3CMEP

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cmeP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cmeP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cmeP02
1VQMP 3CCEP 1YJ9P 1VQ8P 2OTLP 1VQ9P 3CCJP 3CCUP 3CCVP 2QEXP 1YITP 1KD1Q 2QA4P 1VQLP 1VQPP 3G71P 1K8AQ 3CC4P 3CCQP 1YJWP 1VQNP 1YI2P 1Q82Q 1YJNP 3CMEP 1VQ4P 1M90Q 1QVFO 1VQ6P 3CD6P 1NJIQ 3CMAP 1K9MQ 1M1KQ 3OW2O 1VQKP 1Q86Q 3CCRP 1W2BO 1VQOP 3CXCO 3G4SP 1YIJP 1Q81Q 1K73Q 1JJ2O 3CPWO 1Q7YQ 1VQ5P 1QVGO 1N8RQ 3CCLP 3I56P 3I55P 3CC7P 1S72P 3CCMP 1KC8Q 1YHQP 3CC2P 2OTJP 3G6EP 1KQSO 3CCSP 1VQ7P
chains in the Genus database with same CATH superfamily
1SQPJ 3V4QA 1NTKD 1H0TA 1VQ9P 2JQ4A 2KG9A 1OIPA 2R32A 2IBZD 1GXHA 4U0FA 2FQ2A 5CCGD 3L72G 1R8EA 3Q1MA 1GL2D 3M9QA 2GDYA 3M9HA 2ZVOB 3H1LJ 1EZVI 1QL1A 5AVYB 1USEA 1BCCE 2LR2A 1VQLP 1KFMA 2K5XA 1VF5D 2E42A 2D2CB 1OMIA 4H44D 3AEAC 1N7SD 2JWAA 2BASA 1KILE 1ZP0C 2FVAA 3FWNA 3PRJA 2L6EA 2LF4A 1HTLC 4Y99C 1L0NJ 2WVRA 3AEGC 4U7JA 2XNXA 4RESB 1PP9G 3H1IJ 3B5NC 3W67A 3EFGA 2R5DA 2V7QJ 2J5UA 1LTSC 2BCCE 5BS2A 3DTJA 3HTKB 2ZVNB 5H2FE 3EJEA 2O01N 1Z56A 1YITP 1H88A 3P05A 4YXDC 4PXHB 2HFED 3KDPB 4WYMA 1T3UA 3M0DA 4UB8E 1L0LD 1IMQA 4I1LA 2K37A 3PLNA 3N7NA 2FXMA 1LT9C 1DEEG 2FYNC 1SQQG 4CPGA 1BXIA 3CI9A 1LT1A 3WUUA 3H1IE 5GTIE 3G28A 3A0BE 4U0BA 4Y28J 5KP7B 2N5IA 2Y9ZA 1KILC 1S5LH 1L4AC 2FYUD 1M1JC 5AVWB 1M6NA 2MVUA 2B87B 4OH8B 3OAKA 2JDIH 2LPKA 1GXGA 5CJ0A 3TK1A 2CPSA 3AE3C 1RHZB 1NTMG 3CX5D 4NPDA 1HGZA 3HTKA 3B5NB 3B5NA 2K88A 1KB9H 2K3RA 4RKUJ 3A0HE 1ZV8A 2C9NY 1EDLA 2M8LA 3CWBJ 2FFDB 5HGLA 3G71P 3L70D 1NTMK 1CSBA 4I7ZC 2KOOA 5KLIC 1NQ4A 1N73B 3G4SP 2FYUG 1VQ5P 2KGCA 2WSEH 1ZR4A 2YIUB 3HE4B 2LIWA 1BGYE 1YQ4C 1T8ZA 5KKZB 3B5ND 1FE6A 1FR2A 2Y0CA 2Z46A 1PZQA 1NWQA 1KYOD 2JKVA 2QE7H 2QJKB 1QL2A 1S1CX 3BCCD 2QM8A 2HPCA 1BE3E 3G3ZA 5CCGA 2A06G 2A45H 1KC8Q 1RF1A 2FVEA 1M1JB 3E1RA 2ZXXA 3HD7B 2AXTH 1BSHA 2LKIA 2P2UA 2I8DA 2M8RA 1EZVE 1ZMEC 2QJYB 2NPSB 2OYIC 2GZGA 1LTJB 1KYOE 3L73D 1NU1E 3EQ2A 2DGYA 1KLPA 1NVOA 1BCCD 1JY3N 4IFMA 2FBWC 1M90Q 1YIJP 4I7ZB 2Z44A 2YO3A 1EZVG 3MUDA 3U1AA 5KKZC 3NXSA 3AE2C 4COPA 2ERHA 2MKVA 4H0LB 3JCUH 5AVTB 4U3FD 4GR2A 1KQLA 4UB6E 1H8AA 2P1JA 2KORA 3L75E 4A7PA 2O01J 5KAFH 2W6AA 1MKMA 5AW8B 2WPSA 2WZ7A 2FY8A 1VF5C 4D6TJ 3AE9C 1GD2E 1IK9A 2E75C 4YTPC 1Z6MA 2N1TA 2OYOA 1G2CA 4JYCA 1GTWA 2E75D 3II6A 1L0NK 2FYNB 2Z4EA 5CCGC 2RKLA 4GODA 4H2XC 1NJIQ 1LWUB 4C7NA 1JMMA 4OWFA 1URQD 2WSFJ 4AQRD 1PFIA 2PEOA 1L0NG 3M1MA 1G1JA 2KGEA 1U57A 3RK3D 2QJYC 1NAYA 3MGNA 2XT1A 4DG9A 3RG2A 1YJNP 3H0DA 2WSEJ 2H88C 3G1GA 1ZLLA 5M1BA 2IYPA 4DCKA 1RE3A 1ZRTD 2YNYA 5APWA 5APUA 4U0AA 3CWBE 2E1MA 3L71E 4R4MA 2M8PA 4W80A 2Q3IA 1NTKK 5KP6B 4PD4D 1GW3A 4BWNA 4I2LC 2KOPA 2D2CD 2E5TA 1BE3G 1IFJA 3G26A 2K1AA 4KHXA 4H0LC 1K30A 3S1KA 3SSUA 3GZLA 5APTA 3NTEA 1VPCA 1DEBA 1SP4A 3L36A 1SQVE 3CL3D 2XKMA 1ZW0A 3MGEA 1X22A 2QNWA 3PJSK 2OYHC 1N7SA 3CLQA 2AFDA 2YMKA 2E74B 2ZYDA 2KB7P 2RN0A 2AFEA 3BCCJ 1M7LA 2ZFCA 2KW2A 2B9BA 1H89A 3MP7B 2WT7B 3Q3DA 1FZFA 4M3LA 4NPFX 2QVAA 1PPJD 1KYOI 1MFZA 2DW3A 3DPHA 3GJNA 2ZXEB 1EXIA 4WY4C 1W2BO 1FZGA 1FZAA 2IBZG 1Q7YQ 3IR9A 3TGUD 1NTZJ 3L72D 1M56D 3L73J 1EC5A 1M6EX 1RE3C 3VP8A 5B66E 2Z5HA 4U0EA 3L70G 3ZDMA 2KOGA 3CXHI 3VMZA 3CCRP 1ZN5A 1Q81Q 2M3BA 4NPEA 5B5EE 5KAIE 3G9RA 1MZ9A 2KG6A 5TISH 1YTZI 2MF4A 2A06E 1L0LK 2P9XA 4N6JA 3CCVP 2QEXP 2YMYA 3H1HD 4U3FG 4W7ZA 3CX5I 1Q82Q 1PGPA 1L0LE 3RK3E 1OW6A 1T6AA 1GL2A 1SQQJ 3CX5H 2XV6A 2Q9IA 1NOHA 2B87A 3HE5B 4ASWA 1QGKB 3MD0A 1VF5B 1BCCJ 4QNBA 2ZYAA 4H2WC 5KLVD 1QRJA 3AE6C 2ZT9D 1X8YA 3MIWA 1HJ0A 1MV8A 2L91A 3L71G 3RBZA 3PTZA 3H1LD 1S5LE 3OW2O 1VQKP 1ZOYC 3BATA 2W8ZA 3M91A 3M06A 3EJBA 3LRYA 3CPWO 1QVGO 3H25A 4IPYA 2Y0EA 1SQXD 1U7JA 