3G21A

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: low ph
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
AGPWADIMQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gag polyprotein
publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
total genus 25
structure length 77
sequence length 77
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g21A00
2LF4A 4XFXA 3NTEA 1AUMA 3DS1A 3P05A 4XFZA 2XT1A 4IPYA 3DS2A 4WYMA 3MGEA 4U0BA 5DCKA 1E6JP 4U0EA 4PH0A 5HGNA 4M0IA 3G1IA 2BUOA 2M8LA 3DS3A 5JPAA 2M8PA 3H47A 1D1DA 3DTJA 3G28A 5I4TG 3G0VA 5HGLA 3DS5A 1EIAA 2KODA 4COPA 3DS4A 1QRJA 1A8OA 2XV6A 2XXMA 4XFYA 4XRQA 1EOQA 3G26A 4XROA 4U0AA 2JYLA 2JO0A 4U0CA 3VRLC 1A43A 1BAJA 3G29A 3H4EA 2M8NA 3G21A 3G1GA 4U0FA 3DPHA 4PH1A 2ONTA 2L6EA 2JYGA 3DS0A 4COCA 4U0DA 2EIAA 3LRYA 5HGOA 5HGMA 4QNBA
chains in the Genus database with same CATH superfamily
1VQOP 3EJEA 1FR2A 3G6EP 1VQPP 2K2QA 2LOLA 4NEOA 1DNYA 1EIAA 2KGDA 1Q7YQ 1HQBA 1BXIA 3H4EA 2OTLP 1T8KA 2PNGA 3Q20A 1GPJA 3EJDA 3P05A 2FACA 2VLNA 2EHSA 4UHPB 3WBHA 2K0DX 1YI2P 1Q81Q 2K93A 2LIUA 1EOQA 1YJNP 2JO0A 4U0CA 1M1KQ 2L0QA 1M90Q 5HGOA 3DS2A 4WYMA 2KR5A 2BHVA 2CNRA 2MVVA 3G28A 4H2YC 2KGCA 1RO2A 1QRJA 2AFDA 2K5XA 2GZEA 3GKLC 2GZIA 3DPHA 1VQ8P 5BS1A 4HKGA 1OR5A 3G1IA 3I55P 2Z45A 2KOSA 3CCJP 3G0VA 5HGLA 2JU1A 2KWLA 2MD9A 1VKUA 1NQ4A 2LKIA 1ZNVA 1UNKA 3I56P 1W2BO 2XZ1C 2FQ0A 2LF4A 2E1MA 1CEIA 1F80D 4PH0A 5HGNA 1VQ7P 5BS2A 1YJWP 1VQ6P 2K0XA 2VLQA 2XV6A 3CCLP 1RNIA 1AYIA 4DG9A 5F2NA 2CQ8A 2KGEA 7CEIA 4IZ6A 1N8RQ 5KP8B 2JU2A 2LMLA 4BPHA 2KG8A 2AF8A 3RG2A 2KW2A 2VLPA 2MY5A 5KP7B 3DS5A 3M1MA 3G71P 2MR7A 3DS4A 2PEIA 3E2DA 3HZQA 3G29A 1M74A 2L6EA 3LRYA 2OARA 2XZ0D 1K73Q 4U0EA 2GDYA 2M8LA 4CA3A 2JQ4A 1GXHA 1RO0A 2EG5A 2JB0A 4GR6A 3CMAP 3GJNA 2L22A 3OW2O 1VQKP 2N5IA 1YITP 5F2OA 2FAEA 2MF4A 2DGYA 3HYBA 1Q86Q 2Z46A 2KODA 2MVUA 3GZLA 2Z44A 2CWOA 1UJZA 1NJIQ 3B5IA 2FVFA 2KOOA 1K30A 2L4BA 3CC2P 2KGAA 4BPFA 3B4QA 1VQ4P 4U0BA 4MRTC 4F37A 1D1DA 2GZFA 1K8AQ 2EHTA 1YIJP 2QEXP 2X2BA 4XROA 4BPGA 5KP6B 