3CMEP

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cmeP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cmeP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cmeP02
2OTLP 1VQLP 1Q7YQ 1JJ2O 1VQ6P 2OTJP 3G4SP 3OW2O 1Q82Q 3CC2P 1VQ9P 3CCUP 1YJNP 3CMEP 3CC7P 2QA4P 1VQ8P 3CD6P 1M1KQ 1VQ5P 1M90Q 1NJIQ 3CPWO 1QVGO 1KC8Q 3CC4P 3CCQP 1QVFO 3G71P 1KQSO 3CCRP 3I55P 1YHQP 3CCMP 2QEXP 1VQOP 1S72P 3CCJP 1YIJP 1K73Q 3CCEP 1Q86Q 1N8RQ 3CXCO 1YJWP 1K9MQ 3G6EP 1YI2P 1VQ4P 1VQNP 1Q81Q 1VQMP 3CCLP 1K8AQ 3I56P 3CCSP 3CCVP 1VQKP 1VQPP 1W2BO 1KD1Q 1VQ7P 1YITP 3CMAP 1YJ9P
chains in the Genus database with same CATH superfamily
1N2DC 2PAJA 1CSBA 3AEDC 2KOQA 1M56D 1LWUA 2KNCB 4RO0A 2JQ4A 2K0DX 2YKQA 4H44D 1E79H 4WY4C 4C46A 2BEQD 2K93A 2CPBA 4H13B 2AVAA 3CI9A 3Q5PA 1SFCA 1SQQD 1KYOI 1PL5A 3V5BA 3RL0g 3OW2O 1URQC 3CX5D 2C9LY 1AJYA 2MKVA 4EIJA 2Y0EA 2AF8A 4COCA 2B9BA 2QJYC 1E5WA 1L0NG 1LTJA 4I2LC 4DZOA 2BQ1E 1FZCC 2B88A 4GDOA 1H0TB 5KKZC 1K30A 3M0DA 4U3FG 4M3LA 1L4AB 1OVUA 2PEQA 1FZFA 1YJNP 1A8OA 3ZDMA 1MFZA 3TGUJ 1Z6MA 1FZEA 3CCJP 4GOFA 5H2FH 1YJWP 2OQQA 2JJLA 3P05A 4Y99B 4YXWH 1JY3O 1EXIA 3O6QB 2FFDC 1JCCA 1J1DB 4OGQD 1PPJE 2XZ0D 3AEGC 2HPCA 3H1IG 4ZKUA 2FXMA 1VKUA 1NU1E 3B5NA 2IFMA 2MR7A 3Q5RA 1GL2B 2AEJA 1SQPD 4OH8B 2J59M 1JNMA 2O01J 1FU1A 2L5GB 5B5EH 2N6YA 1BXIA 1T2KC 2LKIA 4CA3A 1ZW0A 3IF4A 1RF1B 1AUMA 2XZ1C 1IO4A 1JY2N 5BS2A 3CXCO 1DV5A 1XTGB 2HODA 4H13D 1SQBD 3M06A 5HGMA 3GHGA 1PEUA 3M9BA 7CEIA 3HD7B 3H1KE 4YXDC 2Y0DA 4WY4B 1GW4A 2FBWC 1VQ9P 1BCCJ 1PGPA 1T3JA 3P7KA 2GDYA 3ITKA 1L0NK 5CMZA 1BCCE 1PP9E 4NPFX 3CC4P 2M5RA 1SQQG 3V2NA 1LT9A 1URQB 3KXDA 1BE3J 5KLVJ 3LIDA 2XNDH 5CBOA 4H2XC 3CCVP 1GD2E 5KLVE 1HF9A 3N4XA 2QJYB 2YXRB 1JMMA 2XU6A 3HUSA 3G1IA 5KKZB 4NEOA 1X79B 2OARA 1Q81Q 2D2CB 3C1LA 1NAYA 5CCHD 2W6AA 2Z44A 2LXCB 4KHXA 1VQLP 2KSEA 2R5BA 3W67A 2FFDB 2R3CA 2GZJA 3PJSK 2QSIA 1NYHA 2EFJA 3AEFC 1ZMEC 2Q3IA 2W90A 2YO2A 1NTMD 4I1LA 2KW2A 3TSIA 3IAOA 2H89C 2W6BA 2FYNC 3CXHD 5CCGC 3DS0A 3JCUE 1KN7A 2N50A 1H89A 4R4LA 3H1HJ 1SQPG 3G26A 2FYUE 2XZRA 2EHTA 1IFMA 1LJ2A 1BGYJ 2Q7CA 1N73A 3GW6A 4WY4D 2JKVA 1FE6A 2ROQA 1SQQK 1SQBG 1JM0A 1JOCA 2E43A 1URQD 2Z5HA 2H7HA 2QG4A 3CCLP 5BU5A 3BCCJ 2YO3A 2WPRA 3AE6C 1S3JA 1EC5A 1VQ8P 1SQPJ 3O6QA 1SQVD 5APWA 3G29A 1ZLLA 1GU5A 3MIWA 1X9VA 1GDTA 2WSEJ 2NRGA 2LTEA 1JJ2O 1Q82Q 4B86A 1IMPA 2KGCA 5KTBA 1OXZA 3RL0C 3MGNA 2C0XA 1NTKJ 5TJHA 3L70J 1N7SB 4BRYB 1GW3A 5APXA 5AVRB 1HJBA 3WU2H 1NTMG 3M9HA 1SQPK 5CJ4A 2XKMA 1KILE 4D6TE 1NJIQ 2WVRA 5M1BA 2KLUA 1BSNA 1S2EA 4WY4A 2A45G 1FAVA 1T2KD 3KPEA 4QKOA 2W83C 3BRVB 4PD4E 5AW4B 2EHSA 5BU8B 4EDFA 2IBZD 2EG5A 1URQA 4JF7A 1NTKK 1KMIZ 1QVFO 1GTWA 4PD4I 3CWBD 5EW5E 2PEIA 1VQNP 3IN6A 1SQXD 1FZCA 3P8CE 2IZ0A 4F37A 3EQ2A 4IFMA 3SWFA 3QH9A 1NAFA 5APYA 1LTAC 2C9NY 3K5BA 1MZ9A 4NPDA 4YPCA 1OR5A 2KGAA 1VPCA 1QRJA 1EZVE 4IL6X 1M1JC 1Y47A 4RKUJ 1QLED 2H88C 1JCDA 1GMJA 3JSVC 5AVXB 3S4RA 5HGLA 2FFDA 2JO1A 3L71D 1SQVG 1QL1A 3USSA 2GZFA 3AE2C 4U7JA 2P67A 4TLFA 4XFXA 1S1CX 2OYIC 3HUSC 1VF5C 1YQ3C 4OGQC 5C39A 3NTEA 1GK4A 1LTIC 2R5DA 1R5LA 1SLQA 3FGAD 1NTMK 1MZ8A 3RL0B 1VQPP 4EOTA 1NWQA 1KB9E 3G1GA 5EFWB 2Q6QA 4HYTB 2AFEA 5F2NA 1L0IA 4LC1A 1OWAA 5CCGD 1K04A 3GF3A 1K9MQ 5TISE 1ZR2A 1KB9I 2VRSA 1ZR4A 2M3BA 3W68A 4KT0J 2FVFA 3AEEC 2P10A 3A3YB 2CWOA 3VN0A 1FZAA 2L91A 2E76C 1CI6A 4BPFA 2RN0A 1HVVA 1L0LJ 1KQSO 2A06E 4EYYQ 3CCMP 1UIXA 2N1TD 4BPHA 4PH1A 5B66E 2IBZG 2V4HA 2JBGA 3EFGA 3H4EA 1GZLA 2KB7P 1HY8A 3CWBG 4XROA 2OTJP 2KWLA 2HODB 1LTTC 2GZGA 2YMKA 3GHGB 4DJGA 1J2JB 1SQXG 3DPHA 2KSJA 4HKZH 4W80A 1SQVK 3HZQA 3CL3D 1GU4A 1NU1D 4U0FA 1AVOA 3CXHH 3SFEC 1ZNVA 4HJGH 1LTSC 2FVEA 3D71A 1LT9B 3B8EB 2CNRA 1X8YA 1S5LX 4BRYA 1L0LK 2K0YA 4PWVB 3L73D 1LTGC 1JB0J 