1NO4A 1VL2A 2RMZA 2KOQA 2K9JB 1IUQA 1BDDA 5B66H 1H0TB 1N73A 1IFDA 3VRLC 2FFDC 2GUSA 1L0ND 1AJYA 3HZQA 3KZIH 3IAOA 3P32A 1FZEA 1URQB 1T3JA 1URQA 2XDJA 5CCHD 3G29A 2KI7B 2KZIA 3UIAA 3A7OA 1VKUA 3ABVC 5KLVG 5AW2B 2N9BA 1D7MA 4YXWH 4H44C 1BDCA 4D6TG 1NU1D 2CWOA 3RL0C 1NYHA 1SQXE 3L37A 2BHVA 1S9KE 3H1KG 3H1IG 2QJKC 2H43A 4K35A 2XNDH 4NEOA 1GL2C 1FU1A 2N1TB 1CW5A 2FADA 2JO1A 3MTUE 1SQVJ 4XFJA 5KJ7D 1SS1A 5AW0B 3WMM0 3AEEC 3RBXA 4PH0A 4N3YB 1FS0E 1S2EA 2M5RA 4H13B 1R5SA 1AF8A 4M0IA 3H1LE 3H1KE 1PP9J 3DS1A 3R2PA 1NTME 2ZYGA 2OYIB 3P8CD 1NU1K 1NKZB 1VQPP 2YXQB 4AUWA 3BASA 2JB0A 4JQ0D 1JNMA 3CD6P 1SQPE 4MRTC 5AW7B 2V7QH 3Q2YA 3VP9A 3SWYA 1Y9BA 3GHGC 1ZNVA 3H1ID 2JU2A 1SQBJ 3IFMA 1OR5A 2ROQA 1RF1B 3V2QA 2PEJA 1FBMA 1K05A 4LGDE 2JAZA 2IX7C 1W5CE 4IL6E 2R3SA 3H1JG 2IZ1A 2ZT9B 4R0MA 5AW3B 3HD7C 3D71A 4Z1MH 3L72J 3O6QB 3CCEP 5AVQB 1KORA 2YKOA 3B8EB 5KAFE 5KJ7A 4H13C 1PPJE 2CG5B 3A3YB 1SQBK 2W27A 2DNWA 5AVRB 1RO0A 2L9FA 2BEZF 3CXHE 2PGDA 3RK3C 2I1JA 1N86A 1YJ9P 2KGDA 3RG6C 2OTKE 2M5AB 3U59A 2RH0A 1OW7A 5KP8B 1IZNB 4H0LD 1SQQD 1RY3A 1JO5A 1BSNA 2Q1KA 4TT3H 1NU1J 4WB4A 4UB8H 2PP6A 3H4EA 2XZ0D 1NAFA 2LXBA 4RJTA 4HB1A 3L74E 2C9LY 4ASVA 1DX7A 1RF0C 4RO0A 1EDKA 2KG8A 1ZRTE 1SQBD 3WUVA 5AW6B 2EFJA 1SQVK 3F5HA 2V4HA 2JO0A 3VMYA 5BVZA 1AA0A 1PP9D 4BRYB 3NY7B 4GIFA 1E5WA 3HD7A 2N50A 2E74C 3RK2B 1L0HA 5KJ7C 3TGUG 3RL0B 2KS1A 3USSA 3T97A 2HODA 1HUCA 3K5BA 4JBZA 3LIDA 1EDIA 2KLUA 3L74J 1Q2NA 2M5AA 2N1TC 1DD4A 4LC1A 3GF3A 1AVYA 3L73G 5KLIB 2AXCA 1HY8A 1P84I 1K73Q 1T2KD 2NPSD 1PP9E 2KWLA 1SQXG 1KQSO 2WPVB 1UIIA 1PGQA 2IBZE 3VMXA 1L2PA 3HE4A 4GR6A 2JGPA 3V4WA 5DCKA 2KSEA 3CE7A 2LXCB 1OXZA 3A2AA 2YKPA 1L0IA 4XROA 1SQXJ 3HUSC 1X0TA 3V2NA 5F2KA 1G1IA 4GOEA 2H7HA 2GZJA 3G0VA 2O1KA 2VLNA 2K0YA 1NTZD 1GK6A 1WMKA 1SQQK 3A5TA 1VDFA 3B71A 2FQ0A 1ACPA 3KXDA 2UWJE 3FWLA 1FJPA 4ZKPA 3M9BA 2HYNA 5AW5B 2IFMA 3BRVB 3CXHD 4U0CA 1BGYJ 1KB9E 5APVA 2Q7CA 1LWUA 4C7NB 2CK3H 4IFFA 3GLMA 5BU5A 3L74G 2BUOA 3CC2P 3L74D 1PEMA 1ZMBA 5APXA 1YYCA 1NTZK 2BCCJ 5KLVJ 1NKNA 3B4QA 1LTIC 2IBZI 1KILA 3Q5PA 4L76A 3KQGA 3I55P 5GTHE 1YHQP 1WT6A 4IOIH 1KB9D 1VQ8P 1RH5B 2KK7A 2GZFA 4L75A 1LT9A 4GKGA 1LNQA 2JBGA 1IFNA 2BCCG 1X9VA 5AW1B 1P84D 1USDA 4BPHA 2OTJP 5DJTB 1JCDA 2J58A 2J59M 3U43A 4HKGA 4ZMDA 2WPTA 2MVVA 5APSA 1L4AD 1IFMA 3LW5J 3CXHH 2GM4A 2R44A 1EXJA 3JC22 4N78E 2FXOA 1U7MA 1QLED 3CCJP 2A45G 3O8ZA 2FHSC 1A8OA 3A0HH 2KOSA 1PEOA 1JY2N 1VQOP 5CJ4A 1NU1G 5GTHH 5DJUB 5KAIH 1KZUB 1XTCC 2K9YA 1SQPG 4R4LA 4U3FE 1Q90D 1SQPD 1NHLA 2JR8A 4H44B 2OTLP 2OQQA 4COCA 2A45I 2KIKA 2N9YB 1LT9B 3EFFK 3P8CE 3TGUJ 2KGAA 2ONTA 1X3OA 2ITAA 3KZIE 3VN0A 1CI6A 1A02J 1OVVA 1VHNA 1EZVD 2GZIA 1GL2B 3O6QA 4XA4A 1PEUA 2ZJSE 3BRTB 5AVUB 2AVAA 3H1JJ 2MJZA 5K5GB 2OYHA 2MR7A 1SFCD 1N7SC 4BPFA 1PIXA 2FYUJ 2E76B 2P10A 4WY4A 4JF7A 1FDOA 1AQTA 1RE4A 3JCUE 1LTAC 2WSFH 3M0AA 2YKQA 1J1EB 3ITKA 2HR3A 1S4XA 1VQNP 1E6JP 4QKOA 2P7JA 1SFCC 4PH1A 1DNYA 3KYQA 2XZRA 3HUSA 4HKZH 4HH2A 2FVFA 3IN6A 2GYKA 2Q3EA 1DIPA 2I1KA 4IFDK 3L70E 4BRYA 2LL8A 3TDKA 3G1IA 2IFNA 1YJWP 1KMIZ 2L0QA 3V5BA 1GU5A 4EDFA 2KODA 2IZ0A 1SQVG 3L4FA 3A0BH 2W90A 1S3JA 3H32B 3OA7A 2KP8A 3HD7D 2EHSA 2KZJA 1LTTC 3AECC 3HE5A 1YBKA 1G2CB 5BS1A 5TJHA 1LP1A 5CBNA 1Y8AA 3TNUA 2PY8A 4LLHA 3H1KD 3U1CA 2OGUA 4O9BA 2JYGA 5HVCA 2M8NA 2VLQA 1M1KQ 4F37A 2R3CA 3TYYA 2Z5IA 5EJDA 1PGJA 4L74A 3QH9A 1LTJA 1VQMP 3HRNA 5I4TG 2WITA 3WU2H 2QG4A 1OVRA 3H1HJ 1RF0A 2FKWB 2E76D 5APQA 2K0XA 2NRGA 1OWAA 1J1EC 3L71J 4IZ6A 1A02F 1FZCC 4H2YC 5L8RJ 2G3AA 2HLOA 2EIAA 3FGAD 3AEDC 2K2QA 2KNCA 2HG5D 5HGNA 4ZKUA 2PNGA 3CMEP 2XV5A 4WWIA 2GUVA 2Q6QA 2PFXA 1LGHB 3FX0A 3E7KA 3T97B 1KILB 3DS5A 5E79E 2O3JA 3Q5SA 1MZ8A 3CWBD 2QA4P 3RL0D 3L70J 3HYBA 2BCCD 5KTBA 1NH4A 4OGQC 