1M6NA 2FVAA 2QA4P 2LPKA 3GZMA 3DS0A 2P9XA 4U0DA 2QNWA 3H0DA 3CCRP 1ZMBA 4IPYA 1JJ2O 1E6JP 2FQ2A 2K92A 5EW5E 1IMQA 1QVGO 3CCSP 1VQ9P 3CMEP 2ERHA 3CXCO 1AF8A 4PH1A 2KG6A 2N5HA 2PY8A 1YJ9P 2KORA 3DS1A 2L9FA 3MGEA 2FVEA 4M0IA 1VQ5P 3DTJA 2PEMA 2JBGA 1A8OA 4XRQA 2GZJA 2KG9A 3VRLC 1A43A 3G1GA 3CCQP 2N6YA 2EIAA 5F2KA 5HV8A 1AUMA 2N6ZA 2XT1A 4R0MA 3CCMP 2GYKA 3G4SP 2LTEA 3CE7A 2CG5B 3NY7B 4COPA 3CPWO 2PENA 2LL8A 2EFJA 1ACPA 4XFYA 3EJBA 3U43A 2JYLA 1BAJA 3RG6C 3CC7P 2MR8A 1K9MQ 3CD6P 2M5RA 2GDXA 1X3OA 4XFZA 5I4TG 5JPAA 3H47A 1Z6MA 2GZGA 2AVAA 2NO8A 2K0YA 2XXMA 2GDWA 2DNWA 3LMOA 2VSQA 2CGQA 1M6EX 2VLOA 2JYGA 1HY8A 1QVFO 1IUQA 4XFXA 3NTEA 4PWVB 1EMVA 2BUOA 2M8PA 5HVCA 4H2XC 1S72P 1GXGA 2WPTA 2JAZA 2FHSC 2PEJA 2OTJP 4GR2A 2N98A 2PEOA 1L0HA 2ONTA 1KC8Q 4COCA 2FQ1A 3DS3A 2LIWA 2K94A 4QKOA 1YHQP 2FADA 1VHNA 1VQMP 1KD1Q 5CZDB 1KQSO 2ROQA 4U0AA 2KOPA 1MZ8A 3CCVP 2AFEA 2PEQA 2M8NA 3G21A 4U0FA 2N50A 2JGPA 1L0IA 4PXHB 5HGMA 5EJDA 3CCUP 5DCKA 1IMPA 2KOQA 1VQLP 3CC4P 1KLPA 1E0HA 3CCEP 3G26A 1Q82Q 1DV5A 2PEKA 4H2WC 1VQNP 4QNBA
chains in the Genus database with same CATH topology
2LF4A 1VQOP 4XFZA 1VQ4P 2E1MA 5I4TG 4U0BA 4PH0A 5HGNA 1VQ7P 3G6EP 1VQPP 5JPAA 3H47A 5BS2A 1D1DA 1YJWP 1VQ6P 1EIAA 1K8AQ 2XV6A 2XXMA 1YIJP 2QEXP 3CCLP 4XROA 1RNIA 1Q7YQ 5F2NA 3H4EA 1M6NA 2OTLP 1N8RQ 2QA4P 1M6EX 2JYGA 3DS0A 2P9XA 3Q20A 4U0DA 3H0DA 1QVFO 3CCRP 1IUQA 4XFXA 3NTEA 3P05A 1ZMBA 4IPYA 1JJ2O 1E6JP 3WBHA 2BUOA 2M8PA 3DS5A 1S72P 3M1MA 3G71P 3DS4A 1YI2P 1Q81Q 2PEIA 1QVGO 1EOQA 3CCSP 1YJNP 1VQ9P 2PEJA 2OTJP 4GR2A 2JO0A 3E2DA 4U0CA 3HZQA 1M1KQ 3CMEP 3G29A 1M74A 2PEOA 3CXCO 4PH1A 2ONTA 1KC8Q 2L6EA 4COCA 1M90Q 3LRYA 5HGOA 2PY8A 2OARA 1YJ9P 3DS1A 3DS2A 4WYMA 3MGEA 1K73Q 4U0EA 4M0IA 2M8LA 3DS3A 2BHVA 1VQ5P 3DTJA 3G28A 2PEMA 1YHQP 1RO2A 1VQMP 1QRJA 1A8OA 1KD1Q 4XRQA 1RO0A 1KQSO 2EG5A 4U0AA 3VRLC 1A43A 3CCVP 4GR6A 2PEQA 3CMAP 2M8NA 3G21A 3G1GA 4U0FA 3DPHA 3CCQP 2EIAA 5HGMA 1VQ8P 5F2KA 5BS1A 3OW2O 3CCUP 1VQKP 1AUMA 2XT1A 5DCKA 5F2OA 1YITP 3CCMP 3G1IA 3I55P 3G4SP 2DGYA 2Z45A 