3CMEP

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cmeP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cmeP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cmeP02
3CCLP 1QVGO 3CCQP 1Q7YQ 2QEXP 3G71P 1JJ2O 3CMAP 3CCRP 1VQ5P 1M90Q 1M1KQ 1N8RQ 1VQOP 1Q81Q 1KC8Q 1YIJP 1YJNP 3CCSP 3CMEP 3CXCO 3CPWO 1S72P 1K8AQ 1YHQP 1W2BO 3CC4P 1QVFO 3G4SP 1YITP 1KQSO 1KD1Q 1VQ8P 3I56P 1VQMP 3CCUP 1Q82Q 2OTLP 3G6EP 3CC2P 3OW2O 1K9MQ 3CCEP 1Q86Q 1VQ9P 1VQNP 1VQ6P 1VQPP 1YI2P 1K73Q 1YJWP 3CCMP 1VQLP 1YJ9P 1VQ4P 2OTJP 3I55P 1VQ7P 3CCJP 3CC7P 1VQKP 3CD6P 2QA4P 1NJIQ 3CCVP
chains in the Genus database with same CATH superfamily
2M8RA 4Z1MH 2G3AA 4QNBA 2J58A 2QIWA 3HTKB 3HUSB 4U0AA 4U3FJ 2K9JB 5AVXB 2FVEA 3VTPC 3GG2A 2OYIC 4IOIH 2IYOA 3P8CE 2WZ7A 1KYOE 2K3RA 2M0BA 1S9KE 1LTTC 1KILA 4U3FD 3RL0C 3CC7P 1JM0A 1GK4A 3TNUB 2JB0A 1DX7A 3H1LD 2W90A 3FX0A 3DS1A 3L74D 1YJNP 2QJPC 1VDFA 3G4SP 1PPJE 2L6EA 4GR6A 4H44C 4L75A 1L0HA 1F80D 2PNGA 4NPDA 2CWOA 3MUDC 5K5GB 4C7RA 1SQVK 4R4MA 3S4RA 2IBZG 3HD7C 2FYNC 1W2EA 1PP9G 3B4SA 2CNRA 1EZVE 3S1KA 3G3ZA 3KHUA 1PP9J 3SSUA 3RK3D 5APYA 2WPRA 1NTMD 4JBZA 2MVUA 1JY3P 1YITP 3VP9A 1NH4A 2QM8A 1GPJA 3DS4A 1SQXE 1A02F 2KXPB 2QNWA 3CXHI 1UNKA 5AW6B 2H88C 3DS0A 4I1LA 3G1IA 3RK2B 1UIIA 2WPSA 4DCKA 1DNYA 2I1KA 2ZYAA 4YXDC 2Q5UA 2O01H 2R3SA 3A0HE 3PH0A 2ZT9B 3OW2O 5E79E 1VQLP 3V4QA 1SQBE 4YTPC 2K0XA 1USDA 2DGYA 2QA4P 2ITAA 2KZIA 1IZNB 2Z44A 4XE5B 3WU2E 2AEMA 3H0DA 1SQQG 1U7MA 1QVFO 2KSEA 2KSJA 1M74A 4PWVB 4I6MC 5F2NA 2WTYA 3AE5C 1VQNP 1PFIA 1SQQJ 2KNCB 2JDIH 1PEOA 1H89A 4B86A 1EDKA 2Q9IA 1OFCX 3SWKA 1GU5A 3HE4B 4PH1A 2P10A 3T97A 3TYYA 5CCHC 1BCCE 2PRRA 1DD3A 2BCCE 1EDIA 1D7MA 1HJ0A 2N9YB 2HG5D 2GM4A 4IFFA 2P1JA 2LMLA 5KLIB 1EDJA 1N7SC 1MZ8A 2KW2A 2LIWA 4H2YC 4PXHB 1VPCA 1Y8AA 1ZR4A 3TK1A 2H89C 4D6TE 1M1JA 3B5ND 3DS2A 1GL2A 3PJSK 1AFOA 2RH0A 3H1HG 3MD0A 3DTJA 3L70E 3PRJA 3VMAA 3LMOA 5CCGA 3P8MC 4ZNCA 2RN0A 3H1HJ 5KJ7A 4WBAA 4XFXA 1RF1A 4XFZA 2W6AA 3U1AA 3F5HA 3L71D 3MZWB 2G8YA 1MFTA 4EYYQ 1LTIC 2OYIA 3AE1C 1YYCA 3CXHD 1NAFA 2W27A 1X79B 1VQ8P 4ZKUA 1Q82Q 2O1JA 1NYHA 1RO0A 3H1LE 5GTIH 3L74E 2W6JH 1VQ4P 4GDOA 3I55P 2WPVB 4GIFA 3IAOA 3CXHH 2LL8A 1Z6MA 2XXMA 1K05A 1LGHB 1DV5A 1VL2A 1KQGB 2R32A 3H6PA 3KXDA 1OW7A 2PEIA 3MUDA 1NJIQ 1CI6B 1FR2A 2PEOA 2KK7A 5AW7B 3IF4A 5KLVK 3F89A 3HD7A 2ZJSE 4IFMA 3A5TA 4Y99B 2Y0CA 1KILD 1KD1Q 4F37A 1RE3A 2HFED 1S4XA 3QH9A 4PH0A 1L0LD 2JAZA 1ZLLA 1NTME 2E76D 2KLUA 3N7NA 1N2DC 4H2WC 2VLPA 1XTGB 2X2BA 2QRXA 1KB9I 2E43A 4BWNA 2Z45A 4UB8H 3CXCO 5TJHA 2LXBA 1KLPA 4XFYA 2M8NA 1PPJG 1JEKA 3GLMA 3P8CD 4L73A 2PEMA 2KYVA 2D2CC 1ZRTD 1BSNA 2YMYA 3H1JG 4NPFX 5B5EH 2N50A 1KN7A 1L0NG 2N1TD 2VLQA 2FQ2A 2P9XA 1K9MQ 2Z5IA 1AJYA 3AECC 1QX8A 1L0LK 1GMJA 2KZJA 4WY4B 1AF8A 3H1JJ 4JYCA 1IMPA 3B5NB 2NPSC 1ZW0A 2KS1A 1L0NJ 3TGUE 2WITA 4OGQD 3H1JD 3S9OA 1EZVG 2HLOA 1PGJA 2FKWB 4O9BA 2GZEA 1L0ND 3DS3A 1FZAA 1JNMA 5HGOA 1K04A 2E75D 1JY2N 1JMBA 2BHVA 2XNXA 1BDCA 3B8EB 2K37A 3AE6C 4PD4I 2YIUC 2Q6QA 4IL6H 3H32A 2L9FA 4M0IA 3A2AA 4GKGA 3O6QB 2FVAA 1SQXG 1RQUA 1JTHB 2WSFH 2H7HA 5HGMA 1VQ6P 5CCHA 2K9YA 1E6JP 1SQXJ 1R5SA 1SQPK 3RBZA 4W80A 3LIDA 2QEXP 3CMAP 1FDIA 2KG8A 1SQBG 1NGMB 1N7SA 3LW5H 1EMVA 2XV6A 3E2DA 1IFNA 2IYPA 1HJBA 2ZVNB 2N6ZA 1OVVA 1BSHA 4KHXA 1RNIA 1LNQA 2AEFA 5KAFH 1AA0A 4ZKPA 1GW3A 4W7ZA 2M5AA 5GTIE 1OVUA 1KILB 3VMYA 3L71E 1G2CA 4YXWH 1KB9D 3CLQA 1VQ7P 2E76B 3CCQP 4IL6X 3CXHE 2QJKC 2XNDH 2E74D 2CG5B 4JQ0D 2P58A 2K93A 1NU1D 4U0EA 2C9NY 1BCCG 4I7ZB 1KB9H 3CE7A 3G29A 3D6YA 1URQC 2OARA 1BGYG 1GL2D 4BXLA 1NOHA 1YBKA 2PY8A 4U7JA 5DJTB 1BCCJ 2WSSH 5JPAA 2HPCA 5F2OA 2WQYC 1M90Q 3BRTB 1OIPA 1BGYJ 1FZEA 1Q81Q 4D6TG 3FWLA 4MN4C 1DH3A 1BCCD 4WYMA 5APVA 3I5CA 2GDYA 5KJ7D 1BGYD 1KFNA 