1MUUA 4I6MC 3GW6A 2WQYC 1DV5A 1KQFB 5CCHC 4D6TE 2JJLA 5HGOA 1LTGC 2X2BA 2WWWA 3EWKA 2MD9A 1KN7A 2FYUK 5AW4B 1F80D 2XZ1C 1KILD 1AVOA 4IL6X 4DJGA 1IMPA 4BPGA 2NZ2A 3GHGA 5BU8B 1UIXA 1L0NE 2AEFA 3P7KA 2A06D 3CCSP 1HQBA 1KYOH 5AVVB 1N2DC 1FZCB 3PHLA 3H1LG 2YIUC 1NTKE 1KV4A 1L0LJ 4N78D 1IC2A 2Q5UA 4EIJA 3L71D 1JM0A 3TSIA 2ZT9C 1SFCB 3CC7P 1FJKA 3C1LA 1Y47A 3KPEA 3E1IA 4EOTA 1W2EA 3AE4C 1GPJA 1GK4A 1KD1Q 1IK7A 3TGUE 1LJ2A 2FYZA 1CI6B 3NFQA 4UHPB 2JP3A 4XFXA 4HYTB 3VYIA 3BVHA 5KLVE 3N4XA 1IO4A 1GW4A 4GT1A 1L4AA 1J1DB 1L4AB 1M8OB 1EOQA 3I5CA 1DD3A 3L73E 2CGQA 2NPSC 1SQPK 1XTGB 2LIUA 1LP1B 5CCHA 3RGUA 1VQ4P 3CMAP 3AE1C 1SQBE 1FDMA 2FACA 2CPBA 1FOSE 2KXPB 3SFDC 3RL0g 2O1JA 1JY3O 4GDOA 3TF5A 2FFDA 1BE3D 2W6JH 5EW5E 3BCCE 2C0XA 3WBHA 2QSIA 2N6ZA 1SLQA 4DOJA 3NTNA 1RF1C 2LTEA 2PEMA 1AQ5A 3D70A 2E5YA 2Y0DA 1JB0J 2E75B 3PH0A 4DZOA 3V2RA 1KQGB 3RK2C 1SQQE 2WSCH 3H1JE 2KS1B 5KLVK 1UJZA 4D6TD 5CZDB 1NTKJ 1EQ7A 4AYCA 2LKMA 2KSJA 3GMAA 1SVFA 1PPJG 1J1DC 2IPPA 4B86A 3Q5RA 4XFZA 1JY3P 2R5BA 3PP5A 4EI2A 1K04A 1HF9A 3GF7A 1CEIA 3GKLC 3GG2A 4OGQB 1OVUA 2CQ8A 4MN4C 2M0BA 4JYBA 3CCLP 2GZEA 2H8PD 2AEJA 2GDWA 5F2NA 1QX8A 1HBWA 2MY5A 2QM7A 2YXRB 4U0DA 3G21A 3L75G 4W7YA 1EMVA 1K9MQ 1WRGA 2L22A 1PV3A 1FOSF 1M74A 3AE8C 1R5LA 2LOLA 1PL5A 4YPCA 3LW5H 3G6EP 4DT0A 2KNCB 4KT0J 1HVVA 1SQXK 2K92A 3R4YA 5F2OA 1DH3A 4ZNCA 1NTMD 1D1DA 2PAJA 1FAVA 1IFPA 1GDTA 3AEFC 5CHXA 1YQ3C 2OARA 1E79H 2ZAEB 3I56P 2AEMA 4PV1D 1UNKA 2VLOA 1M1JA 1JUNA 3AE5C 2BEQD 4C7RA 1JY2O 2KLVA 4PD4H 2C0WA 2BQ1E 2NO8A 5AW9B 4PD4I 3CC4P 2XU6A 2M3EA 3MHVA 1VQ6P 2L5GB 4C46A 2P58A 3F89A 1AV1A 3RK2D 3QWOC 1LWUC 4HJGH 3LMOA 1JCCA 1SQBG 2W83C 1S72P 1NGMB 1S9KD 3OJAB 3IF4A 5AVXB 5AVSB 1KB9I 4BXLA 2Y9YA 2FXPA 2KYVA 1HH0A 1NTKG 2WPRA 1J2JB 2JWDA 2FQ1A 1JMBA 1N7LA 3H32A 1BGYG 1N8RQ 1N73C 2W6BA 1BGYD 3C8VA 4PWVB 3WU2E 3FXEA 4QMAA 1KTMA 4PV1B 1EIAA 1BE3J 3GHGB 1RQUA 2N98A 5HGMA 4PJ0E 1AUMA 5B5EH 2IYOA 3DS3A 3S4RA 1TU3F 2QRXA 3MZWB 3SFEC 2PENA 1HJBA 3HUSB 5GTIH 2NPSA 1ZR2A 1S5LX 2JYLA 7CEIA 5CBOA 1MFTA 5TISE 5E79H 2K93A 3LIEA 3L75J 3RK3B 1PEQA 1JTHA 3VTPC 3D6YA 2WPQA 3WUTA 1X79B 1P84H 1T2KC 1QVFO 3EJDA 4KJMA 4GOFA 1VQ7P 1OFCX 2OYIA 2WT7A 4WBAA 1LTJC 2WSSH 4OGQD 3TNUB 2VRSA 1T8KA 3B4SA 2FYUE 5C39A 3AE7C 5AVZB 1EDJA 2N1TD 3H6PA 1AYIA 2PEIA 2K94A 2GA1A 4EYYQ 3CXCO 4PV1C 4TLFA 1NTZG 3H1HE 2CNRA 4WY4B 1L0LG 1RNIA 2P67A 2WTYA 1FZCA 1IJDB 2SPZA 1GMJA 2GDXA 4XE5B 2E74D 2PEKA 1K8AQ 1JOCA 2AF8A 2K9JA 3W68A 2WSCJ 3L72E 2VLPA 3L75D 5JPAA 2QJPC 4WVZA 3M0DC 1GU4A 1OW8A 2IDBA 2PEQA 2B88A 1FZBA 3MUDC 1YTZT 2E43A 4PJ0H 3CCQP 3C9IA 3P8MC 1E0HA 2E76C 2PRRA 1JTHB 2MR8A 1KFNA 3H1HG 1P84E 3B5IA 2HODB 3NMDA 1HWTC 3DS0A 1FDIA 1M57D 3SWFA 1ZXGA 3JSVC 1RE4C 5HV8A 1OZHA 3FXDA 1A43A 1LTBC 5H2FH 3VOPA 2KUBA 4WY4D 1PGOA 1IFIA 4UB6H 3CWBG 1OX3A 3V6IA 3SWKA 1AFOA 1RQVA 1HGVA 3H1JD 2LMLA 3D6ZA 1SFCA 2N6YA 1JEKA 1NTMJ 3AEBC 2JU1A 1RO2A 1BAJA 3H1KJ 1SQVD 3KHUA 3L35A 4CA3A 1YI2P 4PD4E 4XFYA 2EG5A 3V2PA 4H13D 2HPCB 5EFWB 2XXMA 1URQC 2H89C 1FC2C 2L4BA 3H47A 3Q20A 2OYHB 3E2DA 2QJPB 4K3AA 3GZMA 5APYA 3S9OA 4XRQA 2O01H 4JPZB 2B89A 1JY2P 2JEEA 2VSQA 2POHA 1QEXA 4OVNF 2QIWA 2D2CC 2G8YA 4U3FJ 1NTZE 2Z45A 2EHTA 1N7SB 2K0DX 3DS4A 1GZLA 2FAEA 3CCUP 4Y99B 5CMZA 1BCCG 3VMAA 3CX5E 3DS2A 1Q86Q 4L73A 2WMMA 1JJ2O 2KR5A 2AXTE 3CCMP 1CZQA 2N5HA 4IL6H 3BCCG 2YO2A
chains in the Genus database with same CATH topology
