0C 1PGPA 3H1LG 1SQQE 2M3BA 2ZYAA 1QVGO 1AUMA 2JDIH 2FYUD 2C0WA 2D2CC 1Q2NA 2KG8A 3EWKA 5CMZA 1GMJA 3H1JE 5APSA 1PPJD 1NTMD 1SQQG 4QMAA 1DX7A 3VTPC 1FZFA 3CCLP 4A7PA 3ITKA 1LNQA 2OQQA 3B5IA 4O9BA 2JR8A 2VLQA 1QGKB 3H1JG 3BRTB 1L4AC 1AYIA 3AEDC 1SFCB 1RE4A 3MGNA 3QWOC 1GL2A 1N73C 2AXCA 1BE3E 3KQGA 1KILD 3KYQA 1KYOI 1JY2N 4EYYQ 3AECC 3M0DC 3A0BH 3L73E 3B5ND 3R2PA 3HE4A 4XROA 1EDKA 2POHA 1R5SA 3L72D 2WPTA 1BE3G 4U0FA 3CXHE 3G4SP 3HD7B 1MFZA 1W2EA 4DOJA 4H13B 3L73G 1R8EA 3N4XA 3HE5B 2E74B 1X8YA 2K1AA 4IL6X 2JJLA 1NTKD 5APYA 2IX7C 1HBWA 2H8PD 3A0HH 2HR3A 5TISH 1T8KA 4JQ0D 3GG2A 1DH3A 2MKVA 1HH0A 2W90A 5EFWB 3L35A 2C9NY 2KXPB 5DCKA 3LMOA 2ZXEB 2L5GB 3L70E 1RO0A 3C8VA 2KG9A 1ZR4A 1Q82Q 2KNCA 5KLVD 1LTAC 4BPFA 3CCEP 2JYLA 2EHTA 3LRYA 1SQPJ 2HODB 4MN4C 3RK3D 1CI6A 2N1TC 1HF9A 4PD4D 3OA7A 2ERHA 4YXWH 1DNYA 1JCCA 1PEQA 3L70G 1BSNA 4PH1A 4GOFA 1BGYJ 3OJAB 4U0EA 2KYVA 3EJDA 1VQPP 1WRGA 3RL0B 4PXHB 2NPSA 3AE8C 1RE3A 5KJ7C 1EXIA 1S9KE 2KB7P 3CX5D 4H44D 2ONTA 1ZRTE 5JPAA 3Q5SA 1LTGC 1H8AA 5HGNA 3U59A 3JSVC 1YIJP 2KP8A 3TGUJ 2WMMA 2PEIA 1S4XA 4U3FD 2K93A 3H32A 2JWDA 2QEXP 1SQPK 2OYHC 1FDMA 1K73Q 2I8DA 5APUA 2IFMA 4K35A 2JKVA 1FAVA 4BPHA 1SQVE 4IFMA 1L0LJ 2A06E 1LT1A 4I6MC 4JPZB 1JY3P 3L74D 2NZ2A 1DEBA 2QJPC 1KZUB 1AV1A 2JGPA 1PZQA 2ZAEB 1DD4A 2KOGA 3B4QA 3WUTA 4U0DA 1VPCA 2K9JA 3RBZA 2N5IA 1SQVG 1M6NA 3CMAP 1J2JB 2A06G 5AW2B 1AA0A 3M9QA 2LKMA 1MFTA 2ZFCA 3WUUA 4M0IA 1L0NJ 2DGYA 3I5CA 1SQBD 3PH0A 2FYUJ 1EDLA 4AQRD 2MD9A 4W7YA 1PEMA 4PV1B 4I7ZC 1L0LK 3H6PA 1N7LA 2IZ1A 5HGOA 4JBZA 1FBMA 2YKQA 2WT7B 3DS5A 1U7MA 1FS0E 1VQ8P 3H1IE 2B87A 3T97B 1KQFB 1OWAA 1YHQP 3O6QA 1IO4A 5TJHA 4W80A 3DS1A 2Z44A 1G2CA 2A45G 2K9YA 4EI2A 2VRSA 2O01N 2Q7CA 3RGUA 1HQBA 2PRRA 1L0NK 3B5NC 3WBHA 3H1IG 4GR6A 2FYUK 5HVCA 1Q7YQ 1RH5B 3P8CE 4XRQA 3CCMP 2M5AB 4GR2A 1K05A 1JOCA 4KJMA 4WBAA 1LWUA 3HD7D 3L72J 2ZXXA 2M8RA 4GDOA 4AUWA 1EOQA 1MUUA 2ZT9D 3GLMA 1GD2E 2RH0A 2LOLA 4RKUJ 1K8AQ 2E74D 5KAFE 1K30A 3DPHA 4OVNF 2WTYA 1UNKA 2KSJA 1BSHA 1SLQA 1P84E 2PENA 1VQNP 3LIEA 2GZEA 1QRJA 5GTIH 4PWVB 1ZW0A 1AQTA 2LKIA 1GDTA 2XZRA 3Q2YA 2K92A 1YQ3C 5AW1B 3VOPA 4UHPB 1FU1A 4PJ0H 3H47A 2KWLA 1EQ7A 2OGUA 3BCCE 4JYBA 2KSEA 5HGLA 4COPA 4DJGA 2LXBA 3EJEA 1N73A 4NPEA 3RL0D 1NTKE 2QJPB 1NOHA 1EZVI 3H1HD 3FXEA 4CPGA 4XFJA 4DZOA 3BCCG 4WY4C 1HGZA 4H44C 2CNRA 2FY8A 1EC5A 2YXRB 2O01J 1IZNB 1L2PA 1RF0C 1T8ZA 1CEIA 1NTKG 5APWA 3VP8A 2KOQA 3JC22 1KYOE 1DV5A 5KLVK 1QX8A 5AVYB 4U3FJ 1J1DB 3H25A 1N7SC 4RJTA 1QLED 1OVRA 3BATA 4COCA 2JU2A 3LIDA 2M0BA 2Q1KA 3AE2C 1BDCA 1IK9A 1LP1A 2MJZA 2CG5B 3QH9A 1KILB 3KXDA 1NTZE 1QEXA 4YXDC 3WMM0 4IL6E 2P7JA 2LF4A 1FOSE 1EZVD 2M8NA 1MKMA 2DNWA 1D7MA 1JY3O 2N9BA 1DIPA 1BXIA 2VSQA 2Z5HA 4IOIH 1NTZG 3P7KA 1SQBJ 3TYYA 1PFIA 3NY7B 2WSCJ 4RO0A 1BCCD 2RKLA 5I4TG 3A3YB 1N86A 2K3RA 2KK7A 2YO2A 1VQLP 2H7HA 4OWFA 1SFCC 4U0CA 1T3JA 3UIAA 1L0HA 3MIWA 3V4QA 2IPPA 4QKOA 4TT3H 5AVXB 1GZLA 2GM4A 1JMBA 2AVAA 2MR8A 1YYCA 2FQ0A 3G26A 1VQ7P 2W8ZA 3MUDA 1JO5A 3CCUP 2BCCG 2R32A 3ABVC 5F2NA 3CC7P 1SQBK 3JCUE 3IF4A 3NXSA 3HD7C 2AFEA 2O3JA 4H13C 2JYGA 3RK3B 2YKPA 1GL2B 2DW3A 2PY8A 4KHXA 1BGYD 2E74C 4LC1A 1KB9E 1PGQA 2WVRA 2B9BA 1FZBA 3NFQA 3GHGA 2P67A 1T2KD 5B66H 2KZJA 2OTKE 5CBNA 3HE4B 4UB8E 3AE9C 5GTHH 2AXTE 4WYMA 1EXJA 5CCGC 2W6BA 1A02F 1YTZI 2Q9IA 3Q1MA 2WZ7A 2WSCH 2LXCB 3AE4C 2XV6A 