2N1TB 1H0TB 3L73D 4D6TJ 1ZR2A 4OVNF 5B66H 3P32A 5BU8B 1KILE 1SQVG 4UB8E 2LXCB 1RY3A 2JR8A 2XZ0D 3GHGC 1L0LE 1NAYA 2PP6A 4OGQB 2ZYGA 2GUVA 2BEQD 2LPKA 1OW8A 4PD4D 3RL0D 3V2QA 1SQVJ 1JCDA 3RG2A 3V2NA 2IZ1A 2E75B 5KP8B 5CJ0A 4U0FA 4EDFA 1SQVD 3GJNA 4H44D 3H1LG 5B5EE 5AW3B 5HGLA 4PD4H 3D71A 3L74G 2JU1A 3M06A 4H0LC 1OW6A 1LT9B 1AYIA 1RE4A 3AE7C 2ZT9C 1ZRTE 1K73Q 3H1LJ 1FJPA 4H13C 3L74J 5KKZC 2B88A 1M6EX 4PV1C 1SFCA 3EJBA 2PEJA 2FQ0A 1T3UA 1HVVA 4R4LA 3M91A 3PTZA 3VN0A 1PGQA 1CZQA 1LWUB 3AEFC 2IDBA 1FZCB 5CBOA 5APQA 1SQPE 5C39A 3M0AA 5EW5E 2MY5A 2K88A 3H1JE 2NPSA 4IL6E 1L0NE 2R5BA 2O01N 3ZDMA 3MGEA 5HGNA 1NTMG 1IFJA 1IFPA 2AEJA 1NTZK 3T97B 3CCEP 2FYUK 2CQ8A 3MHVA 2L5GB 1EQ7A 1RE3C 1EXIA 2BASA 1NTMJ 5I4TG 1KQFB 3BVHA 1JJ2O 5BS2A 2E74B 2V4HA 3GMAA 2O01J 2KODA 3M9BA 2VLOA 1HGZA 1MZ9A 3RG6C 1HGVA 3CWBE 1GK6A 1TU3F 5M1BA 1M1JB 5H2FH 1H8AA 2MJZA 1GL2B 3HRNA 2A45I 5KAFE 1J1EC 4TT3H 5AVRB 3GZMA 3SWYA 3HE5A 2K5XA 4GOFA 1JY2O 5APTA 3TGUG 3CX5I 2J59M 1IFIA 1LTJA 2ONTA 1RF1B 5AW5B 1AQ5A 1OZHA 2I8DA 3EQ2A 1N73A 2KOSA 3BCCD 3LIEA 1WMKA 4XA4A 3HUSA 3TGUJ 1AVOA 1L4AC 4WB4A 3L72G 2OYIB 1AQTA 1KB9E 3RK3C 3VP8A 3EFGA 2K9JA 1MUUA 2GA1A 1ACPA 5CCHD 1HF9A 1LT1A 3TGUD 3G1GA 2KGCA 3RL0B 2KORA 3EFFK 2JU2A 3L72J 2WPTA 2KP8A 1GXHA 1NU1E 4DOJA 1OMIA 2V7QJ 3NTNA 3G0VA 3TNUA 1ZP0C 2AXTH 1JMMA 3L72D 1N7SD 2YNYA 4H44B 3E1RA 5EJDA 3L4FA 1ZXGA 1FZFA 1URQA 5B66E 3EJEA 4ZMDA 2FYNB 1BGYE 2QM7A 2V7QH 3K5BA 1NO4A 1X0TA 4TLFA 4MRTC 2BQ1E 5APXA 3L73E 1M6NA 2FQ1A 4CA3A 4BRYB 1FDOA 4DZOA 4WY4D 1YJWP 2AVAA 1RO2A 3H25A 1RF0A 4IPYA 2E5TA 3G9RA 4AQRD 2ZFCA 4PD4E 2WSCH 2GDWA 4DT0A 2GUSA 3L71G 3BASA 3GHGA 2LKIA 1J1DC 4W7YA 3NY7B 1RHZB 2ZXEB 3JCUH 2KG6A 1P84I 3MGNA 2GYKA 3Q1MA 2PEKA 4C7NB 1SQVE 2Y9YA 2L91A 3L71J 2JO1A 4UB6H 2M5RA 2WT7B 3ABVC 1VKUA 5KLVD 2FXOA 1BDDA 3AE4C 4QKOA 1GZLA 1KQLA 4OH8B 3GKLC 4N78D 1SP4A 2EHTA 5GTHH 2L4BA 2KS1B 5KP7B 1A8OA 1FZGA 2K0DX 3CX5D 1FBMA 1YIJP 2A45H 3CCSP 1MV8A 4WVZA 2O3JA 2FFDC 2QJYC 3W68A 2OYHC 1L0LG 5DJUB 2KNCA 2DW3A 3CX5H 3SFEC 5BVZA 1USEA 2GZIA 2DNWA 1OR5A 2Q3IA 4I2LC 2MF4A 1L0LJ 2IFNA 1WT6A 4U0CA 5H2FE 1JUNA 3HE4A 3WBHA 1HTLC 1GW4A 1RQVA 2KWLA 1GXGA 3V4WA 1AUMA 2KOGA 2MVVA 1FC2C 1CEIA 1N7SB 1Z56A 2KGEA 1OX3A 1AV1A 3I56P 2OTLP 3G6EP 1T8KA 3NFQA 2NPSD 1RE4C 1HY8A 2EIAA 5BU5A 2QVAA 1NWQA 1D1DA 1JY3N 1SQPG 1SFCC 2W6BA 1FJKA 3D70A 3H1KJ 3TDKA 1Y47A 1IC2A 4U0BA 2M5AB 3CL3D 4HB1A 2YMKA 1VQMP 1SQPJ 1G2CB 3BCCE 3H1KD 3H1IJ 1E79H 1YI2P 1VF5C 1LP1B 2B87A 3JSVC 2WPQA 1SQPD 2AXTE 1KTMA 4RJTA 2PENA 3H1ID 2YXRB 2KGAA 2M3EA 1L4AA 1OVRA 3LRYA 2WSFJ 3RL0g 1G1IA 4ASWA 2XKMA 2FXMA 1P84H 3L72E 2R44A 2HPCB 2JJLA 2O1KA 1IO4A 3CWBG 5CBNA 2KB7P 5AW8B 3LW5J 1QLED 3PLNA 4RO0A 5L8RJ 1ZOYC 4M3LA 3HZQA 3CWBJ 1VQ9P 2L22A 3B4QA 2K1AA 1T2KD 1H88A 1CI6A 2FXPA 3G28A 3CWBD 4KT0J 5AVUB 2ZXXA 3SFDC 3JCUE 1QL2A 3U1CA 3NTEA 2XZRA 3L35A 1X3OA 3Q2YA 2YO3A 1R8EA 3PP5A 2ERHA 3V2PA 2OQQA 4UB6E 1S5LH 4DJGA 1LTJC 2JQ4A 2HODA 2Q7CA 1S1CX 1FU1A 1MFZA 1PEMA 1U57A 1HBWA 1N73C 5HVCA 4HYTB 1GDTA 3Q5RA 2IFMA 3USSA 3HUSC 4ASVA 1URQD 3OAKA 2KOOA 1NU1G 2EG5A 5GTHE 1FOSE 1LJ2A 5KLVE 3G26A 3AEEC 1DIPA 2OTJP 2IPPA 2R5DA 1UJZA 2YO2A 1NU1J 2D2CB 1DEBA 1NTKK 3ITKA 2YXQB 4N78E 2ZYDA 4JF7A 1FZCC 1U7JA 2Z4EA 2CPSA 1YQ4C 2NZ2A 2KR5A 3CX5E 2FYZA 4HKZH 2NPSB 2C0XA 3V2RA 2KUBA 3L73G 3IFMA 3CCVP 3B5NA 1ZNVA 4NEOA 1SQXK 5CCGD 3AEDC 3H4EA 3A0BH 1YHQP 3L73J 2FFDA 1S5LX 5AW4B 2IBZI 3VMXA 2PAJA 1HH0A 2OYHA 2JKVA 2JBGA 2B9BA 3L75D 1M1KQ 2YIUB 2GZGA 1QVGO 1RF0C 3A3YB 4XROA 3P7KA 1SQBK 3BATA 4H0LD 2N6YA 2LR2A 3E1IA 3O6QA 1PIXA 1ZV8A 3C8VA 2XZ1C 3TSIA 3AE2C 1JTHA 4H13D 3Q5PA 1NKNA 3KQGA 4PV1D 1AVYA 1GD2E 4QMAA 2VRSA 2N5HA 1JO5A 3VMZA 3AEGC 3N4XA 1PZQA 1KMIZ 1SS1A 2E1MA 4YPCA 