5CCHC 3L71G 2J5UA 3BVHA 3H1LJ 3V4WA 2OYIB 3HUSB 2JEEA 1VF5B 1NKNA 3RL0D 4OGQB 3A7OA 2JO0A 3H32B 1R5SA 5CCGA 3H1KD 2JWDA 5BVZA 2M3EA 3MHVA 1OMIA 1FR2A 2GDXA 1PP9D 3D6ZA 3WBHA 1ZXGA 2O1JA 4PJ0H 2WSFH 3DS2A 1BAJA 3CLQA 3GF7A 3H1JJ 3L75E 3CMEP 2KP8A 2WQYC 3A0BE 1M57D 1FZGA 1HH0A 5KAIH 1KYOE 1IFNA 3GG2A 3L74J 5HV8A 4GR6A 2E76B 1W2EA 3Q1MA 3CMAP 3GLMA 1SQXK 5AW0B 3AE1C 3SSUA 1S9KD 5F2OA 4BWNA 1N73B 4U0DA 5AVSB 1QVGO 4GT1A 1NKZB 2P2UA 2R3SA 4M0IA 2Z5IA 1KTMA 1NOHA 2QM7A 1RO2A 2E5YA 3L4FA 2L4BA 1VHNA 2GUVA 1RE4C 2CGQA 1Z56A 2WTYA 1NU1G 3FXEA 5AW2B 1KLPA 1NTZD 1U7JA 3TGUE 2MR8A 1VF5D 1OW8A 3HTKB 2WSCJ 1HQBA 2YXQB 3F5HA 1HGVA 3L73G 4EI2A 2YIUB 2LOLA 3S1KA 3EJDA 2OYOA 4R4MA 3CPWO 2JYLA 2SPZA 1HWTC 1IFJA 1L0NJ 3RK3E 1ZN5A 5GTHH 3H1KG 3FWNA 1L0NE 3I56P 4U3FJ 5AVQB 4HKGA 1DD3A 4I7ZB 3TF5A 2PY8A 3M9QA 5GTIH 1BSHA 4I6MC 3VMYA 2LF4A 2ERHA 4TT3H 3FX0A 3HE4B 2E75C 1YBKA 2W27A 1NHLA 2FYZA 4K35A 1YHQP 4UHPB 1AA0A 5KP6B 2Q5UA 2E76D 3U59A 2NZ2A 4XRQA 3HRNA 1YTZI 1N8RQ 4N3YB 2P1JA 2OTKE 5K5GB 3MUDC 3H1IJ 2Z45A 1AYIA 2GYKA 3AE3C 1KYOH 1NH4A 2LMLA 3EWKA 3B4SA 1NVOA 1M1JA 2KR5A 2MF4A 2FY8A 1KV4A 1BE3E 1RQUA 3V2RA 1MKMA 2H43A 1AVYA 5AVUB 2BHVA 2OYIA 1FZCB 2BASA 4U0CA 4D6TD 2VSQA 3MP7B 3H32A 2YMYA 2GZEA 1TU3F 1OZHA 1DEBA 1HJ0A 3RBXA 2KLVA 2IPPA 3HE5B 3CC2P 1NTZG 2WPVB 1T3UA 2H8PD 1JY3N 2ZJSE 5CBNA 4GODA 1SQQJ 4AYCA 4AUWA 2I1JA 3TNUB 2V7QH 1SQQE 2JB0A 2FQ0A 1HGZA 2IZ1A 3P8CD 2L0QA 1P84E 1JMBA 3CX5I 1RE3C 3L72D 3H1HE 4H0LC 4UB6E 1EZVD 4DOJA 2FQ2A 2E75B 1P84I 1BGYE 3H25A 2N1TC 3G4SP 1PEQA 4IL6E 3V4QA 5KJ7C 1EDLA 1PGQA 2KOPA 5AW8B 4PXHB 3VP8A 2DW3A 2FAEA 2N6ZA 3C9IA 1CI6B 4N6JA 3AECC 3EJBA 1VL2A 1FZBA 1YYCA 1ZOYC 2FXPA 3BCCE 4GR2A 1GXGA 3HTKA 3G21A 2HG5D 3G71P 2KODA 3RG2A 5CCHA 1SQPE 3MD0A 2EIAA 2L6EA 2WT7B 4AQRD 1NTZK 1PFIA 2ZYAA 1J1EC 1Q2NA 4D6TG 4U0AA 4IFFA 2M8NA 1SQBJ 2QA4P 1VQ5P 1IUQA 1T6AA 4K3AA 5JPAA 5APQA 1T8ZA 2O3JA 2UWJE 2I1KA 4IPYA 4IOIH 3PP5A 2A06D 4Y28J 1NTKE 2XXMA 2KZIA 1SS1A 3L70E 3HE4A 1JTHA 2KK7A 4HB1A 2OYHC 4WVZA 4N78E 3KZIE 4GIFA 2E5TA 3NY7B 5APSA 3KDPB 1M90Q 2FYNB 3I5CA 4GKGA 3V6IA 3CCRP 3AEBC 1F80D 3E7KA 2E75D 3E2DA 1DD4A 1UJZA 1VQKP 3GKLC 1USDA 3DS4A 1SQBK 3JCUH 3L72G 2BCCD 2K9JA 2FACA 2WSSH 3WUUA 1X0TA 1EZVG 1FC2C 2ZT9C 1DH3A 1L0HA 4UB6H 4PH0A 2N1TB 3G3ZA 1M8OB 2MJZA 1S5LE 2K9YA 3MGEA 4H2YC 2N98A 2JP3A 3LIEA 1NTMJ 3RK2D 2P58A 1RE4A 1IFIA 2HLOA 1DNYA 3FXDA 4LGDE 1JUNA 3CCQP 3SFDC 2B87A 3NTNA 2PEJA 2IYPA 2KGEA 3HE5A 2L22A 4PV1D 1RH5B 2E74D 3TNUA 1IZNB 3WUVA 3CXHI 2A45I 3L75D 3VP9A 1KQFB 3H0DA 1M6EX 1KYOD 3D6YA 3VMAA 1YTZT 1M74A 4C7NA 2NPSC 1UIIA 3FWLA 2CK3H 2A06G 2WMMA 3S9OA 2JYGA 2PP6A 2OYHB 3E1RA 2OGUA 2WSFJ 5DCKA 2MY5A 3GJNA 1QEXA 4MN4C 1D7MA 2K88A 1SQVJ 3C8VA 3OAKA 2KS1A 4H0LD 2N5IA 1SQVE 1PZQA 2MVUA 1ACPA 3MUDA 4ZKPA 3JC22 4OWFA 2FADA 1PGJA 2CG5B 1IFDA 3Q3DA 3DS1A 1DX7A 1L0LE 5KJ7D 2BCCG 3TGUD 4PD4H 3Q2YA 4OVNF 1HBWA 1Y8AA 5HGOA 3GZLA 5E79E 3VRLC 3A5TA 4QNBA 1PPJD 3EJEA 3G0VA 2LXBA 2WT7A 3Q5SA 2RKLA 5APUA 2YNYA 2ONTA 4CPGA 2VLQA 4JPZB 1CZQA 3RK3D 1GK6A 4L75A 3NXSA 2Q1KA 3VYIA 1RF0C 1KILC 3P8MC 2PNGA 2IDBA 5KLIC 2WITA 1DIPA 1M1JB 3CC7P 2Y9ZA 3E1IA 3AEAC 1KC8Q 5KP8B 1QGKB 5AVYB 2BUOA 2QIWA 1L4AC 4MRTC 2ZYGA 3VTPC 2PEMA 2BCCJ 2XT1A 1EDJA 2K0XA 1K8AQ 4XFYA 2ZFCA 3H1LE 1PIXA 3L75G 1YQ4C 4HH2A 2LPKA 4Z1MH 4RESB 3CWBJ 4Y99C 4U0BA 1AV1A 1MUUA 1JY2P 4XE5B 2LIUA 1SQXJ 2IBZI 1A02J 3L36A 1SQXE 1RE3A 1BCCD 4JYBA 5AW9B 3PRJA 2JU2A 2Q3EA 1LNQA 1BE3D 1QL2A 1VDFA 2N1TA 5KLVD 1KB9H 3B5IA 5AW5B 3H1JE 2PRRA 3OA7A 4R0MA 5KJ7A 4L74A 3L71J 2KG6A 2ZYDA 1Q86Q 2M8LA 2L9FA 4LLHA 5TISH 1EDKA 1RF1C 2ZT9D 3L74E 3B5ND 5BS1A 2OTLP 2AXCA 2XV5A 1X3OA 1ZV8A 5APVA 2VLNA 1R8EA 3HD7C 2IFNA 3PH0A 2K3RA 1GPJA 3QWOC 3TGUG 2K5XA 