2GZFA

Crystal structure of the e9 dnase domain with a mutant immunity protein im9 (y54f)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIFYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E9 immunity protein
publication title Crystal Structure of the Complex of the Colicin E9 DNase Domain with a Mutant Immunity Protein, IM9 (Y54F)
rcsb
source organism Escherichia coli k12
molecule tags Antibiotic/antibiotic inhibitor
total genus 28
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gzfA00
2GZIA 2GZJA 2VLNA 1GXGA 2ERHA 2JB0A 2K5XA 1MZ8A 2VLQA 1FR2A 7CEIA 1IMQA 2VLOA 1ZNVA 2GZGA 3U43A 2VLPA 4QKOA 3GKLC 5EW5E 1AYIA 1EMVA 1BXIA 2GZFA 2GZEA 3GJNA 4F37A 1IMPA 2K0DX 2NO8A 2GYKA 2JBGA 1UNKA 1E0HA 1CEIA 4UHPB 2WPTA 1GXHA 1UJZA 2JAZA
chains in the Genus database with same CATH superfamily
2MR8A 3DS1A 2MD9A 4H2XC 3HZQA 2FHSC 1ZNVA 2CNRA 2AF8A 1YJWP 2M5RA 5HGMA 1M6EX 3CC2P 3CMAP 1S72P 1CEIA 2WPTA 1IMPA 5KP6B 1QVGO 2MVUA 1K73Q 1IMQA 1EIAA 1VQ5P 2LL8A 2N50A 3CXCO 5EW5E 2GDWA 3H4EA 1QVFO 3EJDA 3CPWO 4H2YC 5HVCA 2PENA 1F80D 5CZDB 4DG9A 2JQ4A 1K9MQ 2VLQA 2LOLA 4U0FA 7CEIA 2KW2A 3OW2O 2PNGA 1L0IA 1YIJP 2KGCA 4PH1A 1K30A 2N98A 2KWLA 2FACA 2AFDA 2JAZA 2BUOA 2GZJA 2M8NA 3CE7A 2X2BA 3Q20A 4PXHB 1JJ2O 2KODA 2N5IA 1ZMBA 2KOSA 4NEOA 3DS3A 3G1IA 2JU1A 2OTLP 2JBGA 3CCVP 1DV5A 1A43A 1M6NA 2EG5A 1VQ8P 2KR5A 2BHVA 2VLPA 4QNBA 2KOOA 2KGEA 3NY7B 2OTJP 3EJEA 2CQ8A 3DTJA 3GJNA 1KD1Q 4PH0A 2PEKA 2XT1A 4XFYA 1N8RQ 2PEOA 2P9XA 2LIUA 2L9FA 2PEQA 3G0VA 2AVAA 1Z6MA 1X3OA 1FR2A 2VLOA 3I55P 1YITP 2KG8A 2XZ0D 3HYBA 4IPYA 1ACPA 4U0BA 3CCEP 2KGAA 5BS2A 1NJIQ 4GR2A 2JYGA 1VQLP 2GZIA 4XFZA 3G1GA 3RG6C 3CMEP 3M1MA 1AUMA 2L4BA 3CCUP 3U43A 3EJBA 2GDYA 4QKOA 1YJNP 4F37A 4BPHA 1E6JP 2FQ2A 2GYKA 2JGPA 2K0YA 2VSQA 3WBHA 5DCKA 2JO0A 1KLPA 1Q81Q 2JB0A 2XXMA 2EHSA 5HGNA 2FADA 3CD6P 1RO2A 3GZMA 5F2NA 2PEJA 3DS0A 4XRQA 2LKIA 3CCRP 3E2DA 1KC8Q 1GPJA 1Q7YQ 2L0QA 1W2BO 1VKUA 3CCJP 2QA4P 1RNIA 1VQNP 2XV6A 1UNKA 2LPKA 4WYMA 3P05A 2M8PA 1DNYA 2KORA 3CC7P 1HY8A 4BPGA 1AF8A 2XZ1C 2GDXA 4HKGA 2Z46A 2FVEA 4U0DA 2N6YA 2PEIA 2LF4A 2L6EA 2K0XA 3RG2A 5EJDA 4GR6A 2CWOA 3DS5A 5F2KA 1UJZA 1D1DA 3MGEA 4M0IA 1BAJA 1QRJA 4MRTC 1L0HA 2OARA 2GZGA 2MF4A 2PY8A 3GZLA 2KGDA 4COPA 2N5HA 3DS4A 2K0DX 2KG9A 3H0DA 1EOQA 2CGQA 5I4TG 4BPFA 2VLNA 2L22A 2ERHA 3CCMP 5JPAA 2FQ1A 2N6ZA 2FAEA 1T8KA 2GZFA 1VQ6P 3DS2A 3B5IA 2NO8A 2QNWA 2JU2A 2EIAA 4U0AA 3G29A 2K5XA 4COCA 1IUQA 2K2QA 1VQOP 1VQPP 1VHNA 5KP8B 1VQMP 4IZ6A 2KOPA 2K93A 1M90Q 1Q82Q 1YJ9P 2LTEA 1A8OA 4R0MA 2Z45A 5BS1A 1VQKP 