1BXIA 2FYUJ 3RK2C 3Q5SA 1NTZD 1Q86Q 4COPA 1VQPP 2FYUD 3AEBC 4EOTA 3HD7D 1BE3G 5AW0B 2PGDA 3H1KE 3WUTA 1K8AQ 5APSA 4EIJA 3M9QA 3VYIA 3PHLA 1P84E 5CMZA 2WVRA 5AVYB 4DG9A 1BE3J 3H1IE 2OTKE 2AXCA 3CCMP 4JPZB 1EC5A 2QJKB 1LTAC 1ZMBA 1SLQA 2R3CA 1BE3D 4OWFA 1FZBA 4LC1A 1MKMA 2K2QA 3MIWA 1FS0E 5AVQB 1PL5A 1IFMA 2B89A 2CGQA 1URQB 2ROQA 1QEXA 2MD9A 2N98A 2AFDA 1JY3O 1A02J 1VHNA 3P05A 1PGPA 1T6AA 1EDLA 2FY8A 2Q1KA 1IK9A 3CCRP 1LTSC 1LTGC 1S5LE 5TISH 5KLIC 1NTKE 1DEEG 2QG4A 2J5UA 1HQBA 2N1TA 4A7PA 1H0TA 2JYLA 2XU6A 4LLHA 3CCJP 1L4AD 4COCA 2XDJA 2IBZD 3H47A 2OYOA 1E0HA 1X9VA 3BCCG 3GHGB 1KFMA 1PP9D 3CPWO 1S72P 3TF5A 2FBWC 1NVOA 3IR9A 2PEQA 1CW5A 3BCCJ 3UIAA 4BPFA 2FVFA 4H2XC 4BPGA 2JWAA 1YQ3C 3IN6A 1KORA 5KP6B 2PFXA 3HTKA 3CMEP 4H0LB 4EI2A 1LT9A 2M8LA 3CCUP 1BAJA 2Z5HA 4H13B 5KKZB 4PV1B 1NQ4A 3A0BE 2P2UA 2WMMA 1VQOP 2C9LY 2QJPB 1NTMK 1JY2P 1LWUA 1FZCA 4L74A 2KIKA 2OGUA 3Q20A 3CI9A 2LIUA 2KG9A 3GW6A 2BEZF 4GT1A 3V5BA 3BRVB 3GZLA 2BUOA 2E5YA 5F2KA 1IFDA 2WSCJ 3G71P 2EFJA 3AE9C 3HD7B 2N9BA 2KGDA 2WWWA 1SQQD 2Z46A 1EXJA 2C0WA 2ZAEB 1KQSO 3L75E 4Y99C 3EWKA 2FADA 1PGOA 5AVSB 4XFJA 3B5IA 5APUA 5AW9B 2K92A 2W8ZA 1GTWA 1X8YA 5EFWB 2M3BA 1ZMEC 1YTZT 2MR7A 1JB0J 1FAVA 3KYQA 5KLVG 4CPGA 2XT1A 1KYOI 2MKVA 1JOCA 2A45G 3B71A 2YKQA 4HKGA 2UWJE 5KLVJ 3A7OA 3CD6P 1Y9BA 2GZFA 2YKOA 3M0DC 3KZIH 1J1EB 1NTZE 1SQQK 1NHLA 2FYUE 1E5WA 1UIXA 1OWAA 3SWFA 1K30A 3M9HA 3U43A 2B87B 4HH2A 4HJGH 2EHSA 4WY4C 1ZN5A 3AE8C 1Q7YQ 2A06G 3B5NC 3H1HD 1L4AB 3RK3B 2MR8A 4U3FE 2P67A 3G21A 3CC4P 1EOQA 1GU4A 2Y9ZA 1BE3E 2VSQA 2HR3A 1EZVI 1FOSF 3MP7B 4R0MA 2YKPA 4UHPB 1RH5B 4IFDK 2A06D 3H32B 3U59A 1KC8Q 5TISE 1S3JA 4XRQA 4PJ0H 5KAIH 2JYGA 3W67A 1JCCA 5CJ4A 1IUQA 1SFCD 1FE6A 2D2CD 2JO0A 2W83C 3RBXA 1OXZA 2KI7B 3OA7A 1M7LA 3O8ZA 1W2BO 2AF8A 3KPEA 1M57D 1VF5D 2JP3A 4K35A 2IBZE 3RK3E 5AW1B 2M8PA 4BRYA 3H1KG 3NXSA 4N3YB 2HODB 1PP9E 2JGPA 3D6ZA 3H1IG 1J1DB 2ZVOB 3E7KA 1HUCA 3C9IA 2WSEJ 3R2PA 1W5CE 4C7NA 3DS5A 1NKZB 2RMZA 1KILC 5HV8A 5CHXA 4JYBA 3VRLC 1P84D 1KYOD 1S9KD 1VQ5P 2E76C 2FHSC 2WT7A 2XV5A 5KTBA 1N86A 2GDXA 3JC22 2NO8A 1PV3A 4I7ZC 2WSEH 4N6JA 2K0YA 1KYOH 1PPJD 1IMQA 1HWTC 4GODA 1NTKG 1IK7A 2HYNA 5AVZB 7CEIA 1T8ZA 1PEQA 2FFDB 3EJDA 2QJYB 2RKLA 4RKUJ 3AE3C 2OYHB 4WWIA 1NTKJ 1SVFA 1SQQE 4IZ6A 2N1TC 4U0DA 2LOLA 3OJAB 2NRGA 4LGDE 1NTKD 2AFEA 1N8RQ 1EZVD 1A43A 2KOQA 1EIAA 2QSIA 3AEAC 1S2EA 4OGQC 2N5IA 1Q2NA 1YJ9P 3RGUA 1G1JA 1VQKP 3FXDA 1WRGA 3L36A 3FXEA 3KZIE 2E75C 1FDMA 1SQXD 2K94A 2FACA 1N7LA 3C1LA 1J2JB 1T3JA 5CZDB 1L0NK 5AVVB 1LT9C 4K3AA 3GF3A 2IX7C 1SQBJ 3QWOC 3Q3DA 2H43A 2JWDA 4GR2A 1SFCB 2LTEA 3WUVA 3M0DA 1T2KC 1SQBD 2SPZA 1QRJA 2E42A 1M8OB 4KJMA 1LWUC 2I1JA 4RESB 2LF4A 3H1HE 1VF5B 2QE7H 3L37A 3A0HH 1CSBA 5AVWB 2H8PD 1LP1A 3GF7A 2IZ0A 1Q90D 5E79H 2L0QA 4WY4A 3L75G 4AUWA 1X22A 2Y0DA 1YTZI 4PJ0E 2KOPA 5KAIE 3WMM0 3VOPA 2JEEA 3WU2H 1L0IA 2BCCG 2CK3H 2A06E 3L75J 4AYCA 1QGKB 1L2PA 3II6A 2VLNA 3DPHA 4C46A 3M1MA 3CCLP 2LKMA 1LTBC 1KZUB 1XTCC 2BCCJ 3RK2D 2P7JA 1QL1A 2CPBA 1IJDB 4BPHA 3HYBA 2E74C 5BS1A 2BCCD 2ZT9D 5AW2B 1KV4A 3V6IA 1DD4A 1NTZG 2KLVA 3L70G 1M1JC 2Q3EA 2FYUG 4NPEA 2FAEA 2GZJA 1GL2C 5DCKA 4L76A 3WUUA 4D6TD 1NTZJ 1NU1K 2Y0EA 5APWA 3L70J 3NMDA 3KDPB 3MTUE 4Y28J 1R5LA 3FWNA 1PEUA 4GOEA 2POHA 3HE5B 5CCGC 5AVTB 3CC2P 1M56D 1LTJB 3L70D 4U3FG 3R4YA 5KJ7C 1RF1C 3FGAD 1N73B
chains in the Genus database with same CATH topology