3HYBA 3CCJP 3G0VA 5HGLA 1Q86Q 2Z46A 2KODA 4COPA 3CPWO 1VQLP 2PENA 3CC4P 2EFJA 2Z44A 4XFYA 2CWOA 3CCEP 3G26A 1Q82Q 2JYLA 2PEKA 1NJIQ 1BAJA 3RG6C 3B5IA 3CC7P 1K9MQ 3CD6P 3I56P 1W2BO 1K30A 3CC2P 1VQNP 4QNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LF4 A;  4XFX A;  3NTE A;  1AUM A;  3DS1 A;  3P05 A;  4XFZ A;  2XT1 A;  4IPY A;  3DS2 A;  4WYM A;  3MGE A;  4U0B A;  5DCK A;  1E6J P;  4U0E A;  4PH0 A;  5HGN A;  4M0I A;  3G1I A;  2BUO A;  2M8L A;  3DS3 A;  5JPA A;  2M8P A;  3H47 A;  1D1D A;  3DTJ A;  3G28 A;  5I4T G;  3G0V A;  5HGL A;  3DS5 A;  1EIA A;  2KOD A;  4COP A;  3DS4 A;  1QRJ A;  1A8O A;  2XV6 A;  2XXM A;  4XFY A;  4XRQ A;  1EOQ A;  3G26 A;  4XRO A;  4U0A A;  2JYL A;  2JO0 A;  4U0C A;  3VRL C;  1A43 A;  1BAJ A;  3G29 A;  3H4E A;  2M8N A;  3G21 A;  3G1G A;  4U0F A;  3DPH A;  4PH1 A;  2ONT A;  2L6E A;  2JYG A;  3DS0 A;  4COC A;  4U0D A;  2EIA A;  3LRY A;  5HGO A;  5HGM A;  4QNB A; 
#chains in the Genus database with same CATH topology
 1VQO P;  3EJE A;  1FR2 A;  3G6E P;  1VQP P;  2K2Q A;  2LOL A;  4NEO A;  1DNY A;  1EIA A;  2KGD A;  1Q7Y Q;  1HQB A;  1BXI A;  3H4E A;  2OTL P;  1T8K A;  2PNG A;  3Q20 A;  1GPJ A;  3EJD A;  3P05 A;  2FAC A;  2VLN A;  2EHS A;  4UHP B;  3WBH A;  2K0D X;  1YI2 P;  1Q81 Q;  2K93 A;  2LIU A;  1EOQ A;  1YJN P;  2JO0 A;  4U0C A;  1M1K Q;  2L0Q A;  1M90 Q;  5HGO A;  3DS2 A;  4WYM A;  2KR5 A;  2BHV A;  2CNR A;  2MVV A;  3G28 A;  4H2Y C;  2KGC A;  1RO2 A;  1QRJ A;  2AFD A;  2K5X A;  2GZE A;  3GKL C;  2GZI A;  3DPH A;  1VQ8 P;  5BS1 A;  4HKG A;  1OR5 A;  3G1I A;  3I55 P;  2Z45 A;  2KOS A;  3CCJ P;  3G0V A;  5HGL A;  2JU1 A;  2KWL A;  2MD9 A;  1VKU A;  1NQ4 A;  2LKI A;  1ZNV A;  1UNK A;  3I56 P;  1W2B O;  2XZ1 C;  2FQ0 A;  2LF4 A;  2E1M A;  1CEI A;  1F80 D;  4PH0 A;  5HGN A;  1VQ7 P;  5BS2 A;  1YJW P;  1VQ6 P;  2K0X A;  2VLQ A;  2XV6 A;  3CCL P;  1RNI A;  1AYI A;  4DG9 A;  5F2N A;  2CQ8 A;  2KGE A;  7CEI A;  4IZ6 A;  1N8R Q;  5KP8 B;  2JU2 A;  2LML A;  4BPH A;  2KG8 A;  2AF8 A;  3RG2 A;  2KW2 A;  