2FVEA 2KGAA 1PV3A 2EIAA 1NKNA 3M06A 4GIFA 2Y9YA 3CE7A 2Q3EA 3CWBE 5H2FH 3RL0C 5E79H 3CPWO 3LW5J 1FZEA 2N50A 1JM0A 1K04A 1PP9E 3KZIE 3PP5A 3H1HJ 2KGEA 2KNCB 1L0ND 2W27A 3H1KD 3CWBG 3Q5PA 2CWOA 4EDFA 1YJ9P 3I56P 2AEMA 4EOTA 1AQ5A 1URQD 2KS1A 3WU2E 1PIXA 1PP9G 4XFZA 4PH0A 1U57A 2IBZI 1AVOA 2NPSB 2XU6A 2R5BA 3V2QA 4L75A 2IDBA 4ASWA 4GT1A 1S3JA 1ZR2A 1W5CE 1PGOA 3F89A 1NO4A 3E7KA 2BEQD 1VKUA 1S72P 3BVHA 1E0HA 1VQ9P 4IPYA 1LT9A 3H32B 3II6A 5CZDB 2L4BA 2JWAA 4N78E 2LR2A 4QNBA 3PJSK 5CBOA 4PD4I 1JTHA 4PV1C 3N7NA 3P05A 4NEOA 1VQ4P 2ZT9B 3L75D 2K5XA 4WY4A 2XNDH 3LW5H 1BCCJ 1YQ4C 2FHSC 2IBZD 3CX5I 2QJYB 3L70J 1FR2A 2WITA 2B88A 3FGAD 3GKLC 1JY3N 2M3EA 3G21A 3CCJP 1IFDA 2P2UA 1M57D 1OW6A 5KLIB 3AE7C 2FQ2A 2KLVA 1FE6A 1EZVE 1LJ2A 2CK3H 4WWIA 2Z4EA 3AEBC 1USEA 1N7SA 3H4EA 1OMIA 1NVOA 2WSFJ 3TNUB 3PTZA 1GL2D 2BUOA 1AVYA 1EZVG 3CXHH 4C7RA 1T2KC 3MD0A 3D71A 1SQXD 2ZYDA 1FZCC 1KFNA 3L71J 2HYNA 3PHLA 2QM7A 4HYTB 1NWQA 1UIIA 1OW8A 3U1CA 2M8PA 1ZN5A 4UB6E 2Y0DA 4IFDK 3IFMA 5CJ4A 1AJYA 2LIUA 3DS2A 2O1KA 3HUSB 4U0BA 3BRVB 1ZMBA 2IYPA 1G1JA 1VF5B 1SQPE 1KN7A 1SFCA 2N5HA 1YJWP 3F5HA 2R44A 3FXDA 2LL8A 2JU1A 4GKGA 1HWTC 3V2NA 1X9VA 1SQPG 3TK1A 3G71P 4F37A 2FYNB 1M1JA 3MZWB 3RK2D 1ZXGA 3VYIA 3G0VA 3GMAA 1IK7A 3M1MA 5CCHA 1VDFA 3NMDA 3TGUE 3H1KJ 4D6TE 2GUSA 2AEFA 3PRJA 4OGQD 3V2RA 3ZDMA 2WSFH 3HE5A 2G8YA 2XZ1C 1J1DC 2IZ0A 3A2AA 2NPSD 4H2WC 3HZQA 3TGUG 1L0LE 1GPJA 2MR7A 4D6TG 1LTJB 3V4WA 4YPCA 1Q90D 1F80D 2FFDB 2C9LY 4NPDA 1SP4A 1KILC 3M0AA 2MF4A 5HGMA 1ZOYC 1YTZT 4BRYA 1QL2A 1L0LG 2K94A 3AE3C 4Z1MH 2VLOA 2L6EA 1L0NE 1FDOA 2WPRA 2WPSA 2NRGA 2KW2A 1NJIQ 2FYUE 4HJGH 4H0LB 2K0YA 5AW0B 3RG2A 2PNGA 2OYIA 2SPZA 2AFDA 1DD3A 1PPJE 4TLFA 2PEOA 1NTME 2KOPA 1CSBA 1LP1B 2N98A 3V5BA 5DJUB 1L0NG 1KQGB 1S5LE 2FYUG 3GW6A 1N8RQ 3L75J 3BASA 2KIKA 3EFGA 2Q3IA 2K37A 2Z46A 1PPJG 2FXMA 3AEEC 3H1LD 4HH2A 1OFCX 1NTMG 1FZCB 2HG5D 2A45H 5C39A 3BCCJ 5DJTB 1KILE 2QNWA 5KTBA 1Q86Q 1FC2C 1FZGA 3HRNA 2QG4A 2QE7H 2H88C 2NO8A 1OIPA 3S1KA 1IC2A 1SQQD 5KAIE 1A02J 3L72E 1Y8AA 2J58A 3CLQA 1RF1B 4JYCA 2E5TA 1RE4C 3RK3C 1L4AA 1NU1J 2QJKB 1GL2C 2JBGA 1XTCC 3H1JD 3B71A 1Y9BA 1IFNA 1RY3A 2OARA 3L72G 3M0DA 2WPVB 2FACA 1VQKP 3DS0A 2IBZE 1FDIA 2GDYA 3G28A 3NTNA 3H0DA 1SQXJ 3I55P 1TU3F 5AW6B 1HJ0A 2M5RA 2JAZA 2L22A 1P84H 5KKZB 4NPFX 5AW8B 4K3AA 2JQ4A 1URQB 2IBZG 1H0TA 3MP7B 1NU1K 3GHGB 3L73D 2K0XA 3GZMA 5APVA 1VF5D 5KLVE 4XFXA 4CA3A 2Z45A 5AW3B 4H2YC 2D2CD 1RNIA 3CXHD 2RMZA 3RK3E 2ZYGA 1IMQA 5KP7B 3B4SA 4PD4E 2HPCB 1YI2P 1S2EA 2PEMA 4U7JA 3CCQP 5KLVG 1J1EB 2Y9ZA 1SQXK 3VP9A 1GK6A 5BVZA 1H88A 1GXHA 1PL5A 3HTKB 2GA1A 2KZIA 3WUVA 1EDJA 1PEOA 1UIXA 3CX5E 4C46A 3GF7A 2I1KA 5CJ0A 2VLPA 2XT1A 5F2OA 2LTEA 4R4LA 1BDDA 2BCCJ 2N1TA 3D6ZA 2EHSA 4U3FE 2NPSC 1N2DC 3OAKA 4Y28J 1RE3C 1RO2A 3S9OA 3L70D 7CEIA 3AEAC 1USDA 2FVAA 5KJ7A 1KYOH 4HB1A 2BHVA 4U3FG 3L74E 2WPQA 1GU5A 2KS1B 4LLHA 3L4FA 5GTHE 1RHZB 4R4MA 3O8ZA 3A7OA 4ZKPA 5EJDA 2OYHA 3AE1C 3L74G 5AW4B 1JEKA 1S9KD 2R3CA 4H0LD 2JEEA 1SQBE 1IUQA 4IL6H 1ZRTD 2WWWA 3D6YA 1KMIZ 2KGCA 2ZT9C 2P9XA 1FZAA 5APTA 2A45I 2FVFA 1LT9B 1M90Q 2LMLA 3AEFC 1RQVA 2QJYC 2V7QJ 1Z56A 3VMZA 1SQBG 2GZJA 1BAJA 3L71D 5AVSB 4ZMDA 2A06D 3H1LJ 3M9BA 1JTHB 3VRLC 2V4HA 2HFED 5KLIC 5EW5E 2E75B 1LTBC 1KC8Q 1D1DA 1JNMA 2WQYC 1HVVA 5BS1A 4OH8B 3V2PA 1M1KQ 1SQQJ 5AW5B 1IFMA 1RQUA 2PEKA 