2GZFA

Crystal structure of the e9 dnase domain with a mutant immunity protein im9 (y54f)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
KHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIFYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic/antibiotic inhibitor
molecule keywords Colicin-E9 immunity protein
publication title Crystal Structure of the Complex of the Colicin E9 DNase Domain with a Mutant Immunity Protein, IM9 (Y54F)
rcsb
source organism Escherichia coli k12
total genus 28
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gzfA00
2VLNA 2NO8A 1UJZA 1GXHA 2GZGA 2WPTA 1ZNVA 3GKLC 1GXGA 4QKOA 1IMQA 1AYIA 2VLPA 1MZ8A 1FR2A 2K5XA 1EMVA 2JAZA 2ERHA 5EW5E 1IMPA 2GZIA 2VLQA 1UNKA 3GJNA 4F37A 4UHPB 2VLOA 2GZEA 1BXIA 2GZJA 2GYKA 3U43A 7CEIA 2GZFA 1CEIA 2JBGA 1E0HA 2K0DX 2JB0A
chains in the Genus database with same CATH superfamily
2M8LA 2LIUA 1DNYA 1VHNA 1D1DA 3CMAP 2KODA 2PEKA 2KGAA 3CCEP 1S72P 2FQ0A 2JGPA 2JU2A 1YJ9P 4BPHA 2VLNA 1Q7YQ 2E1MA 3NY7B 2FQ1A 2CG5B 2FQ2A 3DS3A 1FR2A 1Q82Q 1BAJA 2XXMA 1ACPA 3GZLA 2XT1A 3EJBA 1HY8A 1KD1Q 2KR5A 1KQSO 1VQMP 1E0HA 3H47A 5F2KA 2Z44A 1W2BO 1KLPA 1UJZA 2WPTA 2AF8A 2K92A 2KGDA 2N5HA 2DGYA 1M90Q 4H2YC 5KP6B 2LMLA 4COPA 3CCQP 2PNGA 2QA4P 1AF8A 4CA3A 7CEIA 1VKUA 3CCRP 4H2WC 3NTEA 2K0XA 4H2XC 1GXHA 2MD9A 2N98A 2N6YA 3CCVP 5HGOA 2MR8A 1IMQA 1AYIA 4IPYA 1VQ7P 1T8KA 1DV5A 5HV8A 1VQ9P 2JYGA 2KOSA 3CE7A 2KG8A 4COCA 5JPAA 1EIAA 1K30A 4U0FA 1YHQP 1Q81Q 1L0HA 2LOLA 2ERHA 1KC8Q 4R0MA 1YI2P 4UHPB 2L0QA 1QVGO 1BXIA 5EJDA 4PXHB 3CMEP 1RNIA 4PH1A 2MY5A 4XFXA 2FVEA 3HZQA 4M0IA 3H4EA 3RG6C 2M5RA 3G28A 2GDWA 4U0AA 5F2OA 2MVUA 4DG9A 2M8NA 2CGQA 2K0YA 3H0DA 1EMVA 3G1IA 1OR5A 2GZEA 2AFEA 2L22A 2K93A 3CCMP 1YJWP 4HKGA 2AFDA 3CC4P 2GZFA 2OARA 1EOQA 1A43A 3G71P 4QNBA 2MR7A 4XRQA 2P9XA 2JU1A 2FVAA 4QKOA 1RO0A 2M8PA 1YJNP 1K73Q 2JYLA 2L4BA 4GR2A 2CQ8A 3VRLC 4U0DA 1Z6MA 4WYMA 1VQ4P 3G26A 2FAEA 1ZNVA 3GKLC 1M74A 2EFJA 2PEIA 3G29A 2JAZA 2MF4A 1VQKP 2QNWA 1JJ2O 3CPWO 5HVCA 2BHVA 1X3OA 2KG9A 1F80D 1RO2A 2NO8A 3CC7P 2DNWA 4XROA 5KP7B 2Z45A 2KW2A 2XV6A 3CCJP 3I56P 4PH0A 2KG6A 2FADA 4XFYA 3CCSP 1VQNP 2PENA 3HYBA 2ONTA 3DS4A 5DCKA 2LKIA 2KOQA 4BPGA 3G6EP 2EIAA 2N50A 2QEXP 1M6EX 2OTLP 3DS0A 1NJIQ 4GR6A 1HQBA 1GXGA 2Z46A 1VQ8P 1ZMBA 3P05A 2FHSC 3EJEA 2GDYA 3CCLP 3WBHA 4F37A 3GJNA 2FVFA 2VSQA 2VLOA 2BUOA 3LRYA 5BS1A 5F2NA 2PEQA 2AVAA 2JQ4A 1CEIA 1M6NA 3E2DA 3OW2O 3DS5A 5HGMA 2JB0A 3B5IA 2KOOA 4U0CA 2GZGA 1VQOP 2K94A 2LL8A 5HGNA 1K9MQ 3DTJA 2VLQA 1UNKA 2KORA 5I4TG 2GZJA 2KGEA 2ROQA 2PEMA 2MVVA 3G0VA 