5HGOA 3CCEP 2OTLP 1PEMA 1ZMBA 4COCA 1A43A 1VQ9P 2XT1A 5F2OA 4U0EA 2PY8A 2ONTA 3G28A 3WBHA 1M6EX 1YJNP 4U0BA 2JYGA 3H0DA 2CWOA 2M8NA 1PEQA 3G1GA 1D1DA 1M1KQ 4U0FA 2BHVA 1RO0A 3CCRP 2PEMA 1Q81Q 1K73Q 2OARA 4U0AA 1M6NA 3I56P 3I55P 1PEUA 2E1MA 1YHQP 2M8PA 1QVFO 1KQSO 3CCSP 1VQ7P 1VQMP 5I4TG 1YJ9P 1VQ8P 2DGYA 1RO2A 2BQ1E 2P9XA 3CCVP 1BAJA 2QEXP 3RG6C 3G26A 1VQLP 4GR6A 3CC4P 1YI2P 1Q82Q 1M90Q 1K30A 4XFYA 2EG5A 4PH0A 2PEIA 1VQ6P 5DCKA 2XV6A 3NTEA 3CXCO 1YIJP 4M0IA 2XXMA 2Z44A 4QNBA 3CC7P 3DS1A 1S72P 3MGEA 1RNIA 2L6EA 2LF4A 1QRJA 1KC8Q 2OTJP 4COPA 2EIAA 4XROA 3H4EA 4GR2A 3H47A 5F2KA 3Q20A 2M8LA 3E2DA 1KD1Q 2PEKA 1VQPP 5HGLA 3G71P 1K8AQ 3G0VA 1VQNP 4XRQA 5HGNA 1E6JP 4XFZA 3CMEP 3CD6P 4XFXA 3OW2O 1VQKP 4PH1A 5BS2A 3G4SP 3LRYA 3DTJA 3CPWO 1VQ5P 5JPAA 1QVGO 1N8RQ 3CCLP 2EFJA 4IPYA 3DS5A 1EOQA 1EIAA 2JO0A 2Z45A 3DS4A 5F2NA 3CCJP 2PEQA 1IUQA 5HGMA 3CCUP 1YITP 3G1IA 3P05A 2QA4P 2PEJA 1AUMA 3G6EP 1A8OA 3CCQP 2Z46A 1YJWP 3DPHA 4U0CA 4U0DA 3G21A 3HYBA 3DS2A 1PEOA 3DS3A 1VQ4P 4WYMA 3VRLC 1NJIQ 2PENA 3CMAP 1K9MQ 2KODA 3HZQA 1Q86Q 1W2BO 1VQOP 1M74A 1JJ2O 1Q7YQ 3B5IA 2PEOA 3G29A 2JYLA 3M1MA 3CCMP 2BUOA 3CC2P 5BS1A 3DS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM P;  3CCE P;  1YJ9 P;  1VQ8 P;  2OTL P;  1VQ9 P;  3CCJ P;  3CCU P;  3CCV P;  2QEX P;  1YIT P;  1KD1 Q;  2QA4 P;  1VQL P;  1VQP P;  3G71 P;  1K8A Q;  3CC4 P;  3CCQ P;  1YJW P;  1VQN P;  1YI2 P;  1Q82 Q;  1YJN P;  3CME P;  1VQ4 P;  1M90 Q;  1QVF O;  1VQ6 P;  3CD6 P;  1NJI Q;  3CMA P;  1K9M Q;  1M1K Q;  3OW2 O;  1VQK P;  1Q86 Q;  3CCR P;  1W2B O;  1VQO P;  3CXC O;  3G4S P;  1YIJ P;  1Q81 Q;  1K73 Q;  1JJ2 O;  3CPW O;  1Q7Y Q;  1VQ5 P;  1QVG O;  1N8R Q;  3CCL P;  3I56 P;  3I55 P;  3CC7 P;  1S72 P;  3CCM P;  1KC8 Q;  1YHQ P;  3CC2 P;  2OTJ P;  3G6E P;  1KQS O;  3CCS P;  1VQ7 P; 
#chains in the Genus database with same CATH topology
 1SQP J;  3V4Q A;  1NTK D;  1H0T A;  1VQ9 P;  2JQ4 A;  2KG9 A;  1OIP A;  2R32 A;  2IBZ D;  1GXH A;  4U0F A;  2FQ2 A;  5CCG D;  3L72 G;  1R8E A;  3Q1M A;  1GL2 D;  3M9Q A;  2GDY A;  3M9H A;  2ZVO B;  3H1L J;  1EZV I;  1QL1 A;  5AVY B;  1USE A;  1BCC E;  2LR2 A;  1VQL P;  1KFM A;  2K5X A;  1VF5 D;  2E42 A;  2D2C B;  1OMI A;  4H44 D;  3AEA C;  1N7S D;  2JWA A;  2BAS A;  1KIL E;  1ZP0 C;  2FVA A;  3FWN A;  3PRJ A;  2L6E A;  2LF4 A;  1HTL C;  4Y99 C;  1L0N J;  2WVR A;  3AEG C;  4U7J A;  2XNX A;  4RES B;  1PP9 G;  3H1I J;  3B5N C;  3W67 A;  3EFG A;  2R5D A;  2V7Q J;  2J5U A;  1LTS C;  2BCC E;  5BS2 A;  3DTJ A;  3HTK B;  2ZVN B;  5H2F E;  3EJE A;  2O01 N;  1Z56 A;  1YIT P;  1H88 A;  3P05 A;  4YXD C;  4PXH B;  2HFE D;  3KDP B;  4WYM A;  1T3U A;  3M0D A;  4UB8 E;  1L0L D;  1IMQ A;  4I1L A;  2K37 A;  3PLN A;  3N7N A;  2FXM A;  1LT9 C;  1DEE G;  2FYN C;  1SQQ G;  4CPG A;  1BXI A;  3CI9 A;  1LT1 A;  3WUU A;  3H1I E;  5GTI E;  3G28 A;  3A0B E;  4U0B A;  4Y28 J;  5KP7 B;  2N5I A;  2Y9Z A;  1KIL C;  1S5L H;  1L4A C;  2FYU D;  1M1J C;  5AVW B;  1M6N A;  2MVU A;  2B87 B;  4OH8 B;  3OAK A;  2JDI H;  2LPK A;  1GXG A;  5CJ0 A;  3TK1 A;  2CPS A;  3AE3 C;  1RHZ B;  1NTM G;  3CX5 D;  4NPD A;  1HGZ A;  3HTK A;  3B5N B;  3B5N A;  2K88 A;  1KB9 H;  2K3R A;  4RKU J;  3A0H E;  1ZV8 A;  2C9N Y;  1EDL A;  2M8L A;  3CWB J;  2FFD B;  5HGL A;  3G71 P;  3L70 D;  1NTM K;  1CSB A;  4I7Z C;  2KOO A;  5KLI C;  1NQ4 A;  1N73 B;  3G4S P;  2FYU G;  1VQ5 P;  2KGC A;  2WSE H;  1ZR4 A;  2YIU B;  3HE4 B;  2LIW A;  1BGY E;  1YQ4 C;  1T8Z A;  5KKZ B;  3B5N D;  1FE6 A;  1FR2 A;  2Y0C A;  2Z46 A;  1PZQ A;  1NWQ A;  1KYO D;  2JKV A;  2QE7 H;  2QJK B;  1QL2 A;  1S1C X;  3BCC D;  2QM8 A;  2HPC A;  1BE3 E;  3G3Z A;  5CCG A;  2A06 G;  2A45 H;  1KC8 Q;  1RF1 A;  2FVE A;  1M1J B;  3E1R A;  2ZXX A;  3HD7 B;  2AXT H;  1BSH A;  2LKI A;  2P2U A;  2I8D A;  2M8R A;  1EZV E;  1ZME C;  2QJY B;  2NPS B;  2OYI C;  2GZG A;  1LTJ B;  1KYO E;  3L73 D;  1NU1 E;  3EQ2 A;  2DGY A;  1KLP A;  1NVO A;  1BCC D;  1JY3 N;  4IFM A;  2FBW C;  1M90 Q;  1YIJ P;  4I7Z B;  2Z44 A;  2YO3 A;  1EZV G;  3MUD