5L8RJ 5B5EH 2ZVNB 1KILA 3H1JJ 1LTIC 3B8EB 2OYOA 3Q20A 2N9YB 1P84I 5AVVB 3B5NA 4LGDE 2FXPA 3RK2B 2GZFA 1KB9H 2CQ8A 3CCSP 1NHLA 1OX3A 4C7NA 3H1ID 1HY8A 3CC2P 1YBKA 1CW5A 3A0BE 1FJPA 2CPBA 1CI6B 2GDWA 4UB8H 3HUSC 2YMKA 4OGQB 1SQQK 3G9RA 1BE3J 3W67A 1LGHB 1FOSF 2AXTH 2KORA 1VF5C 2N6ZA 3P8CD 1E6JP 3USSA 3L73J 2Y0CA 2V7QH 2BASA 1H89A 1NYHA 2IFNA 2FBWC 3FX0A 1ACPA 2P58A 4WB4A 4Y99B 2FYNC 3A0HE 3H1HE 5TISE 4HKZH 3E1IA 2CGQA 2JO1A 2ZVOB 2O1JA 1X22A 2YIUC 1P84D 4RESB 4W7ZA 4H2XC 3C1LA 2LIWA 1IJDB 3KHUA 1SS1A 3KZIH 3G1GA 4YTPC 2E5YA 3GJNA 5AVRB 3H1HG 3CC4P 3OW2O 2E76B 2B89A 1M1JB 2W83C 2K9JB 1LTJC 4I1LA 3WU2H 4ZKUA 2ZJSE 2FFDC 5KP6B 1XTGB 3BCCD 2K88A 3SWKA 4XFYA 4BPGA 3TSIA 1EMVA 2PEQA 2J59M 5APQA 1RF0A 2L91A 2QM8A 1OZHA 3HYBA 1OVUA 3P32A 3RBXA 3VMAA 1JB0J 4IFFA 1JCDA 1VL2A 1M8OB 3G29A 4DCKA 4H0LC 4EIJA 1KLPA 1QL1A 1NU1D 2WSEJ 2RN0A 2HLOA 4B86A 2B87B 3A5TA 3O6QB 2FYZA 1T3UA 2L0QA 4BRYB 4ZNCA 1G2CB 3Q3DA 1KYOD 1BCCE 3MTUE 1L0IA
chains in the Genus database with same CATH topology
4U0BA 2PEOA 4U0DA 1M90Q 1A43A 1ZMBA 2Z45A 1M6NA 1RNIA 3CMAP 3CMEP 2M8NA 5F2KA 1BAJA 3P05A 1YJWP 1VQ4P 1YI2P 1N8RQ 2PEMA 4M0IA 2XV6A 1QRJA 2DGYA 3CCQP 1A8OA 1QVGO 1AUMA 5DCKA 2Z46A 1YITP 1Q81Q 3H47A 3G6EP 2EIAA 3VRLC 2OTLP 1RO0A 3RG6C 2PEJA 3E2DA 5HGLA 4COPA 3G71P 1Q82Q 5I4TG 1PEMA 1PEOA 1KQSO 1KC8Q 1D1DA 2XXMA 3CPWO 1VQLP 3CCEP 3G1GA 1Q86Q 2JYLA 3LRYA 3G0VA 4U0CA 2XT1A 5F2OA 3M1MA 5HGOA 5BS1A 3CC4P 3CCLP 3G21A 3CCJP 2EG5A 3DS5A 3OW2O 3B5IA 1M1KQ 1VQ8P 1PEQA 1M74A 2EFJA 3DTJA 4PH1A 3DS3A 1YHQP 4U0EA 3MGEA 1VQPP 2BQ1E 2PEKA 1YJNP 2CWOA 3NTEA 1RO2A 3CXCO 2QA4P 3DS1A 1YJ9P 3I56P 3G26A 1VQ7P 3H4EA 2Z44A 1JJ2O 1VQOP 3CD6P 4XFYA 3CCUP 5F2NA 3CC7P 3Q20A 4XFZA 2E1MA 3HZQA 3CCVP 2ONTA 2PEQA 2KODA 3WBHA 5JPAA 1VQ5P 4PH0A 4GR6A 4U0AA 1Q7YQ 2BHVA 3HYBA 2BUOA 4XRQA 5BS2A 5HGNA 2OARA 3CCMP 1M6EX 4GR2A 1QVFO 1YIJP 1VQKP 3DS0A 2JYGA 3CCSP 4XROA 3G28A 2PEIA 2PY8A 2M8LA 1KD1Q 3CC2P 3DS4A 1VQMP 1EIAA 3G29A 3H0DA 2QEXP 5HGMA 4U0FA 1EOQA 4COCA 3I55P 3G4SP 1K73Q 3G1IA 1S72P 1K8AQ 3CCRP 4XFXA 1VQ9P 1K30A 2L6EA 2OTJP 3DPHA 4IPYA 1PEUA 1IUQA 2M8PA 1NJIQ 2JO0A 1W2BO 2PENA 1E6JP 1K9MQ 4QNBA 1VQ6P 4WYMA 1VQNP 2LF4A 2P9XA 3DS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM P;  3CXC O;  2QA4 P;  2QEX P;  1YJ9 P;  3I56 P;  3G71 P;  1Q82 Q;  1VQ7 P;  1JJ2 O;  1VQO P;  3CD6 P;  1M90 Q;  1KQS O;  1KC8 Q;  3I55 P;  3G4S P;  1VQL P;  3CPW O;  3CCU P;  3CCE P;  1Q86 Q;  3CMA P;  1K73 Q;  3CME P;  3CC7 P;  1S72 P;  1K8A Q;  3CC4 P;  3CCR P;  3CCL P;  3CCV P;  1YJW P;  1VQ4 P;  1VQ9 P;  1YI2 P;  1VQ5 P;  3CCJ P;  2OTJ P;  1Q7Y Q;  3OW2 O;  1N8R Q;  1M1K Q;  3CCM P;  1VQ8 P;  3CCQ P;  1NJI Q;  1QVG O;  1QVF O;  1YIJ P;  1W2B O;  1VQK P;  1K9M Q;  1YIT P;  1Q81 Q;  3CCS P;  1VQ6 P;  3G6E P;  1YHQ P;  1VQN P;  1VQP P;  3CC2 P;  1KD1 Q;  2OTL P;  1YJN P; 
#chains in the Genus database with same CATH topology