3G28A 3I56P 2ONTA 3DPHA 1HQBA 3NTEA 2QEXP 1VQ4P 2KG6A 3CC4P 4CA3A 3CCLP 2E1MA 4XROA 3H47A 2LIWA 1M74A 2FQ0A 5HGOA 2PEMA 2EHTA 2Z44A 1YHQP 3CCQP 2FVFA 5HGLA 4UHPB 1KQSO 3CCSP 2K94A 3G21A 4H2WC 4XFXA 2FVAA 3LRYA 2JYLA 1AYIA 1E0HA 1OR5A 1VQ7P 2DGYA 2K92A 1RO0A 1VQ9P 2LMLA 2CG5B 5HV8A 3G26A 4PWVB 1GXGA 2MR7A 5F2OA 1MZ8A 2EFJA 2MY5A 2ROQA 3G71P 4U0CA 1YI2P 2DNWA 2M8LA 3GKLC 2AFEA 1EMVA 1BXIA 1NQ4A 2GZEA 3LMOA 3G4SP 1K8AQ 3B4QA 4U0EA 2MVVA 5KP7B 1Q86Q 3VRLC 3G6EP 2KOQA 1M1KQ 1GXHA
chains in the Genus database with same CATH topology
2GZIA 2GZJA 2VLNA 1GXGA 2ERHA 2JB0A 2K5XA 1MZ8A 2VLQA 1FR2A 7CEIA 1IMQA 2VLOA 1ZNVA 2GZGA 3U43A 2VLPA 4QKOA 3GKLC 5EW5E 1AYIA 1EMVA 1BXIA 2GZFA 2GZEA 3GJNA 4F37A 1IMPA 2K0DX 2NO8A 2GYKA 2JBGA 1UNKA 1E0HA 1CEIA 4UHPB 2WPTA 1GXHA 1UJZA 2JAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZI A;  2GZJ A;  2VLN A;  1GXG A;  2ERH A;  2JB0 A;  2K5X A;  1MZ8 A;  2VLQ A;  1FR2 A;  7CEI A;  1IMQ A;  2VLO A;  1ZNV A;  2GZG A;  3U43 A;  2VLP A;  4QKO A;  3GKL C;  5EW5 E;  1AYI A;  1EMV A;  1BXI A;  2GZF A;  2GZE A;  3GJN A;  4F37 A;  1IMP A;  2K0D X;  2NO8 A;  2GYK A;  2JBG A;  1UNK A;  1E0H A;  1CEI A;  4UHP B;  2WPT A;  1GXH A;  1UJZ A;  2JAZ A; 
#chains in the Genus database with same CATH topology
 2MR8 A;  3DS1 A;  2MD9 A;  4H2X C;  3HZQ A;  2FHS C;  1ZNV A;  2CNR A;  2AF8 A;  1YJW P;  2M5R A;  5HGM A;  1M6E X;  3CC2 P;  3CMA P;  1S72 P;  1CEI A;  2WPT A;  1IMP A;  5KP6 B;  1QVG O;  2MVU A;  1K73 Q;  1IMQ A;  1EIA A;  1VQ5 P;  2LL8 A;  2N50 A;  3CXC O;  5EW5 E;  2GDW A;  3H4E A;  1QVF O;  3EJD A;  3CPW O;  4H2Y C;  5HVC A;  2PEN A;  1F80 D;  5CZD B;  4DG9 A;  2JQ4 A;  1K9M Q;  2VLQ A;  2LOL A;  4U0F A;  7CEI A;  2KW2 A;  3OW2 O;  2PNG A;  1L0I A;  1YIJ P;  2KGC A;  4PH1 A;  1K30 A;  2N98 A;  2KWL A;  2FAC A;  2AFD A;  2JAZ A;  2BUO A;  2GZJ A;  2M8N A;  3CE7 A;  2X2B A;  3Q20 A;  4PXH B;  1JJ2 O;  2KOD A;  2N5I A;  1ZMB A;  2KOS A;  4NEO A;  3DS3 A;  3G1I A;  2JU1 A;  2OTL P;  2JBG A;  3CCV P;  1DV5 A;  1A43 A;  1M6N A;  2EG5 A;  1VQ8 P;  2KR5 A;  2BHV A;  2VLP A;  4QNB A;  2KOO A;  2KGE A;  3NY7 B;  2OTJ P;  3EJE A;  2CQ8 A;  3DTJ A;  3GJN A;  1KD1 Q;  4PH0 A;  2PEK A;  2XT1 A;  4XFY A;  1N8R Q;  2PEO A;  2P9X A;  2LIU A;  2L9F A;  2PEQ A;  3G0V A;  2AVA A;  1Z6M A;  1X3O A;  1FR2 A;  2VLO A;  3I55 P;  1YIT P;  2KG8 A;  2XZ0 D;  3HYB A;  4IPY A;  1ACP A;  4U0B A;  3CCE P;  2KGA A;  5BS2 A;  1NJI Q;  4GR2 A;  2JYG A;  1VQL P;  2GZI A;  4XFZ A;  3G1G A;  3RG6 C;  3CME P;  3M1M