A;  3U1A A;  5KKZ C;  3NXS A;  3AE2 C;  4COP A;  2ERH A;  2MKV A;  4H0L B;  3JCU H;  5AVT B;  4U3F D;  4GR2 A;  1KQL A;  4UB6 E;  1H8A A;  2P1J A;  2KOR A;  3L75 E;  4A7P A;  2O01 J;  5KAF H;  2W6A A;  1MKM A;  5AW8 B;  2WPS A;  2WZ7 A;  2FY8 A;  1VF5 C;  4D6T J;  3AE9 C;  1GD2 E;  1IK9 A;  2E75 C;  4YTP C;  1Z6M A;  2N1T A;  2OYO A;  1G2C A;  4JYC A;  1GTW A;  2E75 D;  3II6 A;  1L0N K;  2FYN B;  2Z4E A;  5CCG C;  2RKL A;  4GOD A;  4H2X C;  1NJI Q;  1LWU B;  4C7N A;  1JMM A;  4OWF A;  1URQ D;  2WSF J;  4AQR D;  1PFI A;  2PEO A;  1L0N G;  3M1M A;  1G1J A;  2KGE A;  1U57 A;  3RK3 D;  2QJY C;  1NAY A;  3MGN A;  2XT1 A;  4DG9 A;  3RG2 A;  1YJN P;  3H0D A;  2WSE J;  2H88 C;  3G1G A;  1ZLL A;  5M1B A;  2IYP A;  4DCK A;  1RE3 A;  1ZRT D;  2YNY A;  5APW A;  5APU A;  4U0A A;  3CWB E;  2E1M A;  3L71 E;  4R4M A;  2M8P A;  4W80 A;  2Q3I A;  1NTK K;  5KP6 B;  4PD4 D;  1GW3 A;  4BWN A;  4I2L C;  2KOP A;  2D2C D;  2E5T A;  1BE3 G;  1IFJ A;  3G26 A;  2K1A A;  4KHX A;  4H0L C;  1K30 A;  3S1K A;  3SSU A;  3GZL A;  5APT A;  3NTE A;  1VPC A;  1DEB A;  1SP4 A;  3L36 A;  1SQV E;  3CL3 D;  2XKM A;  1ZW0 A;  3MGE A;  1X22 A;  2QNW A;  3PJS K;  2OYH C;  1N7S A;  3CLQ A;  2AFD A;  2YMK A;  2E74 B;  2ZYD A;  2KB7 P;  2RN0 A;  2AFE A;  3BCC J;  1M7L A;  2ZFC A;  2KW2 A;  2B9B A;  1H89 A;  3MP7 B;  2WT7 B;  3Q3D A;  1FZF A;  4M3L A;  4NPF X;  2QVA A;  1PPJ D;  1KYO I;  1MFZ A;  2DW3 A;  3DPH A;  3GJN A;  2ZXE B;  1EXI A;  4WY4 C;  1W2B O;  1FZG A;  1FZA A;  2IBZ G;  1Q7Y Q;  3IR9 A;  3TGU D;  1NTZ J;  3L72 D;  1M56 D;  3L73 J;  1EC5 A;  1M6E X;  1RE3 C;  3VP8 A;  5B66 E;  2Z5H A;  4U0E A;  3L70 G;  3ZDM A;  2KOG A;  3CXH I;  3VMZ A;  3CCR P;  1ZN5 A;  1Q81 Q;  2M3B A;  4NPE A;  5B5E E;  5KAI E;  3G9R A;  1MZ9 A;  2KG6 A;  5TIS H;  1YTZ I;  2MF4 A;  2A06 E;  1L0L K;  2P9X A;  4N6J A;  3CCV P;  2QEX P;  2YMY A;  3H1H D;  4U3F G;  4W7Z A;  3CX5 I;  1Q82 Q;  1PGP A;  1L0L E;  3RK3 E;  1OW6 A;  1T6A A;  1GL2 A;  1SQQ J;  3CX5 H;  2XV6 A;  2Q9I A;  1NOH A;  2B87 A;  3HE5 B;  4ASW A;  1QGK B;  3MD0 A;  1VF5 B;  1BCC J;  4QNB A;  2ZYA A;  4H2W C;  5KLV D;  1QRJ A;  3AE6 C;  2ZT9 D;  1X8Y A;  3MIW A;  1HJ0 A;  1MV8 A;  2L91 A;  3L71 G;  3RBZ A;  3PTZ A;  3H1L D;  1S5L E;  3OW2 O;  1VQK P;  1ZOY C;  3BAT A;  2W8Z A;  3M91 A;  3M06 A;  3EJB A;  3LRY A;  3CPW O;  1QVG O;  3H25 A;  4IPY A;  2Y0E A;  1SQX D;  1U7J A;  1NO4 A;  1VL2 A;  2RMZ A;  2KOQ A;  2K9J B;  1IUQ A;  1BDD A;  5B66 H;  1H0T B;  1N73 A;  1IFD A;  3VRL C;  2FFD C;  2GUS A;  1L0N D;  1AJY A;  3HZQ A;  3KZI H;  3IAO A;  3P32 A;  1FZE A;  1URQ B;  1T3J A;  1URQ A;  2XDJ A;  5CCH D;  3G29 A;  2KI7 B;  2KZI A;  3UIA A;  3A7O A;  1VKU A;  3ABV C;  5KLV G;  5AW2 B;  2N9B A;  1D7M A;  4YXW H;  4H44 C;  1BDC A;  4D6T G;  1NU1 D;  2CWO A;  3RL0 C;  1NYH A;  1SQX E;  3L37 A;  2BHV A;  1S9K E;  3H1K G;  3H1I G;  2QJK C;  2H43 A;  4K35 A;  2XND H;  4NEO A;  1GL2 C;  1FU1 A;  2N1T B;  1CW5 A;  2FAD A;  2JO1 A;  3MTU E;  1SQV J;  4XFJ A;  5KJ7 D;  1SS1 A;  5AW0 B;  3WMM 0;  3AEE C;  3RBX A;  4PH0 A;  4N3Y B;  1FS0 E;  1S2E A;  2M5R A;  4H13 B;  1R5S A;  1AF8 A;  4M0I A;  3H1L E;  3H1K E;  1PP9 J;  3DS1 A;  3R2P A;  1NTM E;  2ZYG A;  2OYI B;  3P8C D;  1NU1 K;  1NKZ B;  1VQP P;  2YXQ B;  4AUW A;  3BAS A;  2JB0 A;  4JQ0 D;  1JNM A;  3CD6 P;  1SQP E;  4MRT C;  5AW7 B;  2V7Q H;  3Q2Y A;  3VP9 A;  3SWY A;  1Y9B A;  3GHG C;  1ZNV A;  3H1I D;  2JU2 A;  1SQB J;  3IFM A;  1OR5 A;  2ROQ A;  1RF1 B;  3V2Q A;  2PEJ A;  1FBM A;  1K05 A;  4LGD E;  2JAZ A;  2IX7 C;  1W5C E;  4IL6 E;  2R3S A;  3H1J G;  2IZ1 A;  2ZT9 B;  4R0M A;  5AW3 B;  3HD7 C;  3D71 A;  4Z1M H;  3L72 J;  3O6Q B;  3CCE