 1NGM B;  2XZ0 D;  2H43 A;  2MVU A;  2Y0E A;  1GW3 A;  3VMX A;  1G1I A;  1M7L A;  1NAF A;  2FKW B;  2J5U A;  4MRT C;  1SQV J;  1HJB A;  2OYI B;  1LWU B;  1BCC G;  1HTL C;  1JUN A;  2E75 D;  1JY2 P;  2MY5 A;  1NTZ D;  5BU8 B;  3EFF K;  1UJZ A;  3RG6 C;  2I1J A;  1LTT C;  4WY4 D;  1KQS O;  3D70 A;  3RL0 g;  1RF1 C;  1MZ8 A;  3K5B A;  2QJK C;  4BXL A;  2Q5U A;  4L73 A;  4M3L A;  2D2C B;  5AVZ B;  1M74 A;  2ROQ A;  1ZV8 A;  1BGY E;  1KB9 I;  3DS3 A;  4D6T J;  3NTE A;  3MUD C;  3C9I A;  3FWN A;  5K5G B;  1SQV K;  2AF8 A;  2QIW A;  3L71 E;  1N7S D;  2E1M A;  3CCV P;  2KOD A;  1VQ5 P;  1X3O A;  4U0A A;  1EDI A;  1BGY G;  3SWY A;  4N6J A;  2YIU B;  4I2L C;  2BCC D;  1L4A B;  1U7J A;  3HD7 A;  5KKZ C;  1OR5 A;  1SVF A;  3U43 A;  3H1I J;  1URQ C;  2WSE H;  1IFI A;  1VQM P;  1N73 B;  3L71 G;  1EIA A;  5APX A;  3GHG C;  2K0D X;  3G1I A;  3SFE C;  4UB6 H;  1AFO A;  4AYC A;  2P10 A;  2FAE A;  3VN0 A;  1DEE G;  3L36 A;  1NAY A;  2C0X A;  1J1E C;  2YMY A;  1VHN A;  5CCG A;  1NTM J;  1H0T B;  1KQL A;  1KB9 D;  5GTI E;  3TDK A;  4BWN A;  5AVU B;  1AF8 A;  2KI7 B;  3VMY A;  1SFC D;  3H1K E;  3TNU A;  2HOD A;  1YIT P;  1HUC A;  2XKM A;  3GF3 A;  4R0M A;  2OTL P;  3AE6 C;  4PJ0 E;  5AVW B;  3FWL A;  3E2D A;  2PP6 A;  4IZ6 A;  2E76 D;  3H1K G;  2CPS A;  3IAO A;  2EFJ A;  1KV4 A;  1OXZ A;  5CCH D;  3MGE A;  1NTM K;  1S1C X;  3GZL A;  4H13 D;  1VQO P;  3CD6 P;  1GW4 A;  1ZLL A;  3M9H A;  1GXG A;  2N1T B;  5CHX A;  3SFD C;  2GUV A;  3CWB D;  3M91 A;  2PAJ A;  4L76 A;  3HUS A;  1T6A A;  2IYO A;  1X0T A;  2VLN A;  5BS2 A;  1M6E X;  1NTK J;  1PP9 D;  2N6Y A;  1ZNV A;  3CXH I;  3R4Y A;  3DS4 A;  2XDJ A;  2X2B A;  1GU4 A;  3S4R A;  3SWF A;  1KFM A;  2Q6Q A;  2WSS H;  5CCG D;  1OVV A;  2W6A A;  1LT9 C;  4JF7 A;  3TF5 A;  3L75 E;  4GOD A;  2JO0 A;  2R5D A;  1KTM A;  2MVV A;  2GYK A;  1GK4 A;  4WVZ A;  3KPE A;  2OYH B;  5KLV J;  4HKG A;  2W6J H;  5KAF H;  1PGJ A;  1S5L H;  1A43 A;  2GZI A;  3L75 G;  2BEZ F;  1NQ4 A;  2E75 C;  2KOS A;  1NTK K;  2H89 C;  4L74 A;  1BE3 D;  3V6I A;  1A8O A;  3CL3 D;  1GTW A;  2QRX A;  1NTZ J;  4N78 D;  2WT7 A;  1LTJ A;  1NU1 E;  2YXQ B;  2GZG A;  5M1B A;  3T97 A;  1JMM A;  2FFD A;  3W68 A;  5KAI H;  1R5L A;  1WT6 A;  3P8M C;  2P1J A;  3E1R A;  1JY2 O;  2EG5 A;  3G3Z A;  2QSI A;  5AVQ B;  2JP3 A;  2XV5 A;  3PLN A;  2ITA A;  4DT0 A;  1NU1 G;  3DTJ A;  2E43 A;  2E42 A;  3RK2 C;  2BQ1 E;  4I7Z B;  1YJN P;  1SQX E;  2M5A A;  1LTS C;  1JJ2 O;  1ZME C;  2KGD A;  1L4A D;  1WMK A;  1NTZ K;  4OGQ C;  3L74 J;  2YO3 A;  2KR5 A;  1SQX G;  3IN6 A;  1KD1 Q;  3B5N B;  1FZC A;  1Z6M A;  4C7N B;  2L9F A;  1OW7 A;  1PEU A;  4DG9 A;  4Y99 C;  5B66 E;  1X79 B;  1W2B O;  2YNY A;  4PV1 D;  2YKO A;  1VQ6 P;  4XE5 B;  3IR9 A;  1NKZ B;  5BU5 A;  4PD4 H;  5AW7 B;  3AEG C;  2FQ1 A;  1HGV A;  3EJB A;  1RF1 A;  5AVT B;  2BCC E;  1FJK A;  2O01 H;  1Q81 Q;  3G6E P;  3CX5 H;  2KG6 A;  2LPK A;  2E76 C;  2PEJ A;  2AEJ A;  1M1J C;  2Z5I A;  1NH4 A;  2XXM A;  5B5E E;  1IFJ A;  5CCH C;  1SQP D;  5H2F E;  1M56 D;  1CZQ A;  2FXO A;  5E79 E;  1SQV D;  2PGD A;  2FAD A;  3MHV A;  2PFX A;  2GDX A;  2K2Q A;  2N1T D;  1URQ A;  1KOR A;  3CXC O;  2QA4 P;  1IFP A;  3SSU A;  3CWB J;  5AW9 B;  2KUB A;  4XA4 A;  4WY4 B;  2KLU A;  2UWJ E;  5KJ7 D;  2R3S A;  5KP8 B;  1PP9 J;  4H44 B;  1QVF O;  2HPC A;  3TGU D;  2G3A A;  2M8L A;  4D6T D;  4ASV A;  3JCU H;  1Y47 A;  3CI9 A;  1S5L X;  1E79 H;  2KOO A;  3AE5 C;  3CCR P;  3HTK A;  3KDP B;  2OTJ P;  1L0L D;  1MV8 A;  3H1L E;  5HV8 A;  3EQ2 A;  1N7S B;  1K9M Q;  2OYI C;  1LWU C;  4GOE A;  4KT0 J;  1IMP A;  1E5W A;  5F2K A;  3L37 A;  4N3Y B;  2JB0 A;  3U1A A;  1MZ9 A;  2QVA A;  2XNX A;  3Q5R A;  3CME P;  1ZP0 