5EJDA 5B66H 1YI2P 2K1AA 2O01N 1PPJG 3CCSP 1JY3P 4XA4A 5E79H 2JGPA 1XTCC 4XFJA 3Q20A 3P32A 3DTJA 3U43A 3BRTB 2Y0CA 1LGHB 1KILB 2KORA 1P84D 3U1AA 5KLIB 2QM8A 3WMM0 1G2CA 3UIAA 3D70A 3AE4C 3H1HD 2FYUD 2KYVA 1NQ4A 1WRGA 3LW5H 4A7PA 3II6A 2OYHA 2MVVA 1G1IA 1ZMBA 1OX3A 2P9XA 2D2CC 4ASVA 1BGYD 1OIPA 2V7QJ 2HFED 2KZJA 2Q9IA 2NPSD 1ZRTE 3AE5C 1G1JA 2IX7C 3EFFK 5L8RJ 2PFXA 1AQTA 3DS5A 3PLNA 4IZ6A 1U7MA 4U3FE 5AW6B 1BCCG 3CCUP 1PP9G 1PEMA 2W6JH 1EQ7A 3KQGA 1NU1J 1JTHB 3BCCD 3IR9A 1K05A 1AF8A 1BE3G 2ITAA 3CE7A 5KLVG 1USEA 5F2KA 1W5CE 2O1KA 1W2BO 3L73J 3RGUA 3L73E 1IMQA 5HVCA 3A0BH 2GZIA 1WMKA 3H1IE 2FVAA 2DGYA 2RMZA 3NFQA 3H1KJ 3RK2C 2K9JB 2WWWA 1AFOA 2NO8A 3OJAB 1NTKD 1IFPA 3M91A 2M5AB 3L70D 1FS0E 1PP9J 1NU1K 4UB8E 3BASA 4XFZA 4DT0A 4N78D 3MTUE 1FDIA 2VLOA 4L73A 3AE7C 1KFMA 1KILD 1LP1B 1RHZB 1BDDA 4PV1C 4DG9A 2KG9A 1M6NA 2E74C 2W8ZA 4QMAA 2B87B 2ZVOB 2LL8A 1L4AD 2NPSA 3A0HE 4PD4D 1KQGB 2KXPB 3H1HG 2FYUG 3VOPA 1RNIA 3GZMA 1BDCA 4WB4A 4L76A 1BGYG 2KIKA 3RG6C 3CX5E 2WSCH 1S9KE 3WU2E 1JO5A 1N7SC 2N5HA 1LTBC 2QE7H 2QRXA 2WPTA 1GXHA 1N7LA 4C7NB 5KLVK 2C0WA 1GL2D 4ASWA 2KNCA 2WPSA 2QJKC 5AVVB 5DJTB 1E6JP 2LKMA 3BCCG 4U0EA 1OVVA 4WBAA 1NTZJ 2FKWB 2M8RA 1KORA 2O01H 1PEOA 1NTZE 2FYUJ 2HYNA 2KS1B 5APTA 4O9BA 3A2AA 3RBZA 1EXJA 4WYMA 1EDIA 1FJPA 1IJDB 3HD7D 3L37A 3T97B 1FDMA 1RF0A 1HTLC 1KILA 2WPQA 1X22A 1LWUC 3RK2B 1RY3A 1L2PA 1KFNA 1H0TA 1IC2A 3RK3C 1NGMB 5AW3B 2J58A 1KB9D 2K37A 1NTKG 3CCEP 3U1CA 5KAFE 1L4AA 3L70G 2HR3A 1SFCC 2Z4EA 2G3AA 2K2QA 2PENA 4PV1B 1Q7YQ 1VQ6P 4UB8H 2FYUK 2E74B 2ZXEB 1U57A 4NPEA 1QX8A 3V2PA 2E42A 3SWYA 1SQBE 1LTJC 2D2CD 2JDIH 5DJUB 1PV3A 2JWAA 3M0DC 1L0LD 1FJKA 1OW6A 3A0HH 2KOOA 2LIWA 1LT1A 1GL2A 1IK9A 1H88A 1EIAA 4COPA 1VQOP 1S4XA 5AW1B 1Q90D 2M8PA 1VQMP 2K94A 2KOGA 1RF1A 1EMVA 3VMZA 3CX5H 2QEXP 3BATA 2PEOA 3AE9C 4H0LB 4D6TJ 2CPSA 2VLPA 2IYOA 3TYYA 2QJKB 1JEKA 4JQ0D 2FQ1A 1P84H 2JU1A 3HD7A 2BEZF 1Y9BA 5CHXA 1S72P 3AE8C 4YTPC 2N9BA 3B5NC 4H2WC 5AVTB 2M5AA 3NMDA 5AVZB 5I4TG 1VQ7P 1OW7A 2QVAA 4H44C 1LP1A 3WUTA 3H1LD 1RO0A 4IL6H 4JYCA 1NTME 1K73Q 2P7JA 4WWIA 2K92A 2R32A 1LWUB 1D1DA 2CQ8A 1OVRA 3GHGC 2KGDA 2I8DA 3CXHE 1ZP0C 3RK3B 1A43A 2JAZA 3F89A 3L72J 3M1MA 4BPGA 2KOSA 1SFCB 2QJPC 3L72E 3CD6P 1SVFA 5AVWB 3H1JD 3I55P 5KP7B 2Y9YA 1LT9C 1YIJP 5KAFH 3G9RA 1J1EB 3MZWB 3TK1A 2WZ7A 4RJTA 2AXTE 1DEEG 1CW5A 1M7LA 3B71A 2WSEH 1EZVI 1LTJB 2XDJA 2YKOA 3L74D 4BXLA 1G2CB 1PGOA 3G28A 1SP4A 3V2QA 4C7RA 2LR2A 4KJMA 1L0LG 3IFMA 1N7SD 2YKPA 4PJ0E 2JR8A 3R4YA 2KI7B 1T8KA 1E0HA 2KG8A 5CZDB 3KZIH 3PHLA 2GA1A 3B4QA 1KQLA 4GOEA 2N9YB 5KAIE 2DNWA 3T97A 2X2BA 2HPCB 2XV6A 5CJ0A 1IK7A 3HYBA 4IFDK 1A02F 1FOSF 3PTZA 1HUCA 3GMAA 3KHUA 4ZNCA 2ZT9B 3DS3A 1YITP 3R2PA 4ZMDA 3B5NB 2AFDA 1AQ5A 4W7ZA 1H8AA 4H13C 2FHSC 2FXOA 1RQVA 3VMXA 4H44B 3H6PA 2PEKA 3H1LG 2POHA 1ZRTD 2AEFA 1S5LH 1N73C 2MD9A 1KD1Q 1MFTA 1L0ND 2KUBA 2B89A 1SFCD 2Z46A 3N7NA 4U3FD 1WT6A 3L35A 1EOQA 5AW7B 5H2FE 3G6EP 2G8YA 3LW5J 2QJPB 2A45H 1FBMA 2E1MA 3TDKA 3SWKA 2IBZE 2PGDA 2BCCE 1YJ9P 3H1JG 1N7SA 2ZVNB 1OFCX 2RH0A 3CWBE 2XNXA 1M1KQ 1J1DC 2GDWA 1NO4A 2ZAEB 3H1ID 2ZXXA 2NPSB 2GUSA 5GTHE 2YIUC 3L74G 1FOSE 1N86A 1KZUB 2AXTH 3O8ZA 3M0AA 2AEMA 5GTIE 2M0BA 3KYQA 1CEIA 3H47A 1GL2C 5B5EE 2R44A 1MV8A 1UNKA 3LMOA 3ABVC 2QNWA 4I7ZC 2GM4A 3LRYA 1FDOA 1VQ4P 4DCKA 3L71E 5HGNA 4JBZA 3L75J 1JY2O 4W7YA
chains in the Genus database with same CATH topology