1Q7YQ 3VRLC 2QEXP 1JJ2O 5BS2A 3CMAP 1VQ5P 4QNBA 3DS0A 1VQOP 3G1IA 3DTJA 1QRJA 3H4EA 2Z45A 4U0AA 3CXCO 1YHQP 2KODA 3G21A 3CC4P 2BQ1E 1M6NA 1EOQA 4U0CA 3RG6C 2LF4A 3Q20A 3WBHA 2XV6A 4XFYA 3HZQA 3OW2O 1VQ9P 1VQLP 1YJWP 2M8NA 4XFXA 3E2DA 3P05A 1RO2A 3CC7P 4XFZA 2DGYA 2BUOA 4IPYA 2QA4P 1M1KQ 4U0FA 1QVGO 3G28A 5F2KA 2PEMA 3G71P 4XROA 3CCRP 2EFJA 2Z44A 3DS1A 1RNIA 1AUMA 3H0DA 1KC8Q 5HGLA 1YJNP 2Z46A 1QVFO 3NTEA 1PEQA 4XRQA 3G4SP 1KQSO 2L6EA 4GR6A 1M74A 1VQ8P 2JYGA 3I56P 2PEKA 1Q82Q 2OTLP 3G6EP 5F2NA 2P9XA 1K9MQ 1VQNP 1RO0A 2EIAA 1K73Q 2ONTA 2JYLA 2CWOA 1VQ4P 3I55P 1IUQA 3DPHA 4U0DA 3CCJP 3M1MA 3B5IA 1VQ7P 1D1DA 4COCA 3CCLP 1M6EX 1PEMA 1PEOA 3CCQP 2JO0A 3H47A 2PEJA 2E1MA 1N8RQ 1A43A 2XXMA 1EIAA 3CPWO 3HYBA 1S72P 5BS1A 1W2BO 4U0EA 4U0BA 2EG5A 2XT1A 2PEQA 3DS3A 3G29A 1VQMP 4PH1A 5HGOA 2OARA 3G1GA 1Q86Q 2M8PA 4COPA 1VQPP 1YI2P 3G26A 2PY8A 1YJ9P 2PEIA 2BHVA 2OTJP 1VQKP 3CD6P 1NJIQ 5JPAA 2PEOA 1A8OA 5F2OA 2PENA 3G0VA 5DCKA 1M90Q 1Q81Q 4M0IA 3MGEA 1YIJP 3CCSP 3CMEP 1K8AQ 3LRYA 5HGNA 4WYMA 1PEUA 1YITP 1KD1Q 1K30A 2M8LA 3CCUP 3CC2P 3CCEP 3DS5A 5HGMA 1BAJA 1VQ6P 4PH0A 3DS4A 3CCMP 1E6JP 3DS2A 1ZMBA 5I4TG 4GR2A 3CCVP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL P;  1QVG O;  3CCQ P;  1Q7Y Q;  2QEX P;  3G71 P;  1JJ2 O;  3CMA P;  3CCR P;  1VQ5 P;  1M90 Q;  1M1K Q;  1N8R Q;  1VQO P;  1Q81 Q;  1KC8 Q;  1YIJ P;  1YJN P;  3CCS P;  3CME P;  3CXC O;  3CPW O;  1S72 P;  1K8A Q;  1YHQ P;  1W2B O;  3CC4 P;  1QVF O;  3G4S P;  1YIT P;  1KQS O;  1KD1 Q;  1VQ8 P;  3I56 P;  1VQM P;  3CCU P;  1Q82 Q;  2OTL P;  3G6E P;  3CC2 P;  3OW2 O;  1K9M Q;  3CCE P;  1Q86 Q;  1VQ9 P;  1VQN P;  1VQ6 P;  1VQP P;  1YI2 P;  1K73 Q;  1YJW P;  3CCM P;  1VQL P;  1YJ9 P;  1VQ4 P;  2OTJ P;  3I55 P;  1VQ7 P;  3CCJ P;  3CC7 P;  1VQK P;  3CD6 P;  2QA4 P;  1NJI Q;  3CCV P; 
#chains in the Genus database with same CATH topology
 2M8R A;  4Z1M H;  2G3A A;  4QNB A;  2J58 A;  2QIW A;  3HTK B;  3HUS B;  4U0A A;  4U3F J;  2K9J B;  5AVX B;  2FVE A;  3VTP C;  3GG2 A;  2OYI C;  4IOI H;  2IYO A;  3P8C E;  2WZ7 A;  1KYO E;  2K3R A;  2M0B A;  1S9K E;  1LTT C;  1KIL A;  4U3F D;  3RL0 C;  3CC7 P;  1JM0 A;  1GK4 A;  3TNU B;  2JB0 A;  1DX7 A;  3H1L D;  2W90 A;  3FX0 A;  3DS1 A;  3L74 D;  1YJN P;  2QJP C;  1VDF A;  3G4S P;  1PPJ E;  2L6E A;  4GR6 A;  4H44 C;  4L75 A;  1L0H A;  1F80 D;  2PNG A;  4NPD A;  2CWO A;  3MUD C;  5K5G B;  4C7R A;  1SQV K;  4R4M A;  3S4R A;  2IBZ G;  3HD7 C;  2FYN C;  1W2E A;  1PP9 G;  3B4S A;  2CNR A;  1EZV E;  3S1K A;  3G3Z A;  3KHU A;  1PP9 J;  3SSU A;  3RK3 D;  5APY A;  2WPR A;  1NTM D;  4JBZ A;  2MVU A;  1JY3 P;  1YIT P;  3VP9 A;  1NH4 A;  2QM8 A;  1GPJ A;  3DS4 A;  1SQX E;  1A02 F;  2KXP B;  2QNW A;  3CXH I;  1UNK A;  5AW6 B;  2H88 C;  3DS0 A;  4I1L A;  3G1I A;  3RK2 B;  1UII A;  2WPS A;  4DCK A;  1DNY A;  2I1K A;  2ZYA A;  4YXD C;  2Q5U A;  2O01 H;  2R3S A;  3A0H E;  3PH0 A;  2ZT9 B;  3OW2 O;  5E79 E;  1VQL P;  3V4Q A;  1SQB E;  4YTP C;  2K0X A;  1USD A;  2DGY A;  2QA4 P;  2ITA A;  2KZI A;  1IZN B;  2Z44 A;  4XE5 B;  3WU2 E;  2AEM A;  3H0D A;  1SQQ G;  1U7M A;  1QVF O;  2KSE A;  2KSJ A;  1M74 A;  4PWV B;  4I6M C;  5F2N A;  2WTY A;  3AE5 C;  1VQN P;  1PFI A;  1SQQ J;  2KNC B;  2JDI H;  1PEO A;  1H89 A;  4B86 A;  1EDK A;  2Q9I A;  1OFC X;  3SWK A;  1GU5 A;  3HE4 B;  4PH1 A;  2P10 A;  3T97 A;  3TYY A;  5CCH C;  1BCC E;  2PRR A;  1DD3 A;  2BCC E;  1EDI A;  1D7M A;  1HJ0 A;  2N9Y B;  2HG5 D;  2GM4 A;  4IFF A;  2P1J A;  2LML A;  5KLI B;  1EDJ A;  1N7S C;  1MZ8 A;  2KW2 A;  2LIW A;  4H2Y C;  4PXH B;  1VPC A;  1Y8A A;  1ZR4 A;  3TK1 A;  2H89 C;  4D6T E;  1M1J A;  3B5N D;  3DS2 A;  1GL2 A;  3PJS K;  1AFO A;  2RH0 A;  3H1H G;  3MD0 A;  3DTJ A;  3L70 E;  3PRJ A;  3VMA A;  3LMO A;  5CCG A;  3P8M C;  4ZNC A;  2RN0 A;  3H1H J;  5KJ7 A;  4WBA A;  4XFX A;  1RF1 A;  4XFZ A;  2W6A A;  3U1A A;  3F5H A;  3L71 D;  3MZW B;  2G8Y A;  1MFT A;  4EYY Q;  1LTI C;  2OYI A;  3AE1 C;  1YYC A;  3CXH D;  1NAF A;  2W27 A;  1X79 B;  1VQ8 P;  4ZKU A;  1Q82 Q;  2O1J