C;  1PGP A;  3H1L G;  1SQQ E;  2M3B A;  2ZYA A;  1QVG O;  1AUM A;  2JDI H;  2FYU D;  2C0W A;  2D2C C;  1Q2N A;  2KG8 A;  3EWK A;  5CMZ A;  1GMJ A;  3H1J E;  5APS A;  1PPJ D;  1NTM D;  1SQQ G;  4QMA A;  1DX7 A;  3VTP C;  1FZF A;  3CCL P;  4A7P A;  3ITK A;  1LNQ A;  2OQQ A;  3B5I A;  4O9B A;  2JR8 A;  2VLQ A;  1QGK B;  3H1J G;  3BRT B;  1L4A C;  1AYI A;  3AED C;  1SFC B;  1RE4 A;  3MGN A;  3QWO C;  1GL2 A;  1N73 C;  2AXC A;  1BE3 E;  3KQG A;  1KIL D;  3KYQ A;  1KYO I;  1JY2 N;  4EYY Q;  3AEC C;  3M0D C;  3A0B H;  3L73 E;  3B5N D;  3R2P A;  3HE4 A;  4XRO A;  1EDK A;  2POH A;  1R5S A;  3L72 D;  2WPT A;  1BE3 G;  4U0F A;  3CXH E;  3G4S P;  3HD7 B;  1MFZ A;  1W2E A;  4DOJ A;  4H13 B;  3L73 G;  1R8E A;  3N4X A;  3HE5 B;  2E74 B;  1X8Y A;  2K1A A;  4IL6 X;  2JJL A;  1NTK D;  5APY A;  2IX7 C;  1HBW A;  2H8P D;  3A0H H;  2HR3 A;  5TIS H;  1T8K A;  4JQ0 D;  3GG2 A;  1DH3 A;  2MKV A;  1HH0 A;  2W90 A;  5EFW B;  3L35 A;  2C9N Y;  2KXP B;  5DCK A;  3LMO A;  2ZXE B;  2L5G B;  3L70 E;  1RO0 A;  3C8V A;  2KG9 A;  1ZR4 A;  1Q82 Q;  2KNC A;  5KLV D;  1LTA C;  4BPF A;  3CCE P;  2JYL A;  2EHT A;  3LRY A;  1SQP J;  2HOD B;  4MN4 C;  3RK3 D;  1CI6 A;  2N1T C;  1HF9 A;  4PD4 D;  3OA7 A;  2ERH A;  4YXW H;  1DNY A;  1JCC A;  1PEQ A;  3L70 G;  1BSN A;  4PH1 A;  4GOF A;  1BGY J;  3OJA B;  4U0E A;  2KYV A;  3EJD A;  1VQP P;  1WRG A;  3RL0 B;  4PXH B;  2NPS A;  3AE8 C;  1RE3 A;  5KJ7 C;  1EXI A;  1S9K E;  2KB7 P;  3CX5 D;  4H44 D;  2ONT A;  1ZRT E;  5JPA A;  3Q5S A;  1LTG C;  1H8A A;  5HGN A;  3U59 A;  3JSV C;  1YIJ P;  2KP8 A;  3TGU J;  2WMM A;  2PEI A;  1S4X A;  4U3F D;  2K93 A;  3H32 A;  2JWD A;  2QEX P;  1SQP K;  2OYH C;  1FDM A;  1K73 Q;  2I8D A;  5APU A;  2IFM A;  4K35 A;  2JKV A;  1FAV A;  4BPH A;  1SQV E;  4IFM A;  1L0L J;  2A06 E;  1LT1 A;  4I6M C;  4JPZ B;  1JY3 P;  3L74 D;  2NZ2 A;  1DEB A;  2QJP C;  1KZU B;  1AV1 A;  2JGP A;  1PZQ A;  2ZAE B;  1DD4 A;  2KOG A;  3B4Q A;  3WUT A;  4U0D A;  1VPC A;  2K9J A;  3RBZ A;  2N5I A;  1SQV G;  1M6N A;  3CMA P;  1J2J B;  2A06 G;  5AW2 B;  1AA0 A;  3M9Q A;  2LKM A;  1MFT A;  2ZFC A;  3WUU A;  4M0I A;  1L0N J;  2DGY A;  3I5C A;  1SQB D;  3PH0 A;  2FYU J;  1EDL A;  4AQR D;  2MD9 A;  4W7Y A;  1PEM A;  4PV1 B;  4I7Z C;  1L0L K;  3H6P A;  1N7L A;  2IZ1 A;  5HGO A;  4JBZ A;  1FBM A;  2YKQ A;  2WT7 B;  3DS5 A;  1U7M A;  1FS0 E;  1VQ8 P;  3H1I E;  2B87 A;  3T97 B;  1KQF B;  1OWA A;  1YHQ P;  3O6Q A;  1IO4 A;  5TJH A;  4W80 A;  3DS1 A;  2Z44 A;  1G2C A;  2A45 G;  2K9Y A;  4EI2 A;  2VRS A;  2O01 N;  2Q7C A;  3RGU A;  1HQB A;  2PRR A;  1L0N K;  3B5N C;  3WBH A;  3H1I G;  4GR6 A;  2FYU K;  5HVC A;  1Q7Y Q;  1RH5 B;  3P8C E;  4XRQ A;  3CCM P;  2M5A B;  4GR2 A;  1K05 A;  1JOC A;  4KJM A;  4WBA A;  1LWU A;  3HD7 D;  3L72 J;  2ZXX A;  2M8R A;  4GDO A;  4AUW A;  1EOQ A;  1MUU A;  2ZT9 D;  3GLM A;  1GD2 E;  2RH0 A;  2LOL A;  4RKU J;  1K8A Q;  2E74 D;  5KAF E;  1K30 A;  3DPH A;  4OVN F;  2WTY A;  1UNK A;  2KSJ A;  1BSH A;  1SLQ A;  1P84 E;  2PEN A;  1VQN P;  3LIE A;  2GZE A;  1QRJ A;  5GTI H;  4PWV B;  1ZW0 A;  1AQT A;  2LKI A;  1GDT A;  2XZR A;  3Q2Y A;  2K92 A;  1YQ3 C;  5AW1 B;  3VOP A;  4UHP B;  1FU1 A;  4PJ0 H;  3H47 A;  2KWL A;  1EQ7 A;  2OGU A;  3BCC E;  4JYB A;  2KSE A;  5HGL A;  4COP A;  4DJG A;  2LXB