2JO0A 3DS0A 4U0AA 1RO0A 3Q20A 3CC2P 4XFZA 3G1GA 2M8NA 3CC7P 2QA4P 1VQ5P 1IUQA 1AUMA 1NJIQ 3CPWO 5F2NA 2JYLA 3DTJA 1KC8Q 5JPAA 1K73Q 3G26A 3CCEP 3H0DA 2BUOA 5BS2A 3CXCO 1K9MQ 1M6EX 4IPYA 2PEKA 2PEMA 1D1DA 1M6NA 3WBHA 2XT1A 3DS2A 1BAJA 2XXMA 5HGMA 1K8AQ 3I56P 1PEUA 4XFYA 1A43A 1M74A 1KD1Q 2PENA 1Q7YQ 2PY8A 2EG5A 1ZMBA 3OW2O 1VQ6P 2P9XA 3M1MA 2CWOA 4U0BA 1VQ9P 2LF4A 3CMEP 2Z46A 3CD6P 2JYGA 1M90Q 1QVFO 1KQSO 3I55P 3CCRP 1YHQP 3CCMP 3CC4P 5DCKA 1EOQA 1YIJP 4PH1A 1RNIA 4COCA 3G6EP 2PEIA 1VQNP 2BQ1E 4GR6A 3H4EA 3CCLP 2E1MA 3E2DA 3CCVP 1K30A 4XRQA 3RG6C 1VQKP 1N8RQ 3CMAP 1YJ9P 3DS5A 3DS4A 4XROA 2Z45A 3G4SP 2OTJP 2PEQA 1PEQA 3G28A 3CCUP 1YJNP 3B5IA 1PEMA 1A8OA 5F2OA 3G1IA 1VQ8P 1M1KQ 1EIAA 4U0DA 1QVGO 3DPHA 4COPA 1QRJA 1VQOP 3CCJP 4M0IA 2M8LA 1YJWP 3G29A 4PH0A 1Q86Q 3P05A 2OARA 3DS1A 3HZQA 1Q81Q 5F2KA 2M8PA 4U0FA 1VQMP 5HGLA 1RO2A 3MGEA 1E6JP 1W2BO 2QEXP 2Z44A 5HGOA 5BS1A 2PEOA 4U0EA 2OTLP 1VQLP 3VRLC 1JJ2O 4QNBA 4XFXA 1Q82Q 3H47A 3G0VA 4GR2A 2BHVA 1PEOA 3G21A 3CCQP 2EFJA 3G71P 2KODA 2XV6A 1S72P 2DGYA 4U0CA 2PEJA 3LRYA 3NTEA 2ONTA 4WYMA 2EIAA 1YI2P 2L6EA 3HYBA 1VQ4P 5HGNA 5I4TG 3CCSP 1VQPP 1VQ7P 3DS3A 1YITP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTL P;  1VQL P;  1Q7Y Q;  1JJ2 O;  1VQ6 P;  2OTJ P;  3G4S P;  3OW2 O;  1Q82 Q;  3CC2 P;  1VQ9 P;  3CCU P;  1YJN P;  3CME P;  3CC7 P;  2QA4 P;  1VQ8 P;  3CD6 P;  1M1K Q;  1VQ5 P;  1M90 Q;  1NJI Q;  3CPW O;  1QVG O;  1KC8 Q;  3CC4 P;  3CCQ P;  1QVF O;  3G71 P;  1KQS O;  3CCR P;  3I55 P;  1YHQ P;  3CCM P;  2QEX P;  1VQO P;  1S72 P;  3CCJ P;  1YIJ P;  1K73 Q;  3CCE P;  1Q86 Q;  1N8R Q;  3CXC O;  1YJW P;  1K9M Q;  3G6E P;  1YI2 P;  1VQ4 P;  1VQN P;  1Q81 Q;  1VQM P;  3CCL P;  1K8A Q;  3I56 P;  3CCS P;  3CCV P;  1VQK P;  1VQP P;  1W2B O;  1KD1 Q;  1VQ7 P;  1YIT P;  3CMA P;  1YJ9 P; 
#chains in the Genus database with same CATH topology
 1N2D C;  2PAJ A;  1CSB A;  3AED C;  2KOQ A;  1M56 D;  1LWU A;  2KNC B;  4RO0 A;  2JQ4 A;  2K0D X;  2YKQ A;  4H44 D;  1E79 H;  4WY4 C;  4C46 A;  2BEQ D;  2K93 A;  2CPB A;  4H13 B;  2AVA A;  3CI9 A;  3Q5P A;  1SFC A;  1SQQ D;  1KYO I;  1PL5 A;  3V5B A;  3RL0 g;  3OW2 O;  1URQ C;  3CX5 D;  2C9L Y;  1AJY A;  2MKV A;  4EIJ A;  2Y0E A;  2AF8 A;  4COC A;  2B9B A;  2QJY C;  1E5W A;  1L0N G;  1LTJ A;  4I2L C;  4DZO A;  2BQ1 E;  1FZC C;  2B88 A;  4GDO A;  1H0T B;  5KKZ C;  1K30 A;  3M0D A;  4U3F G;  4M3L A;  1L4A B;  1OVU A;  2PEQ A;  1FZF A;  1YJN P;  1A8O A;  3ZDM A;  1MFZ A;  3TGU J;  1Z6M A;  1FZE A;  3CCJ P;  4GOF A;  5H2F H;  1YJW P;  2OQQ A;  2JJL A;  3P05 A;  4Y99 B;  4YXW H;  1JY3 O;  1EXI A;  3O6Q B;  2FFD C;  1JCC A;  1J1D B;  4OGQ D;  1PPJ E;  2XZ0 D;  3AEG C;  2HPC A;  3H1I G;  4ZKU A;  2FXM A;  1VKU A;  1NU1 E;  3B5N A;  2IFM A;  2MR7 A;  3Q5R A;  1GL2 B;  2AEJ A;  1SQP D;  4OH8 B;  2J59 M;  1JNM A;  2O01 J;  1FU1 A;  2L5G B;  5B5E H;  2N6Y A;  1BXI A;  1T2K C;  2LKI A;  4CA3 A;  1ZW0 A;  3IF4 A;  1RF1 B;  1AUM A;  2XZ1 C;  1IO4 A;  1JY2 N;  5BS2 A;  3CXC O;  1DV5 A;  1XTG B;  2HOD A;  4H13 D;  1SQB D;  3M06 A;  5HGM A;  3GHG A;  1PEU A;  3M9B A;  7CEI A;  3HD7 B;  3H1K E;  4YXD C;  2Y0D A;  4WY4 B;  1GW4 A;  2FBW C;  1VQ9 P;  1BCC J;  1PGP A;  1T3J A;  3P7K A;  2GDY A;  3ITK A;  1L0N K;  5CMZ A;  1BCC E;  1PP9 E;  4NPF X;  3CC4 P;  2M5R A;  1SQQ G;  3V2N A;  1LT9 A;  1URQ B;  3KXD A;  1BE3 J;  5KLV J;  3LID A;  2XND H;  5CBO A;  4H2X C;  3CCV P;  1GD2 E;  5KLV E;  1HF9 A;  3N4X A;  2QJY B;  2YXR B;  1JMM A;  2XU6 A;  3HUS A;  3G1I A;  5KKZ B;  4NEO A;  1X79 B;  2OAR A;  1Q81 Q;  2D2C B;  3C1L A;  1NAY A;  5CCH D;  2W6A A;  2Z44 A;  2LXC B;  4KHX A;  1VQL P;  2KSE A;  2R5B A;  3W67 A;  2FFD B;  2R3C A;  2GZJ A;  3PJS K;  2QSI A;  1NYH A;  2EFJ A;  3AEF C;  1ZME C;  2Q3I A;  2W90 A;  2YO2 A;  1NTM D;  4I1L A;  2KW2 A;  3TSI A;  3IAO A;  2H89 C;  2W6B A;  2FYN C;  3CXH D;  5CCG C;  3DS0 A;  3JCU E;  1KN7 A;  2N50 A;  1H89 A;  4R4L A;  3H1H J;  1SQP G;  3G26 A;  2FYU E;  2XZR A;  2EHT A;  1IFM A;  1LJ2 A;  1BGY J;  2Q7C