A;  1NYH A;  1RO0 A;  3H1L E;  5GTI H;  3L74 E;  2W6J H;  1VQ4 P;  4GDO A;  3I55 P;  2WPV B;  4GIF A;  3IAO A;  3CXH H;  2LL8 A;  1Z6M A;  2XXM A;  1K05 A;  1LGH B;  1DV5 A;  1VL2 A;  1KQG B;  2R32 A;  3H6P A;  3KXD A;  1OW7 A;  2PEI A;  3MUD A;  1NJI Q;  1CI6 B;  1FR2 A;  2PEO A;  2KK7 A;  5AW7 B;  3IF4 A;  5KLV K;  3F89 A;  3HD7 A;  2ZJS E;  4IFM A;  3A5T A;  4Y99 B;  2Y0C A;  1KIL D;  1KD1 Q;  4F37 A;  1RE3 A;  2HFE D;  1S4X A;  3QH9 A;  4PH0 A;  1L0L D;  2JAZ A;  1ZLL A;  1NTM E;  2E76 D;  2KLU A;  3N7N A;  1N2D C;  4H2W C;  2VLP A;  1XTG B;  2X2B A;  2QRX A;  1KB9 I;  2E43 A;  4BWN A;  2Z45 A;  4UB8 H;  3CXC O;  5TJH A;  2LXB A;  1KLP A;  4XFY A;  2M8N A;  1PPJ G;  1JEK A;  3GLM A;  3P8C D;  4L73 A;  2PEM A;  2KYV A;  2D2C C;  1ZRT D;  1BSN A;  2YMY A;  3H1J G;  4NPF X;  5B5E H;  2N50 A;  1KN7 A;  1L0N G;  2N1T D;  2VLQ A;  2FQ2 A;  2P9X A;  1K9M Q;  2Z5I A;  1AJY A;  3AEC C;  1QX8 A;  1L0L K;  1GMJ A;  2KZJ A;  4WY4 B;  1AF8 A;  3H1J J;  4JYC A;  1IMP A;  3B5N B;  2NPS C;  1ZW0 A;  2KS1 A;  1L0N J;  3TGU E;  2WIT A;  4OGQ D;  3H1J D;  3S9O A;  1EZV G;  2HLO A;  1PGJ A;  2FKW B;  4O9B A;  2GZE A;  1L0N D;  3DS3 A;  1FZA A;  1JNM A;  5HGO A;  1K04 A;  2E75 D;  1JY2 N;  1JMB A;  2BHV A;  2XNX A;  1BDC A;  3B8E B;  2K37 A;  3AE6 C;  4PD4 I;  2YIU C;  2Q6Q A;  4IL6 H;  3H32 A;  2L9F A;  4M0I A;  3A2A A;  4GKG A;  3O6Q B;  2FVA A;  1SQX G;  1RQU A;  1JTH B;  2WSF H;  2H7H A;  5HGM A;  1VQ6 P;  5CCH A;  2K9Y A;  1E6J P;  1SQX J;  1R5S A;  1SQP K;  3RBZ A;  4W80 A;  3LID A;  2QEX P;  3CMA P;  1FDI A;  2KG8 A;  1SQB G;  1NGM B;  1N7S A;  3LW5 H;  1EMV A;  2XV6 A;  3E2D A;  1IFN A;  2IYP A;  1HJB A;  2ZVN B;  2N6Z A;  1OVV A;  1BSH A;  4KHX A;  1RNI A;  1LNQ A;  2AEF A;  5KAF H;  1AA0 A;  4ZKP A;  1GW3 A;  4W7Z A;  2M5A A;  5GTI E;  1OVU A;  1KIL B;  3VMY A;  3L71 E;  1G2C A;  4YXW H;  1KB9 D;  3CLQ A;  1VQ7 P;  2E76 B;  3CCQ P;  4IL6 X;  3CXH E;  2QJK C;  2XND H;  2E74 D;  2CG5 B;  4JQ0 D;  2P58 A;  2K93 A;  1NU1 D;  4U0E A;  2C9N Y;  1BCC G;  4I7Z B;  1KB9 H;  3CE7 A;  3G29 A;  3D6Y A;  1URQ C;  2OAR A;  1BGY G;  1GL2 D;  4BXL A;  1NOH A;  1YBK A;  2PY8 A;  4U7J A;  5DJT B;  1BCC J;  2WSS H;  5JPA A;  2HPC A;  5F2O A;  2WQY C;  1M90 Q;  3BRT B;  1OIP A;  1BGY J;  1FZE A;  1Q81 Q;  4D6T G;  3FWL A;  4MN4 C;  1DH3 A;  1BCC D;  4WYM A;  5APV A;  3I5C A;  2GDY A;  5KJ7 D;  1BGY D;  1KFN A;  2N1T B;  1H0T B;  3L73 D;  4D6T J;  1ZR2 A;  4OVN F;  5B66 H;  3P32 A;  5BU8 B;  1KIL E;  1SQV G;  4UB8 E;  2LXC B;  1RY3 A;  2JR8 A;  2XZ0 D;  3GHG C;  1L0L E;  1NAY A;  2PP6 A;  4OGQ B;  2ZYG A;  2GUV A;  2BEQ D;  2LPK A;  1OW8 A;  4PD4 D;  3RL0 D;  3V2Q A;  1SQV J;  1JCD A;  3RG2 A;  3V2N A;  2IZ1 A;  2E75 B;  5KP8 B;  5CJ0 A;  4U0F A;  4EDF A;  1SQV D;  3GJN A;  4H44 D;  3H1L G;  5B5E E;  5AW3 B;  5HGL A;  4PD4 H;  3D71 A;  3L74 G;  2JU1 A;  3M06 A;  4H0L C;  1OW6 A;  1LT9 B;  1AYI A;  1RE4 A;  3AE7 C;  2ZT9 C;  1ZRT E;  1K73 Q;  3H1L J;  1FJP A;  4H13 C;  3L74 J;  5KKZ C;  2B88 A;  1M6E X;  4PV1 C;  1SFC A;  3EJB A;  2PEJ A;  2FQ0 A;  1T3U A;  1HVV A;  4R4L A;  3M91 A;  3PTZ A;  3VN0 A;  1PGQ A;  1CZQ A;  1LWU B;  3AEF C;  2IDB A;  1FZC B;  5CBO A;  5APQ A;  1SQP E;  5C39 A;  3M0A A;  5EW5 E;  2MY5 A;  2K88 A;  3H1J E;  2NPS A;  4IL6 E;  1L0N E;  2R5B A;  2O01 N;  3ZDM A;  3MGE A;  5HGN A;  1NTM G;  1IFJ A;  1IFP A;  2AEJ A;  1NTZ K;  3T97 B;  3CCE P;  2FYU K;  2CQ8 A;  3MHV A;  2L5G B;  1EQ7 A;  1RE3 C;  1EXI A;  2BAS A;  1NTM J;  5I4T G;  1KQF B;  3BVH A;  1JJ2 O;  5BS2 A;  2E74 B;  2V4H A;  3GMA A;  2O01 J;  2KOD A;  3M9B A;  2VLO A;  1HGZ A;  1MZ9 A;  3RG6 C;  1HGV A;  3CWB E;  1GK6 A;  1TU3 F;  