3CD6P 2LF4A 2KGCA 2VLPA 1MZ8A 4U0BA 3CC2P 2GZIA 2XZ1C 2JO0A 1A8OA 3EJDA 2GDXA 2XZ0D 3MGEA 3I55P 1VQPP 1YITP 3G1GA 1NQ4A 2KOPA 1AUMA 3DS2A 3Q20A 2EG5A 4U0EA 3CXCO 2N6ZA 1YIJP 1QRJA 1M1KQ 5BS2A 2GYKA 3U43A 2LIWA 1L0IA 5CZDB 3CCUP 3B4QA 1Q86Q 2FACA 4IZ6A 2K2QA 2PEOA 2LTEA 2K5XA 2L9FA 3M1MA 2CWOA 1QVFO 1VQLP 3G4SP 3DPHA 3LMOA 2EHSA 1N8RQ 5KP8B 3G21A 2N5IA 2CNRA 2LPKA 2K0DX 2PY8A 2JBGA 4MRTC 2PEJA 2L6EA 2KWLA 4BPFA 4NEOA 3RG2A 1VQ5P 5EW5E 1IMPA 1IUQA 5HGLA 1GPJA 4PWVB 3DS1A 3GZMA 1E6JP 2OTJP 1VQ6P 2X2BA 1K8AQ 2EHTA 4XFZA
chains in the Genus database with same CATH topology
2VLNA 2NO8A 1UJZA 1GXHA 2GZGA 2WPTA 1ZNVA 3GKLC 1GXGA 4QKOA 1IMQA 1AYIA 2VLPA 1MZ8A 1FR2A 2K5XA 1EMVA 2JAZA 2ERHA 5EW5E 1IMPA 2GZIA 2VLQA 1UNKA 3GJNA 4F37A 4UHPB 2VLOA 2GZEA 1BXIA 2GZJA 2GYKA 3U43A 7CEIA 2GZFA 1CEIA 2JBGA 1E0HA 2K0DX 2JB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLN A;  2NO8 A;  1UJZ A;  1GXH A;  2GZG A;  2WPT A;  1ZNV A;  3GKL C;  1GXG A;  4QKO A;  1IMQ A;  1AYI A;  2VLP A;  1MZ8 A;  1FR2 A;  2K5X A;  1EMV A;  2JAZ A;  2ERH A;  5EW5 E;  1IMP A;  2GZI A;  2VLQ A;  1UNK A;  3GJN A;  4F37 A;  4UHP B;  2VLO A;  2GZE A;  1BXI A;  2GZJ A;  2GYK A;  3U43 A;  7CEI A;  2GZF A;  1CEI A;  2JBG A;  1E0H A;  2K0D X;  2JB0 A; 
#chains in the Genus database with same CATH topology
 2M8L A;  2LIU A;  1DNY A;  1VHN A;  1D1D A;  3CMA P;  2KOD A;  2PEK A;  2KGA A;  3CCE P;  1S72 P;  2FQ0 A;  2JGP A;  2JU2 A;  1YJ9 P;  4BPH A;  2VLN A;  1Q7Y Q;  2E1M A;  3NY7 B;  2FQ1 A;  2CG5 B;  2FQ2 A;  3DS3 A;  1FR2 A;  1Q82 Q;  1BAJ A;  2XXM A;  1ACP A;  3GZL A;  2XT1 A;  3EJB A;  1HY8 A;  1KD1 Q;  2KR5 A;  1KQS O;  1VQM P;  1E0H A;  3H47 A;  5F2K A;  2Z44 A;  1W2B O;  1KLP A;  1UJZ A;  2WPT A;  2AF8 A;  2K92 A;  2KGD A;  2N5H A;  2DGY A;  1M90 Q;  4H2Y C;  5KP6 B;  2LML A;  4COP A;  3CCQ P;  2PNG A;  2QA4 P;  1AF8 A;  4CA3 A;  7CEI A;  1VKU A;  3CCR P;  4H2W C;  3NTE A;  2K0X A;  4H2X C;  1GXH A;  2MD9 A;  2N98 A;  2N6Y A;  3CCV P;  5HGO A;  2MR8 A;  1IMQ A;  1AYI A;  4IPY A;  1VQ7 P;  1T8K A;  1DV5 A;  5HV8 A;  1VQ9 P;  2JYG A;  2KOS A;  3CE7 A;  2KG8 A;  4COC A;  5JPA A;  1EIA A;  1K30 A;  4U0F A;  1YHQ P;  1Q81 Q;  1L0H A;  2LOL A;  2ERH A;  1KC8 Q;  4R0M A;  1YI2 P;  4UHP B;  2L0Q A;  1QVG O;  1BXI A;  5EJD A;  4PXH B;  3CME P;  1RNI A;  4PH1 A;  2MY5 A;  4XFX A;  2FVE A;  3HZQ A;  4M0I A;  3H4E A;  3RG6 C;  2M5R A;  3G28 A;  2GDW A;  4U0A A;  5F2O A;  2MVU A;  4DG9 A;  2M8N A;  2CGQ A;  2K0Y A;  3H0D A;  1EMV A;  3G1I A;  1OR5 A;  2GZE A;  2AFE A;  2L22 