A;  1N73 A;  3GW6 A;  4WY4 D;  2JKV A;  1FE6 A;  2ROQ A;  1SQQ K;  1SQB G;  1JM0 A;  1JOC A;  2E43 A;  1URQ D;  2Z5H A;  2H7H A;  2QG4 A;  3CCL P;  5BU5 A;  3BCC J;  2YO3 A;  2WPR A;  3AE6 C;  1S3J A;  1EC5 A;  1VQ8 P;  1SQP J;  3O6Q A;  1SQV D;  5APW A;  3G29 A;  1ZLL A;  1GU5 A;  3MIW A;  1X9V A;  1GDT A;  2WSE J;  2NRG A;  2LTE A;  1JJ2 O;  1Q82 Q;  4B86 A;  1IMP A;  2KGC A;  5KTB A;  1OXZ A;  3RL0 C;  3MGN A;  2C0X A;  1NTK J;  5TJH A;  3L70 J;  1N7S B;  4BRY B;  1GW3 A;  5APX A;  5AVR B;  1HJB A;  3WU2 H;  1NTM G;  3M9H A;  1SQP K;  5CJ4 A;  2XKM A;  1KIL E;  4D6T E;  1NJI Q;  2WVR A;  5M1B A;  2KLU A;  1BSN A;  1S2E A;  4WY4 A;  2A45 G;  1FAV A;  1T2K D;  3KPE A;  4QKO A;  2W83 C;  3BRV B;  4PD4 E;  5AW4 B;  2EHS A;  5BU8 B;  4EDF A;  2IBZ D;  2EG5 A;  1URQ A;  4JF7 A;  1NTK K;  1KMI Z;  1QVF O;  1GTW A;  4PD4 I;  3CWB D;  5EW5 E;  2PEI A;  1VQN P;  3IN6 A;  1SQX D;  1FZC A;  3P8C E;  2IZ0 A;  4F37 A;  3EQ2 A;  4IFM A;  3SWF A;  3QH9 A;  1NAF A;  5APY A;  1LTA C;  2C9N Y;  3K5B A;  1MZ9 A;  4NPD A;  4YPC A;  1OR5 A;  2KGA A;  1VPC A;  1QRJ A;  1EZV E;  4IL6 X;  1M1J C;  1Y47 A;  4RKU J;  1QLE D;  2H88 C;  1JCD A;  1GMJ A;  3JSV C;  5AVX B;  3S4R A;  5HGL A;  2FFD A;  2JO1 A;  3L71 D;  1SQV G;  1QL1 A;  3USS A;  2GZF A;  3AE2 C;  4U7J A;  2P67 A;  4TLF A;  4XFX A;  1S1C X;  2OYI C;  3HUS C;  1VF5 C;  1YQ3 C;  4OGQ C;  5C39 A;  3NTE A;  1GK4 A;  1LTI C;  2R5D A;  1R5L A;  1SLQ A;  3FGA D;  1NTM K;  1MZ8 A;  3RL0 B;  1VQP P;  4EOT A;  1NWQ A;  1KB9 E;  3G1G A;  5EFW B;  2Q6Q A;  4HYT B;  2AFE A;  5F2N A;  1L0I A;  4LC1 A;  1OWA A;  5CCG D;  1K04 A;  3GF3 A;  1K9M Q;  5TIS E;  1ZR2 A;  1KB9 I;  2VRS A;  1ZR4 A;  2M3B A;  3W68 A;  4KT0 J;  2FVF A;  3AEE C;  2P10 A;  3A3Y B;  2CWO A;  3VN0 A;  1FZA A;  2L91 A;  2E76 C;  1CI6 A;  4BPF A;  2RN0 A;  1HVV A;  1L0L J;  1KQS O;  2A06 E;  4EYY Q;  3CCM P;  1UIX A;  2N1T D;  4BPH A;  4PH1 A;  5B66 E;  2IBZ G;  2V4H A;  2JBG A;  3EFG A;  3H4E A;  1GZL A;  2KB7 P;  1HY8 A;  3CWB G;  4XRO A;  2OTJ P;  2KWL A;  2HOD B;  1LTT C;  2GZG A;  2YMK A;  3GHG B;  4DJG A;  1J2J B;  1SQX G;  3DPH A;  2KSJ A;  4HKZ H;  4W80 A;  1SQV K;  3HZQ A;  3CL3 D;  1GU4 A;  1NU1 D;  4U0F A;  1AVO A;  3CXH H;  3SFE C;  1ZNV A;  4HJG H;  1LTS C;  2FVE A;  3D71 A;  1LT9 B;  3B8E B;  2CNR A;  1X8Y A;  1S5L X;  4BRY A;  1L0L K;  2K0Y A;  4PWV B;  3L73 D;  1LTG C;  1JB0 J;  5CCH C;  3L71 G;  2J5U A;  3BVH A;  3H1L J;  3V4W A;  2OYI B;  3HUS B;  2JEE A;  1VF5 B;  1NKN A;  3RL0 D;  4OGQ B;  3A7O A;  2JO0 A;  3H32 B;  1R5S A;  5CCG A;  3H1K D;  2JWD A;  5BVZ A;  2M3E A;  3MHV A;  1OMI A;  1FR2 A;  2GDX A;  1PP9 D;  3D6Z A;  3WBH A;  1ZXG A;  2O1J A;  4PJ0 H;  2WSF H;  3DS2 A;  1BAJ A;  3CLQ A;  3GF7 A;  3H1J J;  3L75 E;  3CME P;  2KP8 A;  2WQY C;  3A0B E;  1M57 D;  1FZG A;  1HH0 A;  5KAI H;  1KYO E;  1IFN A;  3GG2 A;  3L74 J;  5HV8 A;  4GR6 A;  2E76 B;  1W2E A;  3Q1M A;  3CMA P;  3GLM A;  1SQX K;  5AW0 B;  3AE1 C;  3SSU A;  1S9K D;  5F2O A;  4BWN A;  1N73 B;  4U0D A;  5AVS B;  1QVG O;  4GT1 A;  1NKZ B;  2P2U A;  2R3S A;  4M0I A;  2Z5I A;  1KTM A;  1NOH A;  2QM7 A;  1RO2 A;  2E5Y A;  3L4F A;  2L4B A;  1VHN A;  2GUV A;  1RE4 C;  2CGQ A;  1Z56 A;  2WTY A;  1NU1 G;  3FXE A;  5AW2 B;  1KLP A;  1NTZ D;  1U7J A;  3TGU E;  2MR8 A;  1VF5 D;  1OW8 A;  3HTK B;  2WSC J;  1HQB A;  2YXQ B;  3F5H A;  1HGV A;  3L73 G;  4EI2 A;  2YIU B;  2LOL A;  3S1K A;  3EJD A;  2OYO A;  4R4M A;  3CPW O;  2JYL A;  2SPZ A;  1HWT C;  1IFJ A;  1L0N J;  3RK3 E;  1ZN5 A;  5GTH H;  3H1K G;  3FWN A;  1L0N E;  3I56 P;  4U3F J;  5AVQ B;  4HKG A;  1DD3 A;  4I7Z B;  3TF5 A;  2PY8 A;  3M9Q A;  5GTI H;  1BSH A;  4I6M C;  