2GZFA

Crystal structure of the e9 dnase domain with a mutant immunity protein im9 (y54f)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIFYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Complex of the Colicin E9 DNase Domain with a Mutant Immunity Protein, IM9 (Y54F)
rcsb
source organism Escherichia coli k12
molecule tags Antibiotic/antibiotic inhibitor
molecule keywords Colicin-E9 immunity protein
total genus 28
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gzfA00
1CEIA 2GZEA 1ZNVA 2JBGA 2K5XA 2JAZA 2NO8A 1GXHA 2VLPA 2GYKA 3U43A 1IMQA 1E0HA 1EMVA 2VLNA 2GZGA 1UNKA 4F37A 1IMPA 2WPTA 1FR2A 2GZIA 1BXIA 5EW5E 2GZFA 1AYIA 2K0DX 7CEIA 3GJNA 2VLOA 1GXGA 1UJZA 2JB0A 2ERHA 2VLQA 3GKLC 4QKOA 2GZJA 1MZ8A 4UHPB
chains in the Genus database with same CATH superfamily
2GZEA 1HQBA 3P05A 1VQMP 3G29A 4XFXA 2VLNA 3NY7B 2WPTA 2KOPA 3H47A 1IUQA 1VKUA 2EFJA 5BS1A 1YHQP 2CQ8A 1M6EX 2VSQA 2FVEA 2L6EA 2CNRA 3VRLC 4F37A 1KD1Q 1K8AQ 4H2XC 5EW5E 2DGYA 2MVVA 1VQPP 1Q82Q 3G71P 2ERHA 2KGAA 2XT1A 2EG5A 1RNIA 2Z45A 3DS4A 5KP6B 3DTJA 4U0DA 1M74A 4BPHA 1GPJA 1VQ9P 1AUMA 2L22A 2DNWA 3NTEA 2L4BA 3GZMA 1Q81Q 1UJZA 3GKLC 2KGDA 1Z6MA 2N5HA 2MR7A 4M0IA 2JAZA 2NO8A 2PEOA 2LIUA 4U0FA 2M5RA 4H2WC 1E6JP 3CCEP 2GZGA 1N8RQ 2OARA 2N6YA 3G0VA 2GZIA 2PEJA 2N98A 2KODA 1EOQA 2MVUA 2KG9A 4HKGA 3CE7A 2XXMA 2PEIA 2FQ1A 4U0EA 1YIJP 1KQSO 2KR5A 1VHNA 2ROQA 2P9XA 4BPFA 3CCVP 2K0DX 5F2OA 2EHSA 2FADA 2VLQA 1D1DA 4PWVB 3H4EA 1DV5A 5KP7B 1QVFO 2CWOA 2FAEA 2FVAA 1AF8A 2LIWA 3H0DA 1IMQA 1L0HA 4PH0A 1UNKA 2KGCA 2MD9A 2PEKA 2K0YA 2FHSC 2QEXP 3CCMP 4XROA 5CZDB 2XZ0D 5HGLA 2AFEA 4U0CA 3CMAP 4H2YC 3B5IA 2ONTA 3DS3A 1GXHA 1Q86Q 1RO2A 1VQKP 3U43A 1EMVA 2KW2A 2K93A 1IMPA 1YJNP 2E1MA 5HVCA 1M90Q 1ZMBA 2JO0A 4QKOA 4R0MA 1VQ6P 2X2BA 1EIAA 3CMEP 2FQ0A 3EJEA 1VQ4P 3DS2A 3G21A 4U0BA 4IPYA 2FQ2A 1AYIA 2BUOA 3HZQA 2PENA 1GXGA 5BS2A 2KG6A 1KLPA 1YJWP 2M8PA 1K73Q 3EJDA 3G4SP 3G1IA 4IZ6A 1A8OA 2N5IA 2Z44A 4GR6A 1K30A 2GDXA 2LPKA 3GJNA 3G1GA 3DS0A 5HGMA 2K94A 2KOSA 3HYBA 3CC4P 1ZNVA 1A43A 2QA4P 2FVFA 2JYLA 2LF4A 1W2BO 3CPWO 3LMOA 3CCSP 3CD6P 3RG6C 4XFZA 4PXHB 1BAJA 2LL8A 1QRJA 2GDWA 2N6ZA 3Q20A 1HY8A 2JBGA 2KGEA 1NJIQ 3G28A 2MY5A 3I56P 2CG5B 5EJDA 1E0HA 4GR2A 2JYGA 2KWLA 2OTJP 4COPA 2PEMA 4XFYA 1JJ2O 2Z46A 1VQNP 1VQ8P 3CCLP 1CEIA 2KORA 2JQ4A 5F2NA 2M8NA 2N50A 2L9FA 3E2DA 2MR8A 1VQOP 3MGEA 2EHTA 4PH1A 2VLOA 2JGPA 2M8LA 1ACPA 3G6EP 2AVAA 1QVGO 4MRTC 4CA3A 2K5XA 3EJBA 2LOLA 1L0IA 1YITP 1M1KQ 4COCA 1Q7YQ 2LKIA 1KC8Q 1FR2A 5DCKA 1S72P 4NEOA 2PY8A 2GZJA 3CXCO 