P;  5AVQ B;  1KOR A;  2YKO A;  3B8E B;  5KAF E;  5KJ7 A;  4H13 C;  1PPJ E;  2CG5 B;  3A3Y B;  1SQB K;  2W27 A;  2DNW A;  5AVR B;  1RO0 A;  2L9F A;  2BEZ F;  3CXH E;  2PGD A;  3RK3 C;  2I1J A;  1N86 A;  1YJ9 P;  2KGD A;  3RG6 C;  2OTK E;  2M5A B;  3U59 A;  2RH0 A;  1OW7 A;  5KP8 B;  1IZN B;  4H0L D;  1SQQ D;  1RY3 A;  1JO5 A;  1BSN A;  2Q1K A;  4TT3 H;  1NU1 J;  4WB4 A;  4UB8 H;  2PP6 A;  3H4E A;  2XZ0 D;  1NAF A;  2LXB A;  4RJT A;  4HB1 A;  3L74 E;  2C9L Y;  4ASV A;  1DX7 A;  1RF0 C;  4RO0 A;  1EDK A;  2KG8 A;  1ZRT E;  1SQB D;  3WUV A;  5AW6 B;  2EFJ A;  1SQV K;  3F5H A;  2V4H A;  2JO0 A;  3VMY A;  5BVZ A;  1AA0 A;  1PP9 D;  4BRY B;  3NY7 B;  4GIF A;  1E5W A;  3HD7 A;  2N50 A;  2E74 C;  3RK2 B;  1L0H A;  5KJ7 C;  3TGU G;  3RL0 B;  2KS1 A;  3USS A;  3T97 A;  2HOD A;  1HUC A;  3K5B A;  4JBZ A;  3LID A;  1EDI A;  2KLU A;  3L74 J;  1Q2N A;  2M5A A;  2N1T C;  1DD4 A;  4LC1 A;  3GF3 A;  1AVY A;  3L73 G;  5KLI B;  2AXC A;  1HY8 A;  1P84 I;  1K73 Q;  1T2K D;  2NPS D;  1PP9 E;  2KWL A;  1SQX G;  1KQS O;  2WPV B;  1UII A;  1PGQ A;  2IBZ E;  3VMX A;  1L2P A;  3HE4 A;  4GR6 A;  2JGP A;  3V4W A;  5DCK A;  2KSE A;  3CE7 A;  2LXC B;  1OXZ A;  3A2A A;  2YKP A;  1L0I A;  4XRO A;  1SQX J;  3HUS C;  1X0T A;  3V2N A;  5F2K A;  1G1I A;  4GOE A;  2H7H A;  2GZJ A;  3G0V A;  2O1K A;  2VLN A;  2K0Y A;  1NTZ D;  1GK6 A;  1WMK A;  1SQQ K;  3A5T A;  1VDF A;  3B71 A;  2FQ0 A;  1ACP A;  3KXD A;  2UWJ E;  3FWL A;  1FJP A;  4ZKP A;  3M9B A;  2HYN A;  5AW5 B;  2IFM A;  3BRV B;  3CXH D;  4U0C A;  1BGY J;  1KB9 E;  5APV A;  2Q7C A;  1LWU A;  4C7N B;  2CK3 H;  4IFF A;  3GLM A;  5BU5 A;  3L74 G;  2BUO A;  3CC2 P;  3L74 D;  1PEM A;  1ZMB A;  5APX A;  1YYC A;  1NTZ K;  2BCC J;  5KLV J;  1NKN A;  3B4Q A;  1LTI C;  2IBZ I;  1KIL A;  3Q5P A;  4L76 A;  3KQG A;  3I55 P;  5GTH E;  1YHQ P;  1WT6 A;  4IOI H;  1KB9 D;  1VQ8 P;  1RH5 B;  2KK7 A;  2GZF A;  4L75 A;  1LT9 A;  4GKG A;  1LNQ A;  2JBG A;  1IFN A;  2BCC G;  1X9V A;  5AW1 B;  1P84 D;  1USD A;  4BPH A;  2OTJ P;  5DJT B;  1JCD A;  2J58 A;  2J59 M;  3U43 A;  4HKG A;  4ZMD A;  2WPT A;  2MVV A;  5APS A;  1L4A D;  1IFM A;  3LW5 J;  3CXH H;  2GM4 A;  2R44 A;  1EXJ A;  3JC2 2;  4N78 E;  2FXO A;  1U7M A;  1QLE D;  3CCJ P;  2A45 G;  3O8Z A;  2FHS C;  1A8O A;  3A0H H;  2KOS A;  1PEO A;  1JY2 N;  1VQO P;  5CJ4 A;  1NU1 G;  5GTH H;  5DJU B;  5KAI H;  1KZU B;  1XTC C;  2K9Y A;  1SQP G;  4R4L A;  4U3F E;  1Q90 D;  1SQP D;  1NHL A;  2JR8 A;  4H44 B;  2OTL P;  2OQQ A;  4COC A;  2A45 I;  2KIK A;  2N9Y B;  1LT9 B;  3EFF K;  3P8C E;  3TGU J;  2KGA A;  2ONT A;  1X3O A;  2ITA A;  3KZI E;  3VN0 A;  1CI6 A;  1A02 J;  1OVV A;  1VHN A;  1EZV D;  2GZI A;  1GL2 B;  3O6Q A;  4XA4 A;  1PEU A;  2ZJS E;  3BRT B;  5AVU B;  2AVA A;  3H1J J;  2MJZ A;  5K5G B;  2OYH A;  2MR7 A;  1SFC D;  1N7S C;  4BPF A;  1PIX A;  2FYU J;  2E76 B;  2P10 A;  4WY4 A;  4JF7 A;  1FDO A;  1AQT A;  1RE4 A;  3JCU E;  1LTA C;  2WSF H;  3M0A A;  2YKQ A;  1J1E B;  3ITK A;  2HR3 A;  1S4X A;  1VQN P;  1E6J P;  4QKO A;  2P7J A;  1SFC C;  4PH1 A;  1DNY A;  3KYQ A;  2XZR A;  3HUS A;  4HKZ H;  4HH2 A;  2FVF A;  3IN6 A;  2GYK A;  2Q3E A;  1DIP A;  2I1K A;  4IFD K;  3L70 E;  4BRY A;  2LL8 A;  3TDK A;  3G1I A;  2IFN A;  1YJW P;  1KMI Z;  2L0Q A;  3V5B A;  1GU5 A;  4EDF A;  2KOD A;  2IZ0 A;  1SQV G;  3L4F A;  3A0B H;  2W90 A;  1S3J A;  3H32 B;  3OA7 A;  2KP8 A;  3HD7 D;  2EHS A;  2KZJ A;  1LTT C;  3AEC C;  3HE5 A;  1YBK A;  1G2C B;  5BS1 A;  5TJH A;  1LP1 A;  5CBN A;  1Y8A A;  3TNU A;  2PY8 A;  4LLH A;  3H1K D;  3U1C A;  2OGU A;  4O9B A;  2JYG A;  5HVC A;  2M8N A;  2VLQ A;  1M1K Q;  4F37 A;  2R3C A;  3TYY A;  2Z5I A;  5EJD A;  1PGJ A;  4L74 