3VMY A;  2LF4 A;  2ERH A;  4TT3 H;  3FX0 A;  3HE4 B;  2E75 C;  1YBK A;  2W27 A;  1NHL A;  2FYZ A;  4K35 A;  1YHQ P;  4UHP B;  1AA0 A;  5KP6 B;  2Q5U A;  2E76 D;  3U59 A;  2NZ2 A;  4XRQ A;  3HRN A;  1YTZ I;  1N8R Q;  4N3Y B;  2P1J A;  2OTK E;  5K5G B;  3MUD C;  3H1I J;  2Z45 A;  1AYI A;  2GYK A;  3AE3 C;  1KYO H;  1NH4 A;  2LML A;  3EWK A;  3B4S A;  1NVO A;  1M1J A;  2KR5 A;  2MF4 A;  2FY8 A;  1KV4 A;  1BE3 E;  1RQU A;  3V2R A;  1MKM A;  2H43 A;  1AVY A;  5AVU B;  2BHV A;  2OYI A;  1FZC B;  2BAS A;  4U0C A;  4D6T D;  2VSQ A;  3MP7 B;  3H32 A;  2YMY A;  2GZE A;  1TU3 F;  1OZH A;  1DEB A;  1HJ0 A;  3RBX A;  2KLV A;  2IPP A;  3HE5 B;  3CC2 P;  1NTZ G;  2WPV B;  1T3U A;  2H8P D;  1JY3 N;  2ZJS E;  5CBN A;  4GOD A;  1SQQ J;  4AYC A;  4AUW A;  2I1J A;  3TNU B;  2V7Q H;  1SQQ E;  2JB0 A;  2FQ0 A;  1HGZ A;  2IZ1 A;  3P8C D;  2L0Q A;  1P84 E;  1JMB A;  3CX5 I;  1RE3 C;  3L72 D;  3H1H E;  4H0L C;  4UB6 E;  1EZV D;  4DOJ A;  2FQ2 A;  2E75 B;  1P84 I;  1BGY E;  3H25 A;  2N1T C;  3G4S P;  1PEQ A;  4IL6 E;  3V4Q A;  5KJ7 C;  1EDL A;  1PGQ A;  2KOP A;  5AW8 B;  4PXH B;  3VP8 A;  2DW3 A;  2FAE A;  2N6Z A;  3C9I A;  1CI6 B;  4N6J A;  3AEC C;  3EJB A;  1VL2 A;  1FZB A;  1YYC A;  1ZOY C;  2FXP A;  3BCC E;  4GR2 A;  1GXG A;  3HTK A;  3G21 A;  2HG5 D;  3G71 P;  2KOD A;  3RG2 A;  5CCH A;  1SQP E;  3MD0 A;  2EIA A;  2L6E A;  2WT7 B;  4AQR D;  1NTZ K;  1PFI A;  2ZYA A;  1J1E C;  1Q2N A;  4D6T G;  4U0A A;  4IFF A;  2M8N A;  1SQB J;  2QA4 P;  1VQ5 P;  1IUQ A;  1T6A A;  4K3A A;  5JPA A;  5APQ A;  1T8Z A;  2O3J A;  2UWJ E;  2I1K A;  4IPY A;  4IOI H;  3PP5 A;  2A06 D;  4Y28 J;  1NTK E;  2XXM A;  2KZI A;  1SS1 A;  3L70 E;  3HE4 A;  1JTH A;  2KK7 A;  4HB1 A;  2OYH C;  4WVZ A;  4N78 E;  3KZI E;  4GIF A;  2E5T A;  3NY7 B;  5APS A;  3KDP B;  1M90 Q;  2FYN B;  3I5C A;  4GKG A;  3V6I A;  3CCR P;  3AEB C;  1F80 D;  3E7K A;  2E75 D;  3E2D A;  1DD4 A;  1UJZ A;  1VQK P;  3GKL C;  1USD A;  3DS4 A;  1SQB K;  3JCU H;  3L72 G;  2BCC D;  2K9J A;  2FAC A;  2WSS H;  3WUU A;  1X0T A;  1EZV G;  1FC2 C;  2ZT9 C;  1DH3 A;  1L0H A;  4UB6 H;  4PH0 A;  2N1T B;  3G3Z A;  1M8O B;  2MJZ A;  1S5L E;  2K9Y A;  3MGE A;  4H2Y C;  2N98 A;  2JP3 A;  3LIE A;  1NTM J;  3RK2 D;  2P58 A;  1RE4 A;  1IFI A;  2HLO A;  1DNY A;  3FXD A;  4LGD E;  1JUN A;  3CCQ P;  3SFD C;  2B87 A;  3NTN A;  2PEJ A;  2IYP A;  2KGE A;  3HE5 A;  2L22 A;  4PV1 D;  1RH5 B;  2E74 D;  3TNU A;  1IZN B;  3WUV A;  3CXH I;  2A45 I;  3L75 D;  3VP9 A;  1KQF B;  3H0D A;  1M6E X;  1KYO D;  3D6Y A;  3VMA A;  1YTZ T;  1M74 A;  4C7N A;  2NPS C;  1UII A;  3FWL A;  2CK3 H;  2A06 G;  2WMM A;  3S9O A;  2JYG A;  2PP6 A;  2OYH B;  3E1R A;  2OGU A;  2WSF J;  5DCK A;  2MY5 A;  3GJN A;  1QEX A;  4MN4 C;  1D7M A;  2K88 A;  1SQV J;  3C8V A;  3OAK A;  2KS1 A;  4H0L D;  2N5I A;  1SQV E;  1PZQ A;  2MVU A;  1ACP A;  3MUD A;  4ZKP A;  3JC2 2;  4OWF A;  2FAD A;  1PGJ A;  2CG5 B;  1IFD A;  3Q3D A;  3DS1 A;  1DX7 A;  1L0L E;  5KJ7 D;  2BCC G;  3TGU D;  4PD4 H;  3Q2Y A;  4OVN F;  1HBW A;  1Y8A A;  5HGO A;  3GZL A;  5E79 E;  3VRL C;  3A5T A;  4QNB A;  1PPJ D;  3EJE A;  3G0V A;  2LXB A;  2WT7 A;  3Q5S A;  2RKL A;  5APU A;  2YNY A;  2ONT A;  4CPG A;  2VLQ A;  4JPZ B;  1CZQ A;  3RK3 D;  1GK6 A;  4L75 A;  3NXS A;  2Q1K A;  3VYI A;  1RF0 C;  1KIL C;  3P8M C;  2PNG A;  2IDB A;  5KLI C;  2WIT A;  1DIP A;  1M1J B;  3CC7 P;  2Y9Z A;  3E1I A;  3AEA C;  1KC8 Q;  5KP8 B;  1QGK B;  5AVY B;  2BUO A;  2QIW A;  1L4A C;  4MRT C;  2ZYG A;  3VTP C;  2PEM A;  2BCC J;  2XT1 A;  1EDJ A;  2K0X A;  1K8A Q;  4XFY A;  2ZFC A;  3H1L E;  1PIX A;  3L75 G;  1YQ4 C;  4HH2 A;  2LPK A;  4Z1M H;  4RES B;  3CWB J;  4Y99 C;  4U0B A;  1AV1 A;  