5M1B A;  1M1J B;  5H2F H;  1H8A A;  2MJZ A;  1GL2 B;  3HRN A;  2A45 I;  5KAF E;  1J1E C;  4TT3 H;  5AVR B;  3GZM A;  3SWY A;  3HE5 A;  2K5X A;  4GOF A;  1JY2 O;  5APT A;  3TGU G;  3CX5 I;  2J59 M;  1IFI A;  1LTJ A;  2ONT A;  1RF1 B;  5AW5 B;  1AQ5 A;  1OZH A;  2I8D A;  3EQ2 A;  1N73 A;  2KOS A;  3BCC D;  3LIE A;  1WMK A;  4XA4 A;  3HUS A;  3TGU J;  1AVO A;  1L4A C;  4WB4 A;  3L72 G;  2OYI B;  1AQT A;  1KB9 E;  3RK3 C;  3VP8 A;  3EFG A;  2K9J A;  1MUU A;  2GA1 A;  1ACP A;  5CCH D;  1HF9 A;  1LT1 A;  3TGU D;  3G1G A;  2KGC A;  3RL0 B;  2KOR A;  3EFF K;  2JU2 A;  3L72 J;  2WPT A;  2KP8 A;  1GXH A;  1NU1 E;  4DOJ A;  1OMI A;  2V7Q J;  3NTN A;  3G0V A;  3TNU A;  1ZP0 C;  2AXT H;  1JMM A;  3L72 D;  1N7S D;  2YNY A;  4H44 B;  3E1R A;  5EJD A;  3L4F A;  1ZXG A;  1FZF A;  1URQ A;  5B66 E;  3EJE A;  4ZMD A;  2FYN B;  1BGY E;  2QM7 A;  2V7Q H;  3K5B A;  1NO4 A;  1X0T A;  4TLF A;  4MRT C;  2BQ1 E;  5APX A;  3L73 E;  1M6N A;  2FQ1 A;  4CA3 A;  4BRY B;  1FDO A;  4DZO A;  4WY4 D;  1YJW P;  2AVA A;  1RO2 A;  3H25 A;  1RF0 A;  4IPY A;  2E5T A;  3G9R A;  4AQR D;  2ZFC A;  4PD4 E;  2WSC H;  2GDW A;  4DT0 A;  2GUS A;  3L71 G;  3BAS A;  3GHG A;  2LKI A;  1J1D C;  4W7Y A;  3NY7 B;  1RHZ B;  2ZXE B;  3JCU H;  2KG6 A;  1P84 I;  3MGN A;  2GYK A;  3Q1M A;  2PEK A;  4C7N B;  1SQV E;  2Y9Y A;  2L91 A;  3L71 J;  2JO1 A;  4UB6 H;  2M5R A;  2WT7 B;  3ABV C;  1VKU A;  5KLV D;  2FXO A;  1BDD A;  3AE4 C;  4QKO A;  1GZL A;  1KQL A;  4OH8 B;  3GKL C;  4N78 D;  1SP4 A;  2EHT A;  5GTH H;  2L4B A;  2KS1 B;  5KP7 B;  1A8O A;  1FZG A;  2K0D X;  3CX5 D;  1FBM A;  1YIJ P;  2A45 H;  3CCS P;  1MV8 A;  4WVZ A;  2O3J A;  2FFD C;  2QJY C;  3W68 A;  2OYH C;  1L0L G;  5DJU B;  2KNC A;  2DW3 A;  3CX5 H;  3SFE C;  5BVZ A;  1USE A;  2GZI A;  2DNW A;  1OR5 A;  2Q3I A;  4I2L C;  2MF4 A;  1L0L J;  2IFN A;  1WT6 A;  4U0C A;  5H2F E;  1JUN A;  3HE4 A;  3WBH A;  1HTL C;  1GW4 A;  1RQV A;  2KWL A;  1GXG A;  3V4W A;  1AUM A;  2KOG A;  2MVV A;  1FC2 C;  1CEI A;  1N7S B;  1Z56 A;  2KGE A;  1OX3 A;  1AV1 A;  3I56 P;  2OTL P;  3G6E P;  1T8K A;  3NFQ A;  2NPS D;  1RE4 C;  1HY8 A;  2EIA A;  5BU5 A;  2QVA A;  1NWQ A;  1D1D A;  1JY3 N;  1SQP G;  1SFC C;  2W6B A;  1FJK A;  3D70 A;  3H1K J;  3TDK A;  1Y47 A;  1IC2 A;  4U0B A;  2M5A B;  3CL3 D;  4HB1 A;  2YMK A;  1VQM P;  1SQP J;  1G2C B;  3BCC E;  3H1K D;  3H1I J;  1E79 H;  1YI2 P;  1VF5 C;  1LP1 B;  2B87 A;  3JSV C;  2WPQ A;  1SQP D;  2AXT E;  1KTM A;  4RJT A;  2PEN A;  3H1I D;  2YXR B;  2KGA A;  2M3E A;  1L4A A;  1OVR A;  3LRY A;  2WSF J;  3RL0 g;  1G1I A;  4ASW A;  2XKM A;  2FXM A;  1P84 H;  3L72 E;  2R44 A;  2HPC B;  2JJL A;  2O1K A;  1IO4 A;  3CWB G;  5CBN A;  2KB7 P;  5AW8 B;  3LW5 J;  1QLE D;  3PLN A;  4RO0 A;  5L8R J;  1ZOY C;  4M3L A;  3HZQ A;  3CWB J;  1VQ9 P;  2L22 A;  3B4Q A;  2K1A A;  1T2K D;  1H88 A;  1CI6 A;  2FXP A;  3G28 A;  3CWB D;  4KT0 J;  5AVU B;  2ZXX A;  3SFD C;  3JCU E;  1QL2 A;  3U1C A;  3NTE A;  2XZR A;  3L35 A;  1X3O A;  3Q2Y A;  2YO3 A;  1R8E A;  3PP5 A;  2ERH A;  3V2P A;  2OQQ A;  4UB6 E;  1S5L H;  4DJG A;  1LTJ C;  2JQ4 A;  2HOD A;  2Q7C A;  1S1C X;  1FU1 A;  1MFZ A;  1PEM A;  1U57 A;  1HBW A;  1N73 C;  5HVC A;  4HYT B;  1GDT A;  3Q5R A;  2IFM A;  3USS A;  3HUS C;  4ASV A;  1URQ D;  3OAK A;  2KOO A;  1NU1 G;  2EG5 A;  5GTH E;  1FOS E;  1LJ2 A;  5KLV E;  3G26 A;  3AEE C;  1DIP A;  2OTJ P;  2IPP A;  2R5D A;  1UJZ A;  2YO2 A;  1NU1 J;  2D2C B;  1DEB A;  1NTK K;  3ITK A;  2YXQ B;  4N78 E;  2ZYD A;  4JF7 A;  1FZC C;  1U7J A;  2Z4E A;  2CPS A;  1YQ4 C;  2NZ2 A;  2KR5 A;  3CX5 E;  2FYZ A;  4HKZ H;  2NPS B;  2C0X A;  3V2R A;  2KUB A;  3L73 G;  3IFM A;  3CCV P;  3B5N A;  1ZNV A;  