2GZFA

Crystal structure of the e9 dnase domain with a mutant immunity protein im9 (y54f)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIFYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Complex of the Colicin E9 DNase Domain with a Mutant Immunity Protein, IM9 (Y54F)
rcsb
source organism Escherichia coli k12
molecule tags Antibiotic/antibiotic inhibitor
molecule keywords Colicin-E9 immunity protein
total genus 28
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gzfA00
1E0HA 2K5XA 1UJZA 1AYIA 2K0DX 3GKLC 2VLQA 2VLNA 5EW5E 1UNKA 1IMPA 2GZIA 1MZ8A 2WPTA 2GZGA 4QKOA 1CEIA 1ZNVA 3GJNA 2VLOA 1IMQA 2JAZA 4F37A 2NO8A 2JB0A 2VLPA 4UHPB 7CEIA 1BXIA 1EMVA 2GYKA 3U43A 2GZJA 2ERHA 1FR2A 2GZFA 1GXGA 1GXHA 2GZEA 2JBGA
chains in the Genus database with same CATH superfamily
4IZ6A 2PEIA 3DS3A 1UNKA 2PEQA 2BUOA 1L0IA 2GZGA 2L9FA 2XV6A 4GR2A 2L0QA 1IMQA 4F37A 4UHPB 1Q86Q 2CG5B 4PH1A 5BS1A 2JU2A 1OR5A 4XFZA 4BPGA 4H2YC 1KLPA 2ERHA 2KGEA 2GZEA 2PNGA 3G29A 2PEOA 2KODA 3G1GA 3H47A 3DS4A 1F80D 2GDXA 2MR8A 2K2QA 3H4EA 2GDWA 2N6ZA 1YJ9P 2FACA 1ZMBA 1CEIA 3CCUP 1VQPP 2JAZA 3LMOA 1HQBA 2JU1A 1EMVA 3I55P 2GYKA 5HGLA 5CZDB 2LIUA 2CWOA 1Q7YQ 4MRTC 5I4TG 5KP8B 1VQNP 1GXHA 2JYLA 2KOQA 1VQ6P 2M8LA 1YHQP 3G4SP 5KP6B 1YIJP 1VQ4P 3DTJA 3E2DA 1VQ5P 2KGAA 3LRYA 2MVVA 2KORA 3MGEA 1NJIQ 4DG9A 2MD9A 1D1DA 1A43A 2N6YA 1A8OA 2FADA 2JQ4A 1YJWP 1M6EX 1Z6MA 3CCVP 4U0CA 1T8KA 2EFJA 1W2BO 1N8RQ 2EG5A 1DNYA 3CXCO 4XFXA 3NY7B 1EIAA 2XZ1C 4IPYA 1RO0A 2KG8A 1ZNVA 3CC2P 3CE7A 2KOOA 2EIAA 1VQ8P 2Z45A 1AUMA 1VQKP 3I56P 2AVAA 1VQMP 2MR7A 1M74A 3DS2A 1VQLP 2LF4A 3CMEP 2KW2A 1K73Q 1K8AQ 1ACPA 3VRLC 3EJEA 5HGOA 5F2KA 3B4QA 3DS0A 4BPHA 2QA4P 1UJZA 2K0DX 2VLNA 2JYGA 2MVUA 2K0XA 5KP7B 4PH0A 2CQ8A 3HYBA 2CNRA 4U0AA 2FQ0A 2XZ0D 4U0DA 2FAEA 1E6JP 4U0FA 2LOLA 3GZLA 2M8PA 2K0YA 2EHTA 2L22A 2BHVA 4PWVB 3G21A 5EW5E 1JJ2O 5HGMA 2M5RA 5F2OA 2OARA 2NO8A 2CGQA 3H0DA 2DGYA 3CCLP 1HY8A 1FR2A 1GXGA 1BAJA 3CMAP 4XRQA 1M6NA 5HVCA 3G28A 1AYIA 4R0MA 3CC4P 2WPTA 1AF8A 4CA3A 3P05A 3M1MA 5EJDA 2N50A 2N5IA 2P9XA 2LL8A 3CCEP 3U43A 4H2WC 2FVAA 2K93A 2LMLA 3WBHA 3DS5A 2KOPA 1IMPA 1MZ8A 4QNBA 2OTJP 5HV8A 4XFYA 3DPHA 2FQ2A 1YI2P 4HKGA 1QRJA 3CC7P 2GZFA 2JBGA 2PEJA 1YJNP 1GPJA 1VHNA 4COPA 2XXMA 2KGCA 2FHSC 1EOQA 2DNWA 5BS2A 2GZIA 1KQSO 2QEXP 5DCKA 4M0IA 1YITP 5F2NA 2K92A 2Z44A 1M1KQ 1E0HA 2KG6A 4GR6A 4NEOA 2LKIA 3CCJP 2VLQA 5HGNA 3RG2A 3G6EP 2VLOA 3G26A 1BXIA 1M90Q 2XT1A 3DS1A 2Z46A 3EJBA 2AF8A 2PY8A 3OW2O 1QVGO 2K5XA 2ROQA 2L4BA 2N5HA 2PEKA 2LIWA 5JPAA 2AFDA 3EJDA 