2VLP A;  2MY5 A;  5KP7 B;  3DS5 A;  3M1M A;  3G71 P;  2MR7 A;  3DS4 A;  2PEI A;  3E2D A;  3HZQ A;  3G29 A;  1M74 A;  2L6E A;  3LRY A;  2OAR A;  2XZ0 D;  1K73 Q;  4U0E A;  2GDY A;  2M8L A;  4CA3 A;  2JQ4 A;  1GXH A;  1RO0 A;  2EG5 A;  2JB0 A;  4GR6 A;  3CMA P;  3GJN A;  2L22 A;  3OW2 O;  1VQK P;  2N5I A;  1YIT P;  5F2O A;  2FAE A;  2MF4 A;  2DGY A;  3HYB A;  1Q86 Q;  2Z46 A;  2KOD A;  2MVU A;  3GZL A;  2Z44 A;  2CWO A;  1UJZ A;  1NJI Q;  3B5I A;  2FVF A;  2KOO A;  1K30 A;  2L4B A;  3CC2 P;  2KGA A;  4BPF A;  3B4Q A;  1VQ4 P;  4U0B A;  4MRT C;  4F37 A;  1D1D A;  2GZF A;  1K8A Q;  2EHT A;  1YIJ P;  2QEX P;  2X2B A;  4XRO A;  4BPG A;  5KP6 B;  1M6N A;  2FVA A;  2QA4 P;  2LPK A;  3GZM A;  3DS0 A;  2P9X A;  4U0D A;  2QNW A;  3H0D A;  3CCR P;  1ZMB A;  4IPY A;  1JJ2 O;  1E6J P;  2FQ2 A;  2K92 A;  5EW5 E;  1IMQ A;  1QVG O;  3CCS P;  1VQ9 P;  3CME P;  2ERH A;  3CXC O;  1AF8 A;  4PH1 A;  2KG6 A;  2N5H A;  2PY8 A;  1YJ9 P;  2KOR A;  3DS1 A;  2L9F A;  3MGE A;  2FVE A;  4M0I A;  1VQ5 P;  3DTJ A;  2PEM A;  2JBG A;  1A8O A;  4XRQ A;  2GZJ A;  2KG9 A;  3VRL C;  1A43 A;  3G1G A;  3CCQ P;  2N6Y A;  2EIA A;  5F2K A;  5HV8 A;  1AUM A;  2N6Z A;  2XT1 A;  4R0M A;  3CCM P;  2GYK A;  3G4S P;  2LTE A;  3CE7 A;  2CG5 B;  3NY7 B;  4COP A;  3CPW O;  2PEN A;  2LL8 A;  2EFJ A;  1ACP A;  4XFY A;  3EJB A;  3U43 A;  2JYL A;  1BAJ A;  3RG6 C;  3CC7 P;  2MR8 A;  1K9M Q;  3CD6 P;  2M5R A;  2GDX A;  1X3O A;  4XFZ A;  5I4T G;  5JPA A;  3H47 A;  1Z6M A;  2GZG A;  2AVA A;  2NO8 A;  2K0Y A;  2XXM A;  2GDW A;  2DNW A;  3LMO A;  2VSQ A;  2CGQ A;  1M6E X;  2VLO A;  2JYG A;  1HY8 A;  1QVF O;  1IUQ A;  4XFX A;  3NTE A;  4PWV B;  1EMV A;  2BUO A;  2M8P A;  5HVC A;  4H2X C;  1S72 P;  1GXG A;  2WPT A;  2JAZ A;  2FHS C;  2PEJ A;  2OTJ P;  4GR2 A;  2N98 A;  2PEO A;  1L0H A;  2ONT A;  1KC8 Q;  4COC A;  2FQ1 A;  3DS3 A;  2LIW A;  2K94 A;  4QKO A;  1YHQ P;  2FAD A;  1VHN A;  1VQM P;  1KD1 Q;  5CZD B;  1KQS O;  2ROQ A;  4U0A A;  2KOP A;  1MZ8 A;  3CCV P;  2AFE A;  2PEQ A;  2M8N A;  3G21 A;  4U0F A;  2N50 A;  2JGP A;  1L0I A;  4PXH B;  5HGM A;  5EJD A;  3CCU P;  5DCK A;  1IMP A;  2KOQ A;  1VQL P;  3CC4 P;  1KLP A;  1E0H A;  3CCE P;  3G26 A;  1Q82 Q;  1DV5 A;  2PEK A;  4H2W C;  1VQN P;  4QNB A; 