A;  1AUM A;  2L4B A;  3CCU P;  3U43 A;  3EJB A;  2GDY A;  4QKO A;  1YJN P;  4F37 A;  4BPH A;  1E6J P;  2FQ2 A;  2GYK A;  2JGP A;  2K0Y A;  2VSQ A;  3WBH A;  5DCK A;  2JO0 A;  1KLP A;  1Q81 Q;  2JB0 A;  2XXM A;  2EHS A;  5HGN A;  2FAD A;  3CD6 P;  1RO2 A;  3GZM A;  5F2N A;  2PEJ A;  3DS0 A;  4XRQ A;  2LKI A;  3CCR P;  3E2D A;  1KC8 Q;  1GPJ A;  1Q7Y Q;  2L0Q A;  1W2B O;  1VKU A;  3CCJ P;  2QA4 P;  1RNI A;  1VQN P;  2XV6 A;  1UNK A;  2LPK A;  4WYM A;  3P05 A;  2M8P A;  1DNY A;  2KOR A;  3CC7 P;  1HY8 A;  4BPG A;  1AF8 A;  2XZ1 C;  2GDX A;  4HKG A;  2Z46 A;  2FVE A;  4U0D A;  2N6Y A;  2PEI A;  2LF4 A;  2L6E A;  2K0X A;  3RG2 A;  5EJD A;  4GR6 A;  2CWO A;  3DS5 A;  5F2K A;  1UJZ A;  1D1D A;  3MGE A;  4M0I A;  1BAJ A;  1QRJ A;  4MRT C;  1L0H A;  2OAR A;  2GZG A;  2MF4 A;  2PY8 A;  3GZL A;  2KGD A;  4COP A;  2N5H A;  3DS4 A;  2K0D X;  2KG9 A;  3H0D A;  1EOQ A;  2CGQ A;  5I4T G;  4BPF A;  2VLN A;  2L22 A;  2ERH A;  3CCM P;  5JPA A;  2FQ1 A;  2N6Z A;  2FAE A;  1T8K A;  2GZF A;  1VQ6 P;  3DS2 A;  3B5I A;  2NO8 A;  2QNW A;  2JU2 A;  2EIA A;  4U0A A;  3G29 A;  2K5X A;  4COC A;  1IUQ A;  2K2Q A;  1VQO P;  1VQP P;  1VHN A;  5KP8 B;  1VQM P;  4IZ6 A;  2KOP A;  2K93 A;  1M90 Q;  1Q82 Q;  1YJ9 P;  2LTE A;  1A8O A;  4R0M A;  2Z45 A;  5BS1 A;  1VQK P;  3G28 A;  3I56 P;  2ONT A;  3DPH A;  1HQB A;  3NTE A;  2QEX P;  1VQ4 P;  2KG6 A;  3CC4 P;  4CA3 A;  3CCL P;  2E1M A;  4XRO A;  3H47 A;  2LIW A;  1M74 A;  2FQ0 A;  5HGO A;  2PEM A;  2EHT A;  2Z44 A;  1YHQ P;  3CCQ P;  2FVF A;  5HGL A;  4UHP B;  1KQS O;  3CCS P;  2K94 A;  3G21 A;  4H2W C;  4XFX A;  2FVA A;  3LRY A;  2JYL A;  1AYI A;  1E0H A;  1OR5 A;  1VQ7 P;  2DGY A;  2K92 A;  1RO0 A;  1VQ9 P;  2LML A;  2CG5 B;  5HV8 A;  3G26 A;  4PWV B;  1GXG A;  2MR7 A;  5F2O A;  1MZ8 A;  2EFJ A;  2MY5 A;  2ROQ A;  3G71 P;  4U0C A;  1YI2 P;  2DNW A;  2M8L A;  3GKL C;  2AFE A;  1EMV A;  1BXI A;  1NQ4 A;  2GZE A;  3LMO A;  3G4S P;  1K8A Q;  3B4Q A;  4U0E A;  2MVV A;  5KP7 B;  1Q86 Q;  3VRL C;  3G6E P;  2KOQ A;  1M1K Q;  1GXH A; 
#chains in the Genus database with same CATH homology
 2GZI A;  2GZJ A;  2VLN A;  1GXG A;  2ERH A;  2JB0 A;  2K5X A;  1MZ8 A;  2VLQ A;  1FR2 A;  7CEI A;  1IMQ A;  2VLO A;  1ZNV A;  2GZG A;  3U43 A;  2VLP A;  4QKO A;  3GKL C;  5EW5 E;  1AYI A;  1EMV A;  1BXI A;  2GZF A;  2GZE A;  3GJN A;  4F37 A;  1IMP A;  2K0D X;  2NO8 A;  2GYK A;  2JBG A;  1UNK A;  1E0H A;  1CEI A;  4UHP B;  2WPT A;  1GXH A;  1UJZ A;  2JAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...