A;  3QH9 A;  1LTJ A;  1VQM P;  3HRN A;  5I4T G;  2WIT A;  3WU2 H;  2QG4 A;  1OVR A;  3H1H J;  1RF0 A;  2FKW B;  2E76 D;  5APQ A;  2K0X A;  2NRG A;  1OWA A;  1J1E C;  3L71 J;  4IZ6 A;  1A02 F;  1FZC C;  4H2Y C;  5L8R J;  2G3A A;  2HLO A;  2EIA A;  3FGA D;  3AED C;  2K2Q A;  2KNC A;  2HG5 D;  5HGN A;  4ZKU A;  2PNG A;  3CME P;  2XV5 A;  4WWI A;  2GUV A;  2Q6Q A;  2PFX A;  1LGH B;  3FX0 A;  3E7K A;  3T97 B;  1KIL B;  3DS5 A;  5E79 E;  2O3J A;  3Q5S A;  1MZ8 A;  3CWB D;  2QA4 P;  3RL0 D;  3L70 J;  3HYB A;  2BCC D;  5KTB A;  1NH4 A;  4OGQ C;  1MUU A;  4I6M C;  3GW6 A;  2WQY C;  1DV5 A;  1KQF B;  5CCH C;  4D6T E;  2JJL A;  5HGO A;  1LTG C;  2X2B A;  2WWW A;  3EWK A;  2MD9 A;  1KN7 A;  2FYU K;  5AW4 B;  1F80 D;  2XZ1 C;  1KIL D;  1AVO A;  4IL6 X;  4DJG A;  1IMP A;  4BPG A;  2NZ2 A;  3GHG A;  5BU8 B;  1UIX A;  1L0N E;  2AEF A;  3P7K A;  2A06 D;  3CCS P;  1HQB A;  1KYO H;  5AVV B;  1N2D C;  1FZC B;  3PHL A;  3H1L G;  2YIU C;  1NTK E;  1KV4 A;  1L0L J;  4N78 D;  1IC2 A;  2Q5U A;  4EIJ A;  3L71 D;  1JM0 A;  3TSI A;  2ZT9 C;  1SFC B;  3CC7 P;  1FJK A;  3C1L A;  1Y47 A;  3KPE A;  3E1I A;  4EOT A;  1W2E A;  3AE4 C;  1GPJ A;  1GK4 A;  1KD1 Q;  1IK7 A;  3TGU E;  1LJ2 A;  2FYZ A;  1CI6 B;  3NFQ A;  4UHP B;  2JP3 A;  4XFX A;  4HYT B;  3VYI A;  3BVH A;  5KLV E;  3N4X A;  1IO4 A;  1GW4 A;  4GT1 A;  1L4A A;  1J1D B;  1L4A B;  1M8O B;  1EOQ A;  3I5C A;  1DD3 A;  3L73 E;  2CGQ A;  2NPS C;  1SQP K;  1XTG B;  2LIU A;  1LP1 B;  5CCH A;  3RGU A;  1VQ4 P;  3CMA P;  3AE1 C;  1SQB E;  1FDM A;  2FAC A;  2CPB A;  1FOS E;  2KXP B;  3SFD C;  3RL0 g;  2O1J A;  1JY3 O;  4GDO A;  3TF5 A;  2FFD A;  1BE3 D;  2W6J H;  5EW5 E;  3BCC E;  2C0X A;  3WBH A;  2QSI A;  2N6Z A;  1SLQ A;  4DOJ A;  3NTN A;  1RF1 C;  2LTE A;  2PEM A;  1AQ5 A;  3D70 A;  2E5Y A;  2Y0D A;  1JB0 J;  2E75 B;  3PH0 A;  4DZO A;  3V2R A;  1KQG B;  3RK2 C;  1SQQ E;  2WSC H;  3H1J E;  2KS1 B;  5KLV K;  1UJZ A;  4D6T D;  5CZD B;  1NTK J;  1EQ7 A;  4AYC A;  2LKM A;  2KSJ A;  3GMA A;  1SVF A;  1PPJ G;  1J1D C;  2IPP A;  4B86 A;  3Q5R A;  4XFZ A;  1JY3 P;  2R5B A;  3PP5 A;  4EI2 A;  1K04 A;  1HF9 A;  3GF7 A;  1CEI A;  3GKL C;  3GG2 A;  4OGQ B;  1OVU A;  2CQ8 A;  4MN4 C;  2M0B A;  4JYB A;  3CCL P;  2GZE A;  2H8P D;  2AEJ A;  2GDW A;  5F2N A;  1QX8 A;  1HBW A;  2MY5 A;  2QM7 A;  2YXR B;  4U0D A;  3G21 A;  3L75 G;  4W7Y A;  1EMV A;  1K9M Q;  1WRG A;  2L22 A;  1PV3 A;  1FOS F;  1M74 A;  3AE8 C;  1R5L A;  2LOL A;  1PL5 A;  4YPC A;  3LW5 H;  3G6E P;  4DT0 A;  2KNC B;  4KT0 J;  1HVV A;  1SQX K;  2K92 A;  3R4Y A;  5F2O A;  1DH3 A;  4ZNC A;  1NTM D;  1D1D A;  2PAJ A;  1FAV A;  1IFP A;  1GDT A;  3AEF C;  5CHX A;  1YQ3 C;  2OAR A;  1E79 H;  2ZAE B;  3I56 P;  2AEM A;  4PV1 D;  1UNK A;  2VLO A;  1M1J A;  1JUN A;  3AE5 C;  2BEQ D;  4C7R A;  1JY2 O;  2KLV A;  4PD4 H;  2C0W A;  2BQ1 E;  2NO8 A;  5AW9 B;  4PD4 I;  3CC4 P;  2XU6 A;  2M3E A;  3MHV A;  1VQ6 P;  2L5G B;  4C46 A;  2P58 A;  3F89 A;  1AV1 A;  3RK2 D;  3QWO C;  1LWU C;  4HJG H;  3LMO A;  1JCC A;  1SQB G;  2W83 C;  1S72 P;  1NGM B;  1S9K D;  3OJA B;  3IF4 A;  5AVX B;  5AVS B;  1KB9 I;  4BXL A;  2Y9Y A;  2FXP A;  2KYV A;  1HH0 A;  1NTK G;  2WPR A;  1J2J B;  2JWD A;  2FQ1 A;  1JMB A;  1N7L A;  3H32 A;  1BGY G;  1N8R Q;  1N73 C;  2W6B A;  1BGY D;  3C8V A;  4PWV B;  3WU2 E;  3FXE A;  4QMA A;  1KTM A;  4PV1 B;  1EIA A;  1BE3 J;  3GHG B;  1RQU A;  2N98 A;  5HGM A;  4PJ0 E;  1AUM A;  5B5E H;  2IYO A;  3DS3 A;  3S4R A;  1TU3 F;  2QRX A;  3MZW B;  3SFE C;  2PEN A;  1HJB A;  3HUS B;  5GTI H;  2NPS A;  1ZR2 A;  1S5L X;  2JYL A;  7CEI A;  5CBO A;  1MFT A;  5TIS E;  5E79 H;  2K93 A;  3LIE A;  3L75 J;  3RK3 B;  1PEQ A;  1JTH A;  3VTP