4NEO A;  1SQX K;  5CCG D;  3AED C;  3H4E A;  3A0B H;  1YHQ P;  3L73 J;  2FFD A;  1S5L X;  5AW4 B;  2IBZ I;  3VMX A;  2PAJ A;  1HH0 A;  2OYH A;  2JKV A;  2JBG A;  2B9B A;  3L75 D;  1M1K Q;  2YIU B;  2GZG A;  1QVG O;  1RF0 C;  3A3Y B;  4XRO A;  3P7K A;  1SQB K;  3BAT A;  4H0L D;  2N6Y A;  2LR2 A;  3E1I A;  3O6Q A;  1PIX A;  1ZV8 A;  3C8V A;  2XZ1 C;  3TSI A;  3AE2 C;  1JTH A;  4H13 D;  3Q5P A;  1NKN A;  3KQG A;  4PV1 D;  1AVY A;  1GD2 E;  4QMA A;  2VRS A;  2N5H A;  1JO5 A;  3VMZ A;  3AEG C;  3N4X A;  1PZQ A;  1KMI Z;  1SS1 A;  2E1M A;  4YPC A;  1BXI A;  2FYU J;  3RK2 C;  3Q5S A;  1NTZ D;  1Q86 Q;  4COP A;  1VQP P;  2FYU D;  3AEB C;  4EOT A;  3HD7 D;  1BE3 G;  5AW0 B;  2PGD A;  3H1K E;  3WUT A;  1K8A Q;  5APS A;  4EIJ A;  3M9Q A;  3VYI A;  3PHL A;  1P84 E;  5CMZ A;  2WVR A;  5AVY B;  4DG9 A;  1BE3 J;  3H1I E;  2OTK E;  2AXC A;  3CCM P;  4JPZ B;  1EC5 A;  2QJK B;  1LTA C;  1ZMB A;  1SLQ A;  2R3C A;  1BE3 D;  4OWF A;  1FZB A;  4LC1 A;  1MKM A;  2K2Q A;  3MIW A;  1FS0 E;  5AVQ B;  1PL5 A;  1IFM A;  2B89 A;  2CGQ A;  1URQ B;  2ROQ A;  1QEX A;  2MD9 A;  2N98 A;  2AFD A;  1JY3 O;  1A02 J;  1VHN A;  3P05 A;  1PGP A;  1T6A A;  1EDL A;  2FY8 A;  2Q1K A;  1IK9 A;  3CCR P;  1LTS C;  1LTG C;  1S5L E;  5TIS H;  5KLI C;  1NTK E;  1DEE G;  2QG4 A;  2J5U A;  1HQB A;  2N1T A;  4A7P A;  1H0T A;  2JYL A;  2XU6 A;  4LLH A;  3CCJ P;  1L4A D;  4COC A;  2XDJ A;  2IBZ D;  3H47 A;  2OYO A;  1E0H A;  1X9V A;  3BCC G;  3GHG B;  1KFM A;  1PP9 D;  3CPW O;  1S72 P;  3TF5 A;  2FBW C;  1NVO A;  3IR9 A;  2PEQ A;  1CW5 A;  3BCC J;  3UIA A;  4BPF A;  2FVF A;  4H2X C;  4BPG A;  2JWA A;  1YQ3 C;  3IN6 A;  1KOR A;  5KP6 B;  2PFX A;  3HTK A;  3CME P;  4H0L B;  4EI2 A;  1LT9 A;  2M8L A;  3CCU P;  1BAJ A;  2Z5H A;  4H13 B;  5KKZ B;  4PV1 B;  1NQ4 A;  3A0B E;  2P2U A;  2WMM A;  1VQO P;  2C9L Y;  2QJP B;  1NTM K;  1JY2 P;  1LWU A;  1FZC A;  4L74 A;  2KIK A;  2OGU A;  3Q20 A;  3CI9 A;  2LIU A;  2KG9 A;  3GW6 A;  2BEZ F;  4GT1 A;  3V5B A;  3BRV B;  3GZL A;  2BUO A;  2E5Y A;  5F2K A;  1IFD A;  2WSC J;  3G71 P;  2EFJ A;  3AE9 C;  3HD7 B;  2N9B A;  2KGD A;  2WWW A;  1SQQ D;  2Z46 A;  1EXJ A;  2C0W A;  2ZAE B;  1KQS O;  3L75 E;  4Y99 C;  3EWK A;  2FAD A;  1PGO A;  5AVS B;  4XFJ A;  3B5I A;  5APU A;  5AW9 B;  2K92 A;  2W8Z A;  1GTW A;  1X8Y A;  5EFW B;  2M3B A;  1ZME C;  1YTZ T;  2MR7 A;  1JB0 J;  1FAV A;  3KYQ A;  5KLV G;  4CPG A;  2XT1 A;  1KYO I;  2MKV A;  1JOC A;  2A45 G;  3B71 A;  2YKQ A;  4HKG A;  2UWJ E;  5KLV J;  3A7O A;  3CD6 P;  1Y9B A;  2GZF A;  2YKO A;  3M0D C;  3KZI H;  1J1E B;  1NTZ E;  1SQQ K;  1NHL A;  2FYU E;  1E5W A;  1UIX A;  1OWA A;  3SWF A;  1K30 A;  3M9H A;  3U43 A;  2B87 B;  4HH2 A;  4HJG H;  2EHS A;  4WY4 C;  1ZN5 A;  3AE8 C;  1Q7Y Q;  2A06 G;  3B5N C;  3H1H D;  1L4A B;  3RK3 B;  2MR8 A;  4U3F E;  2P67 A;  3G21 A;  3CC4 P;  1EOQ A;  1GU4 A;  2Y9Z A;  1BE3 E;  2VSQ A;  2HR3 A;  1EZV I;  1FOS F;  3MP7 B;  4R0M A;  2YKP A;  4UHP B;  1RH5 B;  4IFD K;  2A06 D;  3H32 B;  3U59 A;  1KC8 Q;  5TIS E;  1S3J A;  4XRQ A;  4PJ0 H;  5KAI H;  2JYG A;  3W67 A;  1JCC A;  5CJ4 A;  1IUQ A;  1SFC D;  1FE6 A;  2D2C D;  2JO0 A;  2W83 C;  3RBX A;  1OXZ A;  2KI7 B;  3OA7 A;  1M7L A;  3O8Z A;  1W2B O;  2AF8 A;  3KPE A;  1M57 D;  1VF5 D;  2JP3 A;  4K35 A;  2IBZ E;  3RK3 E;  5AW1 B;  2M8P A;  4BRY A;  3H1K G;  3NXS A;  4N3Y B;  2HOD B;  1PP9 E;  2JGP A;  3D6Z A;  3H1I G;  1J1D B;  2ZVO B;  3E7K A;  1HUC A;  3C9I A;  2WSE J;  3R2P A;  1W5C E;  4C7N A;  3DS5 A;  1NKZ B;  2RMZ A;  1KIL C;  5HV8 A;  5CHX A;  4JYB A;  3VRL C;  1P84 D;  1KYO D;  1S9K D;  1VQ5 P;  2E76 C;  2FHS C;  2WT7 A;  2XV5 A;  5KTB A;  1N86 A;  2GDX A;  3JC2 2;  2NO8 A;  