1MUU A;  1JY2 P;  4XE5 B;  2LIU A;  1SQX J;  2IBZ I;  1A02 J;  3L36 A;  1SQX E;  1RE3 A;  1BCC D;  4JYB A;  5AW9 B;  3PRJ A;  2JU2 A;  2Q3E A;  1LNQ A;  1BE3 D;  1QL2 A;  1VDF A;  2N1T A;  5KLV D;  1KB9 H;  3B5I A;  5AW5 B;  3H1J E;  2PRR A;  3OA7 A;  4R0M A;  5KJ7 A;  4L74 A;  3L71 J;  2KG6 A;  2ZYD A;  1Q86 Q;  2M8L A;  2L9F A;  4LLH A;  5TIS H;  1EDK A;  1RF1 C;  2ZT9 D;  3L74 E;  3B5N D;  5BS1 A;  2OTL P;  2AXC A;  2XV5 A;  1X3O A;  1ZV8 A;  5APV A;  2VLN A;  1R8E A;  3HD7 C;  2IFN A;  3PH0 A;  2K3R A;  1GPJ A;  3QWO C;  3TGU G;  2K5X A;  5EJD A;  5B66 H;  1YI2 P;  2K1A A;  2O01 N;  1PPJ G;  3CCS P;  1JY3 P;  4XA4 A;  5E79 H;  2JGP A;  1XTC C;  4XFJ A;  3Q20 A;  3P32 A;  3DTJ A;  3U43 A;  3BRT B;  2Y0C A;  1LGH B;  1KIL B;  2KOR A;  1P84 D;  3U1A A;  5KLI B;  2QM8 A;  3WMM 0;  1G2C A;  3UIA A;  3D70 A;  3AE4 C;  3H1H D;  2FYU D;  2KYV A;  1NQ4 A;  1WRG A;  3LW5 H;  4A7P A;  3II6 A;  2OYH A;  2MVV A;  1G1I A;  1ZMB A;  1OX3 A;  2P9X A;  2D2C C;  4ASV A;  1BGY D;  1OIP A;  2V7Q J;  2HFE D;  2KZJ A;  2Q9I A;  2NPS D;  1ZRT E;  3AE5 C;  1G1J A;  2IX7 C;  3EFF K;  5L8R J;  2PFX A;  1AQT A;  3DS5 A;  3PLN A;  4IZ6 A;  1U7M A;  4U3F E;  5AW6 B;  1BCC G;  3CCU P;  1PP9 G;  1PEM A;  2W6J H;  1EQ7 A;  3KQG A;  1NU1 J;  1JTH B;  3BCC D;  3IR9 A;  1K05 A;  1AF8 A;  1BE3 G;  2ITA A;  3CE7 A;  5KLV G;  1USE A;  5F2K A;  1W5C E;  2O1K A;  1W2B O;  3L73 J;  3RGU A;  3L73 E;  1IMQ A;  5HVC A;  3A0B H;  2GZI A;  1WMK A;  3H1I E;  2FVA A;  2DGY A;  2RMZ A;  3NFQ A;  3H1K J;  3RK2 C;  2K9J B;  2WWW A;  1AFO A;  2NO8 A;  3OJA B;  1NTK D;  1IFP A;  3M91 A;  2M5A B;  3L70 D;  1FS0 E;  1PP9 J;  1NU1 K;  4UB8 E;  3BAS A;  4XFZ A;  4DT0 A;  4N78 D;  3MTU E;  1FDI A;  2VLO A;  4L73 A;  3AE7 C;  1KFM A;  1KIL D;  1LP1 B;  1RHZ B;  1BDD A;  4PV1 C;  4DG9 A;  2KG9 A;  1M6N A;  2E74 C;  2W8Z A;  4QMA A;  2B87 B;  2ZVO B;  2LL8 A;  1L4A D;  2NPS A;  3A0H E;  4PD4 D;  1KQG B;  2KXP B;  3H1H G;  2FYU G;  3VOP A;  1RNI A;  3GZM A;  1BDC A;  4WB4 A;  4L76 A;  1BGY G;  2KIK A;  3RG6 C;  3CX5 E;  2WSC H;  1S9K E;  3WU2 E;  1JO5 A;  1N7S C;  2N5H A;  1LTB C;  2QE7 H;  2QRX A;  2WPT A;  1GXH A;  1N7L A;  4C7N B;  5KLV K;  2C0W A;  1GL2 D;  4ASW A;  2KNC A;  2WPS A;  2QJK C;  5AVV B;  5DJT B;  1E6J P;  2LKM A;  3BCC G;  4U0E A;  1OVV A;  4WBA A;  1NTZ J;  2FKW B;  2M8R A;  1KOR A;  2O01 H;  1PEO A;  1NTZ E;  2FYU J;  2HYN A;  2KS1 B;  5APT A;  4O9B A;  3A2A A;  3RBZ A;  1EXJ A;  4WYM A;  1EDI A;  1FJP A;  1IJD B;  3HD7 D;  3L37 A;  3T97 B;  1FDM A;  1RF0 A;  1HTL C;  1KIL A;  2WPQ A;  1X22 A;  1LWU C;  3RK2 B;  1RY3 A;  1L2P A;  1KFN A;  1H0T A;  1IC2 A;  3RK3 C;  1NGM B;  5AW3 B;  2J58 A;  1KB9 D;  2K37 A;  1NTK G;  3CCE P;  3U1C A;  5KAF E;  1L4A A;  3L70 G;  2HR3 A;  1SFC C;  2Z4E A;  2G3A A;  2K2Q A;  2PEN A;  4PV1 B;  1Q7Y Q;  1VQ6 P;  4UB8 H;  2FYU K;  2E74 B;  2ZXE B;  1U57 A;  4NPE A;  1QX8 A;  3V2P A;  2E42 A;  3SWY A;  1SQB E;  1LTJ C;  2D2C D;  2JDI H;  5DJU B;  1PV3 A;  2JWA A;  3M0D C;  1L0L D;  1FJK A;  1OW6 A;  3A0H H;  2KOO A;  2LIW A;  1LT1 A;  1GL2 A;  1IK9 A;  1H88 A;  1EIA A;  4COP A;  1VQO P;  1S4X A;  5AW1 B;  1Q90 D;  2M8P A;  1VQM P;  2K94 A;  2KOG A;  1RF1 A;  1EMV A;  3VMZ A;  3CX5 H;  2QEX P;  3BAT A;  2PEO A;  3AE9 C;  4H0L B;  4D6T J;  2CPS A;  2VLP A;  2IYO A;  3TYY A;  2QJK B;  1JEK A;  4JQ0 D;  2FQ1 A;  1P84 H;  2JU1 A;  3HD7 A;  2BEZ F;  1Y9B A;  5CHX A;  1S72 P;  3AE8 C;  4YTP C;  2N9B A;  3B5N C;  4H2W C;  5AVT B;  2M5A A;  3NMD A;  5AVZ B;  5I4T G;  1VQ7 P;  1OW7 A;  2QVA A;  4H44 C;  1LP1 A;  3WUT A;  3H1L D;  1RO0 A;  4IL6 H;  4JYC A;  1NTM E;  1K73 Q;  2P7J A;  4WWI A;  2K92 A;  