A;  3EJE A;  1N73 A;  4NPE A;  3RL0 D;  1NTK E;  2QJP B;  1NOH A;  1EZV I;  3H1H D;  3FXE A;  4CPG A;  4XFJ A;  4DZO A;  3BCC G;  4WY4 C;  1HGZ A;  4H44 C;  2CNR A;  2FY8 A;  1EC5 A;  2YXR B;  2O01 J;  1IZN B;  1L2P A;  1RF0 C;  1T8Z A;  1CEI A;  1NTK G;  5APW A;  3VP8 A;  2KOQ A;  3JC2 2;  1KYO E;  1DV5 A;  5KLV K;  1QX8 A;  5AVY B;  4U3F J;  1J1D B;  3H25 A;  1N7S C;  4RJT A;  1QLE D;  1OVR A;  3BAT A;  4COC A;  2JU2 A;  3LID A;  2M0B A;  2Q1K A;  3AE2 C;  1BDC A;  1IK9 A;  1LP1 A;  2MJZ A;  2CG5 B;  3QH9 A;  1KIL B;  3KXD A;  1NTZ E;  1QEX A;  4YXD C;  3WMM 0;  4IL6 E;  2P7J A;  2LF4 A;  1FOS E;  1EZV D;  2M8N A;  1MKM A;  2DNW A;  1D7M A;  1JY3 O;  2N9B A;  1DIP A;  1BXI A;  2VSQ A;  2Z5H A;  4IOI H;  1NTZ G;  3P7K A;  1SQB J;  3TYY A;  1PFI A;  3NY7 B;  2WSC J;  4RO0 A;  1BCC D;  2RKL A;  5I4T G;  3A3Y B;  1N86 A;  2K3R A;  2KK7 A;  2YO2 A;  1VQL P;  2H7H A;  4OWF A;  1SFC C;  4U0C A;  1T3J A;  3UIA A;  1L0H A;  3MIW A;  3V4Q A;  2IPP A;  4QKO A;  4TT3 H;  5AVX B;  1GZL A;  2GM4 A;  1JMB A;  2AVA A;  2MR8 A;  1YYC A;  2FQ0 A;  3G26 A;  1VQ7 P;  2W8Z A;  3MUD A;  1JO5 A;  3CCU P;  2BCC G;  2R32 A;  3ABV C;  5F2N A;  3CC7 P;  1SQB K;  3JCU E;  3IF4 A;  3NXS A;  3HD7 C;  2AFE A;  2O3J A;  4H13 C;  2JYG A;  3RK3 B;  2YKP A;  1GL2 B;  2DW3 A;  2PY8 A;  4KHX A;  1BGY D;  2E74 C;  4LC1 A;  1KB9 E;  1PGQ A;  2WVR A;  2B9B A;  1FZB A;  3NFQ A;  3GHG A;  2P67 A;  1T2K D;  5B66 H;  2KZJ A;  2OTK E;  5CBN A;  3HE4 B;  4UB8 E;  3AE9 C;  5GTH H;  2AXT E;  4WYM A;  1EXJ A;  5CCG C;  2W6B A;  1A02 F;  1YTZ I;  2Q9I A;  3Q1M A;  2WZ7 A;  2WSC H;  2LXC B;  3AE4 C;  2XV6 A;  2FVE A;  2KGA A;  1PV3 A;  2EIA A;  1NKN A;  3M06 A;  4GIF A;  2Y9Y A;  3CE7 A;  2Q3E A;  3CWB E;  5H2F H;  3RL0 C;  5E79 H;  3CPW O;  3LW5 J;  1FZE A;  2N50 A;  1JM0 A;  1K04 A;  1PP9 E;  3KZI E;  3PP5 A;  3H1H J;  2KGE A;  2KNC B;  1L0N D;  2W27 A;  3H1K D;  3CWB G;  3Q5P A;  2CWO A;  4EDF A;  1YJ9 P;  3I56 P;  2AEM A;  4EOT A;  1AQ5 A;  1URQ D;  2KS1 A;  3WU2 E;  1PIX A;  1PP9 G;  4XFZ A;  4PH0 A;  1U57 A;  2IBZ I;  1AVO A;  2NPS B;  2XU6 A;  2R5B A;  3V2Q A;  4L75 A;  2IDB A;  4ASW A;  4GT1 A;  1S3J A;  1ZR2 A;  1W5C E;  1PGO A;  3F89 A;  1NO4 A;  3E7K A;  2BEQ D;  1VKU A;  1S72 P;  3BVH A;  1E0H A;  1VQ9 P;  4IPY A;  1LT9 A;  3H32 B;  3II6 A;  5CZD B;  2L4B A;  2JWA A;  4N78 E;  2LR2 A;  4QNB A;  3PJS K;  5CBO A;  4PD4 I;  1JTH A;  4PV1 C;  3N7N A;  3P05 A;  4NEO A;  1VQ4 P;  2ZT9 B;  3L75 D;  2K5X A;  4WY4 A;  2XND H;  3LW5 H;  1BCC J;  1YQ4 C;  2FHS C;  2IBZ D;  3CX5 I;  2QJY B;  3L70 J;  1FR2 A;  2WIT A;  2B88 A;  3FGA D;  3GKL C;  1JY3 N;  2M3E A;  3G21 A;  3CCJ P;  1IFD A;  2P2U A;  1M57 D;  1OW6 A;  5KLI B;  3AE7 C;  2FQ2 A;  2KLV A;  1FE6 A;  1EZV E;  1LJ2 A;  2CK3 H;  4WWI A;  2Z4E A;  3AEB C;  1USE A;  1N7S A;  3H4E A;  1OMI A;  1NVO A;  2WSF J;  3TNU B;  3PTZ A;  1GL2 D;  2BUO A;  1AVY A;  1EZV G;  3CXH H;  4C7R A;  1T2K C;  3MD0 A;  3D71 A;  1SQX D;  2ZYD A;  1FZC C;  1KFN A;  3L71 J;  2HYN A;  3PHL A;  2QM7 A;  4HYT B;  1NWQ A;  1UII A;  1OW8 A;  3U1C A;  2M8P A;  1ZN5 A;  4UB6 E;  2Y0D A;  4IFD K;  3IFM A;  5CJ4 A;  1AJY A;  2LIU A;  3DS2 A;  2O1K A;  3HUS B;  4U0B A;  3BRV B;  1ZMB A;  2IYP A;  1G1J A;  1VF5 B;  1SQP E;  1KN7 A;  1SFC A;  