3G21A

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: low ph
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
AGPWADIMQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 25
structure length 77
sequence length 77
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g21A00
4M0IA 2ONTA 4WYMA 1A8OA 4PH0A 2JYLA 2JYGA 3G1GA 3DPHA 1AUMA 4PH1A 4U0FA 2BUOA 1EOQA 4XFYA 4U0EA 3DS1A 2XV6A 3DTJA 3H47A 5JPAA 3DS0A 1D1DA 3G28A 2EIAA 3DS2A 2LF4A 3G29A 4IPYA 4XROA 5HGOA 5DCKA 2XXMA 3G0VA 4U0DA 2KODA 1EIAA 4U0BA 3DS3A 3DS5A 2XT1A 4QNBA 5HGMA 5HGNA 3G1IA 3H4EA 2JO0A 4U0CA 4COCA 3MGEA 1QRJA 2L6EA 3G26A 4XFZA 5HGLA 3LRYA 1BAJA 1A43A 3VRLC 4XFXA 1E6JP 2M8LA 2M8NA 4XRQA 4COPA 3P05A 3NTEA 4U0AA 5I4TG 3G21A 3DS4A 2M8PA
chains in the Genus database with same CATH superfamily
1VQ8P 1VQ6P 7CEIA 3DPHA 3HZQA 2KGEA 4U0EA 3G6EP 2KW2A 1VQNP 4U0DA 2PENA 3GZMA 3G71P 2N6YA 2VLNA 3HYBA 1YI2P 1YHQP 2CWOA 1A8OA 1VKUA 4XFYA 2ROQA 2JGPA 2KG9A 4H2YC 3CCQP 3CCJP 2OTLP 1ZMBA 2FVFA 3CMAP 4GR6A 5EW5E 2KORA 3G28A 2GZFA 3G29A 5KP8B 2MVVA 2Z46A 3H0DA 3G4SP 3GKLC 3DS5A 2PEOA 3LMOA 3CCUP 3MGEA 1F80D 2K92A 2K94A 3LRYA 1AF8A 2FACA 3NTEA 5I4TG 2CQ8A 2K93A 4IZ6A 2JQ4A 2PEMA 4CA3A 2QNWA 1AUMA 4U0FA 2BUOA 3DTJA 2XV6A 1M90Q 1VQMP 5F2NA 2LF4A 2DNWA 1VQLP 2KOOA 1E0HA 3E2DA 2XT1A 2QEXP 5F2OA 1ACPA 2KG8A 4GR2A 2CG5B 5KP6B 3CC2P 3CD6P 4WYMA 1UJZA 1IMPA 1W2BO 1VQ4P 1T8KA 1FR2A 4BPFA 1X3OA 1YITP 3H4EA 4U0CA 4COCA 1QRJA 4UHPB 2KGCA 3CCSP 3VRLC 2M8LA 2KGDA 2FAEA 2KOSA 1EMVA 2KOQA 2OARA 2VLOA 2JBGA 2PEQA 2N5IA 3G1IA 2JO0A 2LIUA 4H2WC 2L6EA 2PEJA 1HY8A 4QKOA 5F2KA 2Z44A 2GDXA 2E1MA 2M5RA 3G1GA 2ERHA 4PH1A 2PEIA 1RO2A 5BS1A 3H47A 1RO0A 1M6EX 3DS2A 3CC4P 3WBHA 2XXMA 1HQBA 2JU2A 3OW2O 2AF8A 2MVUA 3RG6C 1BAJA 2N6ZA 2M8NA 1VHNA 2CNRA 2MF4A 4BPHA 2KG6A 1NJIQ 1QVFO 1IUQA 2FQ2A 1M1KQ 2P9XA 2XZ0D 2FHSC 1Q86Q 1L0IA 2K0XA 2JYLA 2JYGA 5DCKA 2FADA 2JB0A 3DS1A 1NQ4A 1YJWP 2XZ1C 2OTJP 2NO8A 5HGOA 2N5HA 3CCEP 1S72P 2LKIA 3CE7A 5HGLA 1GPJA 2Z45A 1KLPA 2K2QA 2DGYA 2GZEA 4M0IA 2GZJA 2KR5A 2PNGA 1EOQA 1K8AQ 1D1DA 3CMEP 3Q20A 1MZ8A 2FQ1A 2VSQA 1M