2R32 A;  1LWU B;  1D1D A;  2CQ8 A;  1OVR A;  3GHG C;  2KGD A;  2I8D A;  3CXH E;  1ZP0 C;  3RK3 B;  1A43 A;  2JAZ A;  3F89 A;  3L72 J;  3M1M A;  4BPG A;  2KOS A;  1SFC B;  2QJP C;  3L72 E;  3CD6 P;  1SVF A;  5AVW B;  3H1J D;  3I55 P;  5KP7 B;  2Y9Y A;  1LT9 C;  1YIJ P;  5KAF H;  3G9R A;  1J1E B;  3MZW B;  3TK1 A;  2WZ7 A;  4RJT A;  2AXT E;  1DEE G;  1CW5 A;  1M7L A;  3B71 A;  2WSE H;  1EZV I;  1LTJ B;  2XDJ A;  2YKO A;  3L74 D;  4BXL A;  1G2C B;  1PGO A;  3G28 A;  1SP4 A;  3V2Q A;  4C7R A;  2LR2 A;  4KJM A;  1L0L G;  3IFM A;  1N7S D;  2YKP A;  4PJ0 E;  2JR8 A;  3R4Y A;  2KI7 B;  1T8K A;  1E0H A;  2KG8 A;  5CZD B;  3KZI H;  3PHL A;  2GA1 A;  3B4Q A;  1KQL A;  4GOE A;  2N9Y B;  5KAI E;  2DNW A;  3T97 A;  2X2B A;  2HPC B;  2XV6 A;  5CJ0 A;  1IK7 A;  3HYB A;  4IFD K;  1A02 F;  1FOS F;  3PTZ A;  1HUC A;  3GMA A;  3KHU A;  4ZNC A;  2ZT9 B;  3DS3 A;  1YIT P;  3R2P A;  4ZMD A;  3B5N B;  2AFD A;  1AQ5 A;  4W7Z A;  1H8A A;  4H13 C;  2FHS C;  2FXO A;  1RQV A;  3VMX A;  4H44 B;  3H6P A;  2PEK A;  3H1L G;  2POH A;  1ZRT D;  2AEF A;  1S5L H;  1N73 C;  2MD9 A;  1KD1 Q;  1MFT A;  1L0N D;  2KUB A;  2B89 A;  1SFC D;  2Z46 A;  3N7N A;  4U3F D;  1WT6 A;  3L35 A;  1EOQ A;  5AW7 B;  5H2F E;  3G6E P;  2G8Y A;  3LW5 J;  2QJP B;  2A45 H;  1FBM A;  2E1M A;  3TDK A;  3SWK A;  2IBZ E;  2PGD A;  2BCC E;  1YJ9 P;  3H1J G;  1N7S A;  2ZVN B;  1OFC X;  2RH0 A;  3CWB E;  2XNX A;  1M1K Q;  1J1D C;  2GDW A;  1NO4 A;  2ZAE B;  3H1I D;  2ZXX A;  2NPS B;  2GUS A;  5GTH E;  2YIU C;  3L74 G;  1FOS E;  1N86 A;  1KZU B;  2AXT H;  3O8Z A;  3M0A A;  2AEM A;  5GTI E;  2M0B A;  3KYQ A;  1CEI A;  3H47 A;  1GL2 C;  5B5E E;  2R44 A;  1MV8 A;  1UNK A;  3LMO A;  3ABV C;  2QNW A;  4I7Z C;  2GM4 A;  3LRY A;  1FDO A;  1VQ4 P;  4DCK A;  3L71 E;  5HGN A;  4JBZ A;  3L75 J;  1JY2 O;  4W7Y A; 
#chains in the Genus database with same CATH homology
 2JO0 A;  3DS0 A;  4U0A A;  1RO0 A;  3Q20 A;  3CC2 P;  4XFZ A;  3G1G A;  2M8N A;  3CC7 P;  2QA4 P;  1VQ5 P;  1IUQ A;  1AUM A;  1NJI Q;  3CPW O;  5F2N A;  2JYL A;  3DTJ A;  1KC8 Q;  5JPA A;  1K73 Q;  3G26 A;  3CCE P;  3H0D A;  2BUO A;  5BS2 A;  3CXC O;  1K9M Q;  1M6E X;  4IPY A;  2PEK A;  2PEM A;  1D1D A;  1M6N A;  3WBH A;  2XT1 A;  3DS2 A;  1BAJ A;  2XXM A;  5HGM A;  1K8A Q;  3I56 P;  1PEU A;  4XFY A;  1A43 A;  1M74 A;  1KD1 Q;  2PEN A;  1Q7Y Q;  2PY8 A;  2EG5 A;  1ZMB A;  3OW2 O;  1VQ6 P;  2P9X A;  3M1M A;  2CWO A;  4U0B A;  1VQ9 P;  2LF4 A;  3CME P;  2Z46 A;  3CD6 P;  2JYG A;  1M90 Q;  1QVF O;  1KQS O;  3I55 P;  3CCR P;  1YHQ P;  3CCM P;  3CC4 P;  5DCK A;  1EOQ A;  1YIJ P;  4PH1 A;  1RNI A;  4COC A;  3G6E P;  2PEI A;  1VQN P;  2BQ1 E;  4GR6 A;  3H4E A;  3CCL P;  2E1M A;  3E2D A;  3CCV P;  1K30 A;  4XRQ A;  3RG6 C;  1VQK P;  1N8R Q;  3CMA P;  1YJ9 P;  3DS5 A;  3DS4 A;  4XRO A;  2Z45 A;  3G4S P;  2OTJ P;  2PEQ A;  1PEQ A;  3G28 A;  3CCU P;  1YJN P;  3B5I A;  1PEM A;  1A8O A;  5F2O A;  3G1I A;  1VQ8 P;  1M1K Q;  1EIA A;  4U0D A;  1QVG O;  3DPH A;  4COP A;  1QRJ A;  1VQO P;  3CCJ P;  4M0I A;  2M8L A;  1YJW P;  3G29 A;  4PH0 A;  1Q86 Q;  3P05 A;  2OAR A;  3DS1 A;  3HZQ A;  1Q81 Q;  5F2K A;  2M8P A;  4U0F A;  1VQM P;  5HGL A;  1RO2 A;  3MGE A;  1E6J P;  1W2B O;  2QEX P;  2Z44 A;  5HGO A;  5BS1 A;  2PEO A;  4U0E A;  2OTL P;  1VQL P;  3VRL C;  1JJ2 O;  4QNB A;  4XFX A;  1Q82 Q;  3H47 A;  3G0V A;  4GR2 A;  2BHV A;  1PEO A;  3G21 A;  3CCQ P;  2EFJ A;  3G71 P;  2KOD A;  2XV6 A;  1S72 P;  2DGY A;  4U0C A;  2PEJ A;  3LRY A;  3NTE A;  2ONT A;  4WYM A;  2EIA A;  1YI2 P;  2L6E A;  3HYB A;  1VQ4 P;  5HGN A;  5I4T G;  3CCS P;  1VQP P;  1VQ7 P;  3DS3 A;  1YIT P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...