1PV3 A;  4I7Z C;  2WSE H;  4N6J A;  2K0Y A;  1KYO H;  1PPJ D;  1IMQ A;  1HWT C;  4GOD A;  1NTK G;  1IK7 A;  2HYN A;  5AVZ B;  7CEI A;  1T8Z A;  1PEQ A;  2FFD B;  3EJD A;  2QJY B;  2RKL A;  4RKU J;  3AE3 C;  2OYH B;  4WWI A;  1NTK J;  1SVF A;  1SQQ E;  4IZ6 A;  2N1T C;  4U0D A;  2LOL A;  3OJA B;  2NRG A;  4LGD E;  1NTK D;  2AFE A;  1N8R Q;  1EZV D;  1A43 A;  2KOQ A;  1EIA A;  2QSI A;  3AEA C;  1S2E A;  4OGQ C;  2N5I A;  1Q2N A;  1YJ9 P;  3RGU A;  1G1J A;  1VQK P;  3FXD A;  1WRG A;  3L36 A;  3FXE A;  3KZI E;  2E75 C;  1FDM A;  1SQX D;  2K94 A;  2FAC A;  1N7L A;  3C1L A;  1J2J B;  1T3J A;  5CZD B;  1L0N K;  5AVV B;  1LT9 C;  4K3A A;  3GF3 A;  2IX7 C;  1SQB J;  3QWO C;  3Q3D A;  2H43 A;  2JWD A;  4GR2 A;  1SFC B;  2LTE A;  3WUV A;  3M0D A;  1T2K C;  1SQB D;  2SPZ A;  1QRJ A;  2E42 A;  1M8O B;  4KJM A;  1LWU C;  2I1J A;  4RES B;  2LF4 A;  3H1H E;  1VF5 B;  2QE7 H;  3L37 A;  3A0H H;  1CSB A;  5AVW B;  2H8P D;  1LP1 A;  3GF7 A;  2IZ0 A;  1Q90 D;  5E79 H;  2L0Q A;  4WY4 A;  3L75 G;  4AUW A;  1X22 A;  2Y0D A;  1YTZ I;  4PJ0 E;  2KOP A;  5KAI E;  3WMM 0;  3VOP A;  2JEE A;  3WU2 H;  1L0I A;  2BCC G;  2CK3 H;  2A06 E;  3L75 J;  4AYC A;  1QGK B;  1L2P A;  3II6 A;  2VLN A;  3DPH A;  4C46 A;  3M1M A;  3CCL P;  2LKM A;  1LTB C;  1KZU B;  1XTC C;  2BCC J;  3RK2 D;  2P7J A;  1QL1 A;  2CPB A;  1IJD B;  4BPH A;  3HYB A;  2E74 C;  5BS1 A;  2BCC D;  2ZT9 D;  5AW2 B;  1KV4 A;  3V6I A;  1DD4 A;  1NTZ G;  2KLV A;  3L70 G;  1M1J C;  2Q3E A;  2FYU G;  4NPE A;  2FAE A;  2GZJ A;  1GL2 C;  5DCK A;  4L76 A;  3WUU A;  4D6T D;  1NTZ J;  1NU1 K;  2Y0E A;  5APW A;  3L70 J;  3NMD A;  3KDP B;  3MTU E;  4Y28 J;  1R5L A;  3FWN A;  1PEU A;  4GOE A;  2POH A;  3HE5 B;  5CCG C;  5AVT B;  3CC2 P;  1M56 D;  1LTJ B;  3L70 D;  4U3F G;  3R4Y A;  5KJ7 C;  1RF1 C;  3FGA D;  1N73 B; 
#chains in the Genus database with same CATH homology
 1Q7Y Q;  3VRL C;  2QEX P;  1JJ2 O;  5BS2 A;  3CMA P;  1VQ5 P;  4QNB A;  3DS0 A;  1VQO P;  3G1I A;  3DTJ A;  1QRJ A;  3H4E A;  2Z45 A;  4U0A A;  3CXC O;  1YHQ P;  2KOD A;  3G21 A;  3CC4 P;  2BQ1 E;  1M6N A;  1EOQ A;  4U0C A;  3RG6 C;  2LF4 A;  3Q20 A;  3WBH A;  2XV6 A;  4XFY A;  3HZQ A;  3OW2 O;  1VQ9 P;  1VQL P;  1YJW P;  2M8N A;  4XFX A;  3E2D A;  3P05 A;  1RO2 A;  3CC7 P;  4XFZ A;  2DGY A;  2BUO A;  4IPY A;  2QA4 P;  1M1K Q;  4U0F A;  1QVG O;  3G28 A;  5F2K A;  2PEM A;  3G71 P;  4XRO A;  3CCR P;  2EFJ A;  2Z44 A;  3DS1 A;  1RNI A;  1AUM A;  3H0D A;  1KC8 Q;  5HGL A;  1YJN P;  2Z46 A;  1QVF O;  3NTE A;  1PEQ A;  4XRQ A;  3G4S P;  1KQS O;  2L6E A;  4GR6 A;  1M74 A;  1VQ8 P;  2JYG A;  3I56 P;  2PEK A;  1Q82 Q;  2OTL P;  3G6E P;  5F2N A;  2P9X A;  1K9M Q;  1VQN P;  1RO0 A;  2EIA A;  1K73 Q;  2ONT A;  2JYL A;  2CWO A;  1VQ4 P;  3I55 P;  1IUQ A;  3DPH A;  4U0D A;  3CCJ P;  3M1M A;  3B5I A;  1VQ7 P;  1D1D A;  4COC A;  3CCL P;  1M6E X;  1PEM A;  1PEO A;  3CCQ P;  2JO0 A;  3H47 A;  2PEJ A;  2E1M A;  1N8R Q;  1A43 A;  2XXM A;  1EIA A;  3CPW O;  3HYB A;  1S72 P;  5BS1 A;  1W2B O;  4U0E A;  4U0B A;  2EG5 A;  2XT1 A;  2PEQ A;  3DS3 A;  3G29 A;  1VQM P;  4PH1 A;  5HGO A;  2OAR A;  3G1G A;  1Q86 Q;  2M8P A;  4COP A;  1VQP P;  1YI2 P;  3G26 A;  2PY8 A;  1YJ9 P;  2PEI A;  2BHV A;  2OTJ P;  1VQK P;  3CD6 P;  1NJI Q;  5JPA A;  2PEO A;  1A8O A;  5F2O A;  2PEN A;  3G0V A;  5DCK A;  1M90 Q;  1Q81 Q;  4M0I A;  3MGE A;  1YIJ P;  3CCS P;  3CME P;  1K8A Q;  3LRY A;  5HGN A;  4WYM A;  1PEU A;  1YIT P;  1KD1 Q;  1K30 A;  2M8L A;  3CCU P;  3CC2 P;  3CCE P;  3DS5 A;  5HGM A;  1BAJ A;  1VQ6 P;  4PH0 A;  3DS4 A;  3CCM P;  1E6J P;  3DS2 A;  1ZMB A;  5I4T G;  4GR2 A;  3CCV P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...