2GDYA 4PXHB 2FQ1A 2KWLA 2KOSA 2JB0A 2VLPA 1DV5A 2L6EA 1RNIA 2GZJA 2N98A 3Q20A 2MF4A 2KGDA 1K30A 3GZMA 4WYMA 1L0HA 2FVEA 3CPWO 4U0EA 2JGPA 3RG6C 1KD1Q 4XROA 4QKOA 2KG9A 7CEIA 3CD6P 2PEMA 1X3OA 2M8NA 2KR5A 2MY5A 2AFEA 1VQ9P 2LTEA 1NQ4A 3CCMP 1K9MQ 4H2XC 1VQOP 2ONTA 3G0VA 2VSQA 2K94A 4BPFA 2FVFA 1KC8Q 3CCRP 1IUQA 2PENA 3CCSP 3G71P 2QNWA 3B5IA 2E1MA 3CCQP 4COCA 4U0BA 1Q81Q 1VKUA 2JO0A 1RO2A 3GKLC 1VQ7P 1QVFO 1Q82Q 3NTEA 3HZQA 1S72P 3GJNA 3G1IA 2EHSA 2X2BA 2OTLP 2LPKA
chains in the Genus database with same CATH topology
1E0HA 2K5XA 1UJZA 1AYIA 2K0DX 3GKLC 2VLQA 2VLNA 5EW5E 1UNKA 1IMPA 2GZIA 1MZ8A 2WPTA 2GZGA 4QKOA 1CEIA 1ZNVA 3GJNA 2VLOA 1IMQA 2JAZA 4F37A 2NO8A 2JB0A 2VLPA 4UHPB 7CEIA 1BXIA 1EMVA 2GYKA 3U43A 2GZJA 2ERHA 1FR2A 2GZFA 1GXGA 1GXHA 2GZEA 2JBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E0H A;  2K5X A;  1UJZ A;  1AYI A;  2K0D X;  3GKL C;  2VLQ A;  2VLN A;  5EW5 E;  1UNK A;  1IMP A;  2GZI A;  1MZ8 A;  2WPT A;  2GZG A;  4QKO A;  1CEI A;  1ZNV A;  3GJN A;  2VLO A;  1IMQ A;  2JAZ A;  4F37 A;  2NO8 A;  2JB0 A;  2VLP A;  4UHP B;  7CEI A;  1BXI A;  1EMV A;  2GYK A;  3U43 A;  2GZJ A;  2ERH A;  1FR2 A;  2GZF A;  1GXG A;  1GXH A;  2GZE A;  2JBG A; 
#chains in the Genus database with same CATH topology
 4IZ6 A;  2PEI A;  3DS3 A;  1UNK A;  2PEQ A;  2BUO A;  1L0I A;  2GZG A;  2L9F A;  2XV6 A;  4GR2 A;  2L0Q A;  1IMQ A;  4F37 A;  4UHP B;  1Q86 Q;  2CG5 B;  4PH1 A;  5BS1 A;  2JU2 A;  1OR5 A;  4XFZ A;  4BPG A;  4H2Y C;  1KLP A;  2ERH A;  2KGE A;  2GZE A;  2PNG A;  3G29 A;  2PEO A;  2KOD A;  3G1G A;  3H47 A;  3DS4 A;  1F80 D;  2GDX A;  2MR8 A;  2K2Q A;  3H4E A;  2GDW A;  2N6Z A;  1YJ9 P;  2FAC A;  1ZMB A;  1CEI A;  3CCU P;  1VQP P;  2JAZ A;  3LMO A;  1HQB A;  2JU1 A;  1EMV A;  3I55 P;  2GYK A;  5HGL A;  5CZD B;  2LIU A;  2CWO A;  1Q7Y Q;  4MRT C;  5I4T G;  5KP8 B;  1VQN P;  1GXH A;  2JYL A;  2KOQ A;  1VQ6 P;  2M8L A;  1YHQ P;  3G4S P;  5KP6 B;  1YIJ P;  1VQ4 P;  3DTJ A;  3E2D A;  1VQ5 P;  2KGA A;  3LRY A;  2MVV A;  2KOR A;  3MGE A;  1NJI Q;  4DG9 A;  2MD9 A;  1D1D A;  1A43 A;  2N6Y A;  1A8O A;  2FAD A;  2JQ4 A;  1YJW P;  1M6E X;  1Z6M A;  3CCV P;  4U0C A;  1T8K A;  2EFJ A;  1W2B O;  1N8R Q;  2EG5 A;  1DNY A;  3CXC O;  4XFX A;  3NY7 B;  1EIA A;  2XZ1 C;  4IPY A;  1RO0 A;  2KG8 A;  1ZNV A;  3CC2 P;  3CE7 A;  2KOO A;  2EIA A;  1VQ8 P;  2Z45 A;  1AUM A;  1VQK P;  3I56 P;  2AVA A;  1VQM P;  2MR7 A;  1M74 A;  3DS2 A;  1VQL P;  2LF4 A;  3CME P;  2KW2 A;  1K73 Q;  1K8A Q;  1ACP A;  3VRL C;  3EJE A;  