A;  2K93 A;  3CCM P;  1YJW P;  4HKG A;  2AFD A;  3CC4 P;  2GZF A;  2OAR A;  1EOQ A;  1A43 A;  3G71 P;  4QNB A;  2MR7 A;  4XRQ A;  2P9X A;  2JU1 A;  2FVA A;  4QKO A;  1RO0 A;  2M8P A;  1YJN P;  1K73 Q;  2JYL A;  2L4B A;  4GR2 A;  2CQ8 A;  3VRL C;  4U0D A;  1Z6M A;  4WYM A;  1VQ4 P;  3G26 A;  2FAE A;  1ZNV A;  3GKL C;  1M74 A;  2EFJ A;  2PEI A;  3G29 A;  2JAZ A;  2MF4 A;  1VQK P;  2QNW A;  1JJ2 O;  3CPW O;  5HVC A;  2BHV A;  1X3O A;  2KG9 A;  1F80 D;  1RO2 A;  2NO8 A;  3CC7 P;  2DNW A;  4XRO A;  5KP7 B;  2Z45 A;  2KW2 A;  2XV6 A;  3CCJ P;  3I56 P;  4PH0 A;  2KG6 A;  2FAD A;  4XFY A;  3CCS P;  1VQN P;  2PEN A;  3HYB A;  2ONT A;  3DS4 A;  5DCK A;  2LKI A;  2KOQ A;  4BPG A;  3G6E P;  2EIA A;  2N50 A;  2QEX P;  1M6E X;  2OTL P;  3DS0 A;  1NJI Q;  4GR6 A;  1HQB A;  1GXG A;  2Z46 A;  1VQ8 P;  1ZMB A;  3P05 A;  2FHS C;  3EJE A;  2GDY A;  3CCL P;  3WBH A;  4F37 A;  3GJN A;  2FVF A;  2VSQ A;  2VLO A;  2BUO A;  3LRY A;  5BS1 A;  5F2N A;  2PEQ A;  2AVA A;  2JQ4 A;  1CEI A;  1M6N A;  3E2D A;  3OW2 O;  3DS5 A;  5HGM A;  2JB0 A;  3B5I A;  2KOO A;  4U0C A;  2GZG A;  1VQO P;  2K94 A;  2LL8 A;  5HGN A;  1K9M Q;  3DTJ A;  2VLQ A;  1UNK A;  2KOR A;  5I4T G;  2GZJ A;  2KGE A;  2ROQ A;  2PEM A;  2MVV A;  3G0V A;  3CD6 P;  2LF4 A;  2KGC A;  2VLP A;  1MZ8 A;  4U0B A;  3CC2 P;  2GZI A;  2XZ1 C;  2JO0 A;  1A8O A;  3EJD A;  2GDX A;  2XZ0 D;  3MGE A;  3I55 P;  1VQP P;  1YIT P;  3G1G A;  1NQ4 A;  2KOP A;  1AUM A;  3DS2 A;  3Q20 A;  2EG5 A;  4U0E A;  3CXC O;  2N6Z A;  1YIJ P;  1QRJ A;  1M1K Q;  5BS2 A;  2GYK A;  3U43 A;  2LIW A;  1L0I A;  5CZD B;  3CCU P;  3B4Q A;  1Q86 Q;  2FAC A;  4IZ6 A;  2K2Q A;  2PEO A;  2LTE A;  2K5X A;  2L9F A;  3M1M A;  2CWO A;  1QVF O;  1VQL P;  3G4S P;  3DPH A;  3LMO A;  2EHS A;  1N8R Q;  5KP8 B;  3G21 A;  2N5I A;  2CNR A;  2LPK A;  2K0D X;  2PY8 A;  2JBG A;  4MRT C;  2PEJ A;  2L6E A;  2KWL A;  4BPF A;  4NEO A;  3RG2 A;  1VQ5 P;  5EW5 E;  1IMP A;  1IUQ A;  5HGL A;  1GPJ A;  4PWV B;  3DS1 A;  3GZM A;  1E6J P;  2OTJ P;  1VQ6 P;  2X2B A;  1K8A Q;  2EHT A;  4XFZ A; 
#chains in the Genus database with same CATH homology
 2VLN A;  2NO8 A;  1UJZ A;  1GXH A;  2GZG A;  2WPT A;  1ZNV A;  3GKL C;  1GXG A;  4QKO A;  1IMQ A;  1AYI A;  2VLP A;  1MZ8 A;  1FR2 A;  2K5X A;  1EMV A;  2JAZ A;  2ERH A;  5EW5 E;  1IMP A;  2GZI A;  2VLQ A;  1UNK A;  3GJN A;  4F37 A;  4UHP B;  2VLO A;  2GZE A;  1BXI A;  2GZJ A;  2GYK A;  3U43 A;  7CEI A;  2GZF A;  1CEI A;  2JBG A;  1E0H A;  2K0D X;  2JB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...