C;  3D6Y A;  2WPQ A;  3WUT A;  1X79 B;  1P84 H;  1T2K C;  1QVF O;  3EJD A;  4KJM A;  4GOF A;  1VQ7 P;  1OFC X;  2OYI A;  2WT7 A;  4WBA A;  1LTJ C;  2WSS H;  4OGQ D;  3TNU B;  2VRS A;  1T8K A;  3B4S A;  2FYU E;  5C39 A;  3AE7 C;  5AVZ B;  1EDJ A;  2N1T D;  3H6P A;  1AYI A;  2PEI A;  2K94 A;  2GA1 A;  4EYY Q;  3CXC O;  4PV1 C;  4TLF A;  1NTZ G;  3H1H E;  2CNR A;  4WY4 B;  1L0L G;  1RNI A;  2P67 A;  2WTY A;  1FZC A;  1IJD B;  2SPZ A;  1GMJ A;  2GDX A;  4XE5 B;  2E74 D;  2PEK A;  1K8A Q;  1JOC A;  2AF8 A;  2K9J A;  3W68 A;  2WSC J;  3L72 E;  2VLP A;  3L75 D;  5JPA A;  2QJP C;  4WVZ A;  3M0D C;  1GU4 A;  1OW8 A;  2IDB A;  2PEQ A;  2B88 A;  1FZB A;  3MUD C;  1YTZ T;  2E43 A;  4PJ0 H;  3CCQ P;  3C9I A;  3P8M C;  1E0H A;  2E76 C;  2PRR A;  1JTH B;  2MR8 A;  1KFN A;  3H1H G;  1P84 E;  3B5I A;  2HOD B;  3NMD A;  1HWT C;  3DS0 A;  1FDI A;  1M57 D;  3SWF A;  1ZXG A;  3JSV C;  1RE4 C;  5HV8 A;  1OZH A;  3FXD A;  1A43 A;  1LTB C;  5H2F H;  3VOP A;  2KUB A;  4WY4 D;  1PGO A;  1IFI A;  4UB6 H;  3CWB G;  1OX3 A;  3V6I A;  3SWK A;  1AFO A;  1RQV A;  1HGV A;  3H1J D;  2LML A;  3D6Z A;  1SFC A;  2N6Y A;  1JEK A;  1NTM J;  3AEB C;  2JU1 A;  1RO2 A;  1BAJ A;  3H1K J;  1SQV D;  3KHU A;  3L35 A;  4CA3 A;  1YI2 P;  4PD4 E;  4XFY A;  2EG5 A;  3V2P A;  4H13 D;  2HPC B;  5EFW B;  2XXM A;  1URQ C;  2H89 C;  1FC2 C;  2L4B A;  3H47 A;  3Q20 A;  2OYH B;  3E2D A;  2QJP B;  4K3A A;  3GZM A;  5APY A;  3S9O A;  4XRQ A;  2O01 H;  4JPZ B;  2B89 A;  1JY2 P;  2JEE A;  2VSQ A;  2POH A;  1QEX A;  4OVN F;  2QIW A;  2D2C C;  2G8Y A;  4U3F J;  1NTZ E;  2Z45 A;  2EHT A;  1N7S B;  2K0D X;  3DS4 A;  1GZL A;  2FAE A;  3CCU P;  4Y99 B;  5CMZ A;  1BCC G;  3VMA A;  3CX5 E;  3DS2 A;  1Q86 Q;  4L73 A;  2WMM A;  1JJ2 O;  2KR5 A;  2AXT E;  3CCM P;  1CZQ A;  2N5H A;  4IL6 H;  3BCC G;  2YO2 A; 
#chains in the Genus database with same CATH homology
 5HGO A;  3CCE P;  2OTL P;  1PEM A;  1ZMB A;  4COC A;  1A43 A;  1VQ9 P;  2XT1 A;  5F2O A;  4U0E A;  2PY8 A;  2ONT A;  3G28 A;  3WBH A;  1M6E X;  1YJN P;  4U0B A;  2JYG A;  3H0D A;  2CWO A;  2M8N A;  1PEQ A;  3G1G A;  1D1D A;  1M1K Q;  4U0F A;  2BHV A;  1RO0 A;  3CCR P;  2PEM A;  1Q81 Q;  1K73 Q;  2OAR A;  4U0A A;  1M6N A;  3I56 P;  3I55 P;  1PEU A;  2E1M A;  1YHQ P;  2M8P A;  1QVF O;  1KQS O;  3CCS P;  1VQ7 P;  1VQM P;  5I4T G;  1YJ9 P;  1VQ8 P;  2DGY A;  1RO2 A;  2BQ1 E;  2P9X A;  3CCV P;  1BAJ A;  2QEX P;  3RG6 C;  3G26 A;  1VQL P;  4GR6 A;  3CC4 P;  1YI2 P;  1Q82 Q;  1M90 Q;  1K30 A;  4XFY A;  2EG5 A;  4PH0 A;  2PEI A;  1VQ6 P;  5DCK A;  2XV6 A;  3NTE A;  3CXC O;  1YIJ P;  4M0I A;  2XXM A;  2Z44 A;  4QNB A;  3CC7 P;  3DS1 A;  1S72 P;  3MGE A;  1RNI A;  2L6E A;  2LF4 A;  1QRJ A;  1KC8 Q;  2OTJ P;  4COP A;  2EIA A;  4XRO A;  3H4E A;  4GR2 A;  3H47 A;  5F2K A;  3Q20 A;  2M8L A;  3E2D A;  1KD1 Q;  2PEK A;  1VQP P;  5HGL A;  3G71 P;  1K8A Q;  3G0V A;  1VQN P;  4XRQ A;  5HGN A;  1E6J P;  4XFZ A;  3CME P;  3CD6 P;  4XFX A;  3OW2 O;  1VQK P;  4PH1 A;  5BS2 A;  3G4S P;  3LRY A;  3DTJ A;  3CPW O;  1VQ5 P;  5JPA A;  1QVG O;  1N8R Q;  3CCL P;  2EFJ A;  4IPY A;  3DS5 A;  1EOQ A;  1EIA A;  2JO0 A;  2Z45 A;  3DS4 A;  5F2N A;  3CCJ P;  2PEQ A;  1IUQ A;  5HGM A;  3CCU P;  1YIT P;  3G1I A;  3P05 A;  2QA4 P;  2PEJ A;  1AUM A;  3G6E P;  1A8O A;  3CCQ P;  2Z46 A;  1YJW P;  3DPH A;  4U0C A;  4U0D A;  3G21 A;  3HYB A;  3DS2 A;  1PEO A;  3DS3 A;  1VQ4 P;  4WYM A;  3VRL C;  1NJI Q;  2PEN A;  3CMA P;  1K9M Q;  2KOD A;  3HZQ A;  1Q86 Q;  1W2B O;  1VQO P;  1M74 A;  1JJ2 O;  1Q7Y Q;  3B5I A;  2PEO A;  3G29 A;  2JYL A;  3M1M A;  3CCM P;  2BUO A;  3CC2 P;  5BS1 A;  3DS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...