5HGO A;  5F2K A;  3B4Q A;  3DS0 A;  4BPH A;  2QA4 P;  1UJZ A;  2K0D X;  2VLN A;  2JYG A;  2MVU A;  2K0X A;  5KP7 B;  4PH0 A;  2CQ8 A;  3HYB A;  2CNR A;  4U0A A;  2FQ0 A;  2XZ0 D;  4U0D A;  2FAE A;  1E6J P;  4U0F A;  2LOL A;  3GZL A;  2M8P A;  2K0Y A;  2EHT A;  2L22 A;  2BHV A;  4PWV B;  3G21 A;  5EW5 E;  1JJ2 O;  5HGM A;  2M5R A;  5F2O A;  2OAR A;  2NO8 A;  2CGQ A;  3H0D A;  2DGY A;  3CCL P;  1HY8 A;  1FR2 A;  1GXG A;  1BAJ A;  3CMA P;  4XRQ A;  1M6N A;  5HVC A;  3G28 A;  1AYI A;  4R0M A;  3CC4 P;  2WPT A;  1AF8 A;  4CA3 A;  3P05 A;  3M1M A;  5EJD A;  2N50 A;  2N5I A;  2P9X A;  2LL8 A;  3CCE P;  3U43 A;  4H2W C;  2FVA A;  2K93 A;  2LML A;  3WBH A;  3DS5 A;  2KOP A;  1IMP A;  1MZ8 A;  4QNB A;  2OTJ P;  5HV8 A;  4XFY A;  3DPH A;  2FQ2 A;  1YI2 P;  4HKG A;  1QRJ A;  3CC7 P;  2GZF A;  2JBG A;  2PEJ A;  1YJN P;  1GPJ A;  1VHN A;  4COP A;  2XXM A;  2KGC A;  2FHS C;  1EOQ A;  2DNW A;  5BS2 A;  2GZI A;  1KQS O;  2QEX P;  5DCK A;  4M0I A;  1YIT P;  5F2N A;  2K92 A;  2Z44 A;  1M1K Q;  1E0H A;  2KG6 A;  4GR6 A;  4NEO A;  2LKI A;  3CCJ P;  2VLQ A;  5HGN A;  3RG2 A;  3G6E P;  2VLO A;  3G26 A;  1BXI A;  1M90 Q;  2XT1 A;  3DS1 A;  2Z46 A;  3EJB A;  2AF8 A;  2PY8 A;  3OW2 O;  1QVG O;  2K5X A;  2ROQ A;  2L4B A;  2N5H A;  2PEK A;  2LIW A;  5JPA A;  2AFD A;  3EJD A;  2GDY A;  4PXH B;  2FQ1 A;  2KWL A;  2KOS A;  2JB0 A;  2VLP A;  1DV5 A;  2L6E A;  1RNI A;  2GZJ A;  2N98 A;  3Q20 A;  2MF4 A;  2KGD A;  1K30 A;  3GZM A;  4WYM A;  1L0H A;  2FVE A;  3CPW O;  4U0E A;  2JGP A;  3RG6 C;  1KD1 Q;  4XRO A;  4QKO A;  2KG9 A;  7CEI A;  3CD6 P;  2PEM A;  1X3O A;  2M8N A;  2KR5 A;  2MY5 A;  2AFE A;  1VQ9 P;  2LTE A;  1NQ4 A;  3CCM P;  1K9M Q;  4H2X C;  1VQO P;  2ONT A;  3G0V A;  2VSQ A;  2K94 A;  4BPF A;  2FVF A;  1KC8 Q;  3CCR P;  1IUQ A;  2PEN A;  3CCS P;  3G71 P;  2QNW A;  3B5I A;  2E1M A;  3CCQ P;  4COC A;  4U0B A;  1Q81 Q;  1VKU A;  2JO0 A;  1RO2 A;  3GKL C;  1VQ7 P;  1QVF O;  1Q82 Q;  3NTE A;  3HZQ A;  1S72 P;  3GJN A;  3G1I A;  2EHS A;  2X2B A;  2OTL P;  2LPK A; 
#chains in the Genus database with same CATH homology
 1E0H A;  2K5X A;  1UJZ A;  1AYI A;  2K0D X;  3GKL C;  2VLQ A;  2VLN A;  5EW5 E;  1UNK A;  1IMP A;  2GZI A;  1MZ8 A;  2WPT A;  2GZG A;  4QKO A;  1CEI A;  1ZNV A;  3GJN A;  2VLO A;  1IMQ A;  2JAZ A;  4F37 A;  2NO8 A;  2JB0 A;  2VLP A;  4UHP B;  7CEI A;  1BXI A;  1EMV A;  2GYK A;  3U43 A;  2GZJ A;  2ERH A;  1FR2 A;  2GZF A;  1GXG A;  1GXH A;  2GZE A;  2JBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...