2LTEA 1VQ5P 5F2KA 3OW2O 3M1MA 4WYMA 5HV8A 1DNYA 2JU1A 2L0QA 2EIAA 1RO0A 2K92A 2OTLP 5I4TG 2GZFA 5HGOA 2XZ1C 4QNBA 2KOOA 2PNGA 4UHPB 3CCRP 3CC7P 2MF4A 2JU2A 2GYKA 3LRYA 2PEQA 2FACA 3CCUP 1OR5A 2K2QA 5HGNA 3B4QA 1T8KA 4DG9A 2QNWA 1YI2P 1MZ8A 1M6NA 2AFDA 7CEIA 4U0AA 2CGQA 3CC2P 1VQLP 2LMLA 1VQ7P 3I55P 1K9MQ 1NQ4A 3DS1A 3DPHA 1F80D 2VLPA 3WBHA 4BPGA 1X3OA 2KOQA 3G26A 2GDYA 2KG8A 3GZLA 3CCJP 3CCQP 2XV6A 1BXIA 3DS5A 5KP8B 2K0XA 5JPAA 2AF8A 4XRQA 2JB0A 1YJ9P 2BHVA 3RG2A
chains in the Genus database with same CATH topology
1CEIA 2GZEA 1ZNVA 2JBGA 2K5XA 2JAZA 2NO8A 1GXHA 2VLPA 2GYKA 3U43A 1IMQA 1E0HA 1EMVA 2VLNA 2GZGA 1UNKA 4F37A 1IMPA 2WPTA 1FR2A 2GZIA 1BXIA 5EW5E 2GZFA 1AYIA 2K0DX 7CEIA 3GJNA 2VLOA 1GXGA 1UJZA 2JB0A 2ERHA 2VLQA 3GKLC 4QKOA 2GZJA 1MZ8A 4UHPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CEI A;  2GZE A;  1ZNV A;  2JBG A;  2K5X A;  2JAZ A;  2NO8 A;  1GXH A;  2VLP A;  2GYK A;  3U43 A;  1IMQ A;  1E0H A;  1EMV A;  2VLN A;  2GZG A;  1UNK A;  4F37 A;  1IMP A;  2WPT A;  1FR2 A;  2GZI A;  1BXI A;  5EW5 E;  2GZF A;  1AYI A;  2K0D X;  7CEI A;  3GJN A;  2VLO A;  1GXG A;  1UJZ A;  2JB0 A;  2ERH A;  2VLQ A;  3GKL C;  4QKO A;  2GZJ A;  1MZ8 A;  4UHP B; 
#chains in the Genus database with same CATH topology
 2GZE A;  1HQB A;  3P05 A;  1VQM P;  3G29 A;  4XFX A;  2VLN A;  3NY7 B;  2WPT A;  2KOP A;  3H47 A;  1IUQ A;  1VKU A;  2EFJ A;  5BS1 A;  1YHQ P;  2CQ8 A;  1M6E X;  2VSQ A;  2FVE A;  2L6E A;  2CNR A;  3VRL C;  4F37 A;  1KD1 Q;  1K8A Q;  4H2X C;  5EW5 E;  2DGY A;  2MVV A;  1VQP P;  1Q82 Q;  3G71 P;  2ERH A;  2KGA A;  2XT1 A;  2EG5 A;  1RNI A;  2Z45 A;  3DS4 A;  5KP6 B;  3DTJ A;  4U0D A;  1M74 A;  4BPH A;  1GPJ A;  1VQ9 P;  1AUM A;  2L22 A;  2DNW A;  3NTE A;  2L4B A;  3GZM A;  1Q81 Q;  1UJZ A;  3GKL C;  2KGD A;  1Z6M A;  2N5H A;  2MR7 A;  4M0I A;  2JAZ A;  2NO8 A;  2PEO A;  2LIU A;  4U0F A;  2M5R A;  4H2W C;  1E6J P;  3CCE P;  2GZG A;  1N8R Q;  2OAR A;  2N6Y A;  3G0V A;  2GZI A;  2PEJ A;  2N98 A;  2KOD A;  1EOQ A;  2MVU A;  2KG9 A;  4HKG A;  3CE7 A;  2XXM A;  2PEI A;  2FQ1 A;  4U0E A;  1YIJ P;  1KQS O;  2KR5 A;  1VHN A;  2ROQ A;  2P9X A;  4BPF A;  3CCV P;  2K0D X;  5F2O A;  2EHS A;  2FAD A;  2VLQ A;  1D1D A;  4PWV B;  3H4E A;  1DV5 A;  5KP7 B;  1QVF O;  2CWO A;  2FAE A;  2FVA A;  1AF8 A;  2LIW A;  3H0D A;  1IMQ A;  1L0H A;  4PH0 A;  1UNK A;  2KGC A;  2MD9 A;  2PEK A;  2K0Y A;  2FHS C;  2QEX P;  3CCM P;  4XRO A;  5CZD B;  2XZ0 D;  5HGL A;  2AFE A;  4U0C A;  3CMA P;  4H2Y C;  3B5I A;  2ONT A;  