2N5H A;  1YJW P;  3F5H A;  2R44 A;  3FXD A;  2LL8 A;  2JU1 A;  4GKG A;  1HWT C;  3V2N A;  1X9V A;  1SQP G;  3TK1 A;  3G71 P;  4F37 A;  2FYN B;  1M1J A;  3MZW B;  3RK2 D;  1ZXG A;  3VYI A;  3G0V A;  3GMA A;  1IK7 A;  3M1M A;  5CCH A;  1VDF A;  3NMD A;  3TGU E;  3H1K J;  4D6T E;  2GUS A;  2AEF A;  3PRJ A;  4OGQ D;  3V2R A;  3ZDM A;  2WSF H;  3HE5 A;  2G8Y A;  2XZ1 C;  1J1D C;  2IZ0 A;  3A2A A;  2NPS D;  4H2W C;  3HZQ A;  3TGU G;  1L0L E;  1GPJ A;  2MR7 A;  4D6T G;  1LTJ B;  3V4W A;  4YPC A;  1Q90 D;  1F80 D;  2FFD B;  2C9L Y;  4NPD A;  1SP4 A;  1KIL C;  3M0A A;  2MF4 A;  5HGM A;  1ZOY C;  1YTZ T;  4BRY A;  1QL2 A;  1L0L G;  2K94 A;  3AE3 C;  4Z1M H;  2VLO A;  2L6E A;  1L0N E;  1FDO A;  2WPR A;  2WPS A;  2NRG A;  2KW2 A;  1NJI Q;  2FYU E;  4HJG H;  4H0L B;  2K0Y A;  5AW0 B;  3RG2 A;  2PNG A;  2OYI A;  2SPZ A;  2AFD A;  1DD3 A;  1PPJ E;  4TLF A;  2PEO A;  1NTM E;  2KOP A;  1CSB A;  1LP1 B;  2N98 A;  3V5B A;  5DJU B;  1L0N G;  1KQG B;  1S5L E;  2FYU G;  3GW6 A;  1N8R Q;  3L75 J;  3BAS A;  2KIK A;  3EFG A;  2Q3I A;  2K37 A;  2Z46 A;  1PPJ G;  2FXM A;  3AEE C;  3H1L D;  4HH2 A;  1OFC X;  1NTM G;  1FZC B;  2HG5 D;  2A45 H;  5C39 A;  3BCC J;  5DJT B;  1KIL E;  2QNW A;  5KTB A;  1Q86 Q;  1FC2 C;  1FZG A;  3HRN A;  2QG4 A;  2QE7 H;  2H88 C;  2NO8 A;  1OIP A;  3S1K A;  1IC2 A;  1SQQ D;  5KAI E;  1A02 J;  3L72 E;  1Y8A A;  2J58 A;  3CLQ A;  1RF1 B;  4JYC A;  2E5T A;  1RE4 C;  3RK3 C;  1L4A A;  1NU1 J;  2QJK B;  1GL2 C;  2JBG A;  1XTC C;  3H1J D;  3B71 A;  1Y9B A;  1IFN A;  1RY3 A;  2OAR A;  3L72 G;  3M0D A;  2WPV B;  2FAC A;  1VQK P;  3DS0 A;  2IBZ E;  1FDI A;  2GDY A;  3G28 A;  3NTN A;  3H0D A;  1SQX J;  3I55 P;  1TU3 F;  5AW6 B;  1HJ0 A;  2M5R A;  2JAZ A;  2L22 A;  1P84 H;  5KKZ B;  4NPF X;  5AW8 B;  4K3A A;  2JQ4 A;  1URQ B;  2IBZ G;  1H0T A;  3MP7 B;  1NU1 K;  3GHG B;  3L73 D;  2K0X A;  3GZM A;  5APV A;  1VF5 D;  5KLV E;  4XFX A;  4CA3 A;  2Z45 A;  5AW3 B;  4H2Y C;  2D2C D;  1RNI A;  3CXH D;  2RMZ A;  3RK3 E;  2ZYG A;  1IMQ A;  5KP7 B;  3B4S A;  4PD4 E;  2HPC B;  1YI2 P;  1S2E A;  2PEM A;  4U7J A;  3CCQ P;  5KLV G;  1J1E B;  2Y9Z A;  1SQX K;  3VP9 A;  1GK6 A;  5BVZ A;  1H88 A;  1GXH A;  1PL5 A;  3HTK B;  2GA1 A;  2KZI A;  3WUV A;  1EDJ A;  1PEO A;  1UIX A;  3CX5 E;  4C46 A;  3GF7 A;  2I1K A;  5CJ0 A;  2VLP A;  2XT1 A;  5F2O A;  2LTE A;  4R4L A;  1BDD A;  2BCC J;  2N1T A;  3D6Z A;  2EHS A;  4U3F E;  2NPS C;  1N2D C;  3OAK A;  4Y28 J;  1RE3 C;  1RO2 A;  3S9O A;  3L70 D;  7CEI A;  3AEA C;  1USD A;  2FVA A;  5KJ7 A;  1KYO H;  4HB1 A;  2BHV A;  4U3F G;  3L74 E;  2WPQ A;  1GU5 A;  2KS1 B;  4LLH A;  3L4F A;  5GTH E;  1RHZ B;  4R4M A;  3O8Z A;  3A7O A;  4ZKP A;  5EJD A;  2OYH A;  3AE1 C;  3L74 G;  5AW4 B;  1JEK A;  1S9K D;  2R3C A;  4H0L D;  2JEE A;  1SQB E;  1IUQ A;  4IL6 H;  1ZRT D;  2WWW A;  3D6Y A;  1KMI Z;  2KGC A;  2ZT9 C;  2P9X A;  1FZA A;  5APT A;  2A45 I;  2FVF A;  1LT9 B;  1M90 Q;  2LML A;  3AEF C;  1RQV A;  2QJY C;  2V7Q J;  1Z56 A;  3VMZ A;  1SQB G;  2GZJ A;  1BAJ A;  3L71 D;  5AVS B;  4ZMD A;  2A06 D;  3H1L J;  3M9B A;  1JTH B;  3VRL C;  2V4H A;  2HFE D;  5KLI C;  5EW5 E;  2E75 B;  1LTB C;  1KC8 Q;  1D1D A;  1JNM A;  2WQY C;  1HVV A;  5BS1 A;  4OH8 B;  3V2P A;  1M1K Q;  1SQQ J;  5AW5 B;  1IFM A;  1RQU A;  2PEK A;  5L8R