#chains in the Genus database with same CATH homology
 2LF4 A;  1VQO P;  4XFZ A;  1VQ4 P;  2E1M A;  5I4T G;  4U0B A;  4PH0 A;  5HGN A;  1VQ7 P;  3G6E P;  1VQP P;  5JPA A;  3H47 A;  5BS2 A;  1D1D A;  1YJW P;  1VQ6 P;  1EIA A;  1K8A Q;  2XV6 A;  2XXM A;  1YIJ P;  2QEX P;  3CCL P;  4XRO A;  1RNI A;  1Q7Y Q;  5F2N A;  3H4E A;  1M6N A;  2OTL P;  1N8R Q;  2QA4 P;  1M6E X;  2JYG A;  3DS0 A;  2P9X A;  3Q20 A;  4U0D A;  3H0D A;  1QVF O;  3CCR P;  1IUQ A;  4XFX A;  3NTE A;  3P05 A;  1ZMB A;  4IPY A;  1JJ2 O;  1E6J P;  3WBH A;  2BUO A;  2M8P A;  3DS5 A;  1S72 P;  3M1M A;  3G71 P;  3DS4 A;  1YI2 P;  1Q81 Q;  2PEI A;  1QVG O;  1EOQ A;  3CCS P;  1YJN P;  1VQ9 P;  2PEJ A;  2OTJ P;  4GR2 A;  2JO0 A;  3E2D A;  4U0C A;  3HZQ A;  1M1K Q;  3CME P;  3G29 A;  1M74 A;  2PEO A;  3CXC O;  4PH1 A;  2ONT A;  1KC8 Q;  2L6E A;  4COC A;  1M90 Q;  3LRY A;  5HGO A;  2PY8 A;  2OAR A;  1YJ9 P;  3DS1 A;  3DS2 A;  4WYM A;  3MGE A;  1K73 Q;  4U0E A;  4M0I A;  2M8L A;  3DS3 A;  2BHV A;  1VQ5 P;  3DTJ A;  3G28 A;  2PEM A;  1YHQ P;  1RO2 A;  1VQM P;  1QRJ A;  1A8O A;  1KD1 Q;  4XRQ A;  1RO0 A;  1KQS O;  2EG5 A;  4U0A A;  3VRL C;  1A43 A;  3CCV P;  4GR6 A;  2PEQ A;  3CMA P;  2M8N A;  3G21 A;  3G1G A;  4U0F A;  3DPH A;  3CCQ P;  2EIA A;  5HGM A;  1VQ8 P;  5F2K A;  5BS1 A;  3OW2 O;  3CCU P;  1VQK P;  1AUM A;  2XT1 A;  5DCK A;  5F2O A;  1YIT P;  3CCM P;  3G1I A;  3I55 P;  3G4S P;  2DGY A;  2Z45 A;  3HYB A;  3CCJ P;  3G0V A;  5HGL A;  1Q86 Q;  2Z46 A;  2KOD A;  4COP A;  3CPW O;  1VQL P;  2PEN A;  3CC4 P;  2EFJ A;  2Z44 A;  4XFY A;  2CWO A;  3CCE P;  3G26 A;  1Q82 Q;  2JYL A;  2PEK A;  1NJI Q;  1BAJ A;  3RG6 C;  3B5I A;  3CC7 P;  1K9M Q;  3CD6 P;  3I56 P;  1W2B O;  1K30 A;  3CC2 P;  1VQN P;  4QNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...