3DS3 A;  1GXH A;  1Q86 Q;  1RO2 A;  1VQK P;  3U43 A;  1EMV A;  2KW2 A;  2K93 A;  1IMP A;  1YJN P;  2E1M A;  5HVC A;  1M90 Q;  1ZMB A;  2JO0 A;  4QKO A;  4R0M A;  1VQ6 P;  2X2B A;  1EIA A;  3CME P;  2FQ0 A;  3EJE A;  1VQ4 P;  3DS2 A;  3G21 A;  4U0B A;  4IPY A;  2FQ2 A;  1AYI A;  2BUO A;  3HZQ A;  2PEN A;  1GXG A;  5BS2 A;  2KG6 A;  1KLP A;  1YJW P;  2M8P A;  1K73 Q;  3EJD A;  3G4S P;  3G1I A;  4IZ6 A;  1A8O A;  2N5I A;  2Z44 A;  4GR6 A;  1K30 A;  2GDX A;  2LPK A;  3GJN A;  3G1G A;  3DS0 A;  5HGM A;  2K94 A;  2KOS A;  3HYB A;  3CC4 P;  1ZNV A;  1A43 A;  2QA4 P;  2FVF A;  2JYL A;  2LF4 A;  1W2B O;  3CPW O;  3LMO A;  3CCS P;  3CD6 P;  3RG6 C;  4XFZ A;  4PXH B;  1BAJ A;  2LL8 A;  1QRJ A;  2GDW A;  2N6Z A;  3Q20 A;  1HY8 A;  2JBG A;  2KGE A;  1NJI Q;  3G28 A;  2MY5 A;  3I56 P;  2CG5 B;  5EJD A;  1E0H A;  4GR2 A;  2JYG A;  2KWL A;  2OTJ P;  4COP A;  2PEM A;  4XFY A;  1JJ2 O;  2Z46 A;  1VQN P;  1VQ8 P;  3CCL P;  1CEI A;  2KOR A;  2JQ4 A;  5F2N A;  2M8N A;  2N50 A;  2L9F A;  3E2D A;  2MR8 A;  1VQO P;  3MGE A;  2EHT A;  4PH1 A;  2VLO A;  2JGP A;  2M8L A;  1ACP A;  3G6E P;  2AVA A;  1QVG O;  4MRT C;  4CA3 A;  2K5X A;  3EJB A;  2LOL A;  1L0I A;  1YIT P;  1M1K Q;  4COC A;  1Q7Y Q;  2LKI A;  1KC8 Q;  1FR2 A;  5DCK A;  1S72 P;  4NEO A;  2PY8 A;  2GZJ A;  3CXC O;  2LTE A;  1VQ5 P;  5F2K A;  3OW2 O;  3M1M A;  4WYM A;  5HV8 A;  1DNY A;  2JU1 A;  2L0Q A;  2EIA A;  1RO0 A;  2K92 A;  2OTL P;  5I4T G;  2GZF A;  5HGO A;  2XZ1 C;  4QNB A;  2KOO A;  2PNG A;  4UHP B;  3CCR P;  3CC7 P;  2MF4 A;  2JU2 A;  2GYK A;  3LRY A;  2PEQ A;  2FAC A;  3CCU P;  1OR5 A;  2K2Q A;  5HGN A;  3B4Q A;  1T8K A;  4DG9 A;  2QNW A;  1YI2 P;  1MZ8 A;  1M6N A;  2AFD A;  7CEI A;  4U0A A;  2CGQ A;  3CC2 P;  1VQL P;  2LML A;  1VQ7 P;  3I55 P;  1K9M Q;  1NQ4 A;  3DS1 A;  3DPH A;  1F80 D;  2VLP A;  3WBH A;  4BPG A;  1X3O A;  2KOQ A;  3G26 A;  2GDY A;  2KG8 A;  3GZL A;  3CCJ P;  3CCQ P;  2XV6 A;  1BXI A;  3DS5 A;  5KP8 B;  2K0X A;  5JPA A;  2AF8 A;  4XRQ A;  2JB0 A;  1YJ9 P;  2BHV A;  3RG2 A; 
#chains in the Genus database with same CATH homology
 1CEI A;  2GZE A;  1ZNV A;  2JBG A;  2K5X A;  2JAZ A;  2NO8 A;  1GXH A;  2VLP A;  2GYK A;  3U43 A;  1IMQ A;  1E0H A;  1EMV A;  2VLN A;  2GZG A;  1UNK A;  4F37 A;  1IMP A;  2WPT A;  1FR2 A;  2GZI A;  1BXI A;  5EW5 E;  2GZF A;  1AYI A;  2K0D X;  7CEI A;  3GJN A;  2VLO A;  1GXG A;  1UJZ A;  2JB0 A;  2ERH A;  2VLQ A;  3GKL C;  4QKO A;  2GZJ A;  1MZ8 A;  4UHP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...