J;  5B5E H;  2ZVN B;  1KIL A;  3H1J J;  1LTI C;  3B8E B;  2OYO A;  3Q20 A;  2N9Y B;  1P84 I;  5AVV B;  3B5N A;  4LGD E;  2FXP A;  3RK2 B;  2GZF A;  1KB9 H;  2CQ8 A;  3CCS P;  1NHL A;  1OX3 A;  4C7N A;  3H1I D;  1HY8 A;  3CC2 P;  1YBK A;  1CW5 A;  3A0B E;  1FJP A;  2CPB A;  1CI6 B;  2GDW A;  4UB8 H;  3HUS C;  2YMK A;  4OGQ B;  1SQQ K;  3G9R A;  1BE3 J;  3W67 A;  1LGH B;  1FOS F;  2AXT H;  2KOR A;  1VF5 C;  2N6Z A;  3P8C D;  1E6J P;  3USS A;  3L73 J;  2Y0C A;  2V7Q H;  2BAS A;  1H89 A;  1NYH A;  2IFN A;  2FBW C;  3FX0 A;  1ACP A;  2P58 A;  4WB4 A;  4Y99 B;  2FYN C;  3A0H E;  3H1H E;  5TIS E;  4HKZ H;  3E1I A;  2CGQ A;  2JO1 A;  2ZVO B;  2O1J A;  1X22 A;  2YIU C;  1P84 D;  4RES B;  4W7Z A;  4H2X C;  3C1L A;  2LIW A;  1IJD B;  3KHU A;  1SS1 A;  3KZI H;  3G1G A;  4YTP C;  2E5Y A;  3GJN A;  5AVR B;  3H1H G;  3CC4 P;  3OW2 O;  2E76 B;  2B89 A;  1M1J B;  2W83 C;  2K9J B;  1LTJ C;  4I1L A;  3WU2 H;  4ZKU A;  2ZJS E;  2FFD C;  5KP6 B;  1XTG B;  3BCC D;  2K88 A;  3SWK A;  4XFY A;  4BPG A;  3TSI A;  1EMV A;  2PEQ A;  2J59 M;  5APQ A;  1RF0 A;  2L91 A;  2QM8 A;  1OZH A;  3HYB A;  1OVU A;  3P32 A;  3RBX A;  3VMA A;  1JB0 J;  4IFF A;  1JCD A;  1VL2 A;  1M8O B;  3G29 A;  4DCK A;  4H0L C;  4EIJ A;  1KLP A;  1QL1 A;  1NU1 D;  2WSE J;  2RN0 A;  2HLO A;  4B86 A;  2B87 B;  3A5T A;  3O6Q B;  2FYZ A;  1T3U A;  2L0Q A;  4BRY B;  4ZNC A;  1G2C B;  3Q3D A;  1KYO D;  1BCC E;  3MTU E;  1L0I A; 
#chains in the Genus database with same CATH homology
 4U0B A;  2PEO A;  4U0D A;  1M90 Q;  1A43 A;  1ZMB A;  2Z45 A;  1M6N A;  1RNI A;  3CMA P;  3CME P;  2M8N A;  5F2K A;  1BAJ A;  3P05 A;  1YJW P;  1VQ4 P;  1YI2 P;  1N8R Q;  2PEM A;  4M0I A;  2XV6 A;  1QRJ A;  2DGY A;  3CCQ P;  1A8O A;  1QVG O;  1AUM A;  5DCK A;  2Z46 A;  1YIT P;  1Q81 Q;  3H47 A;  3G6E P;  2EIA A;  3VRL C;  2OTL P;  1RO0 A;  3RG6 C;  2PEJ A;  3E2D A;  5HGL A;  4COP A;  3G71 P;  1Q82 Q;  5I4T G;  1PEM A;  1PEO A;  1KQS O;  1KC8 Q;  1D1D A;  2XXM A;  3CPW O;  1VQL P;  3CCE P;  3G1G A;  1Q86 Q;  2JYL A;  3LRY A;  3G0V A;  4U0C A;  2XT1 A;  5F2O A;  3M1M A;  5HGO A;  5BS1 A;  3CC4 P;  3CCL P;  3G21 A;  3CCJ P;  2EG5 A;  3DS5 A;  3OW2 O;  3B5I A;  1M1K Q;  1VQ8 P;  1PEQ A;  1M74 A;  2EFJ A;  3DTJ A;  4PH1 A;  3DS3 A;  1YHQ P;  4U0E A;  3MGE A;  1VQP P;  2BQ1 E;  2PEK A;  1YJN P;  2CWO A;  3NTE A;  1RO2 A;  3CXC O;  2QA4 P;  3DS1 A;  1YJ9 P;  3I56 P;  3G26 A;  1VQ7 P;  3H4E A;  2Z44 A;  1JJ2 O;  1VQO P;  3CD6 P;  4XFY A;  3CCU P;  5F2N A;  3CC7 P;  3Q20 A;  4XFZ A;  2E1M A;  3HZQ A;  3CCV P;  2ONT A;  2PEQ A;  2KOD A;  3WBH A;  5JPA A;  1VQ5 P;  4PH0 A;  4GR6 A;  4U0A A;  1Q7Y Q;  2BHV A;  3HYB A;  2BUO A;  4XRQ A;  5BS2 A;  5HGN A;  2OAR A;  3CCM P;  1M6E X;  4GR2 A;  1QVF O;  1YIJ P;  1VQK P;  3DS0 A;  2JYG A;  3CCS P;  4XRO A;  3G28 A;  2PEI A;  2PY8 A;  2M8L A;  1KD1 Q;  3CC2 P;  3DS4 A;  1VQM P;  1EIA A;  3G29 A;  3H0D A;  2QEX P;  5HGM A;  4U0F A;  1EOQ A;  4COC A;  3I55 P;  3G4S P;  1K73 Q;  3G1I A;  1S72 P;  1K8A Q;  3CCR P;  4XFX A;  1VQ9 P;  1K30 A;  2L6E A;  2OTJ P;  3DPH A;  4IPY A;  1PEU A;  1IUQ A;  2M8P A;  1NJI Q;  2JO0 A;  1W2B O;  2PEN A;  1E6J P;  1K9M Q;  4QNB A;  1VQ6 P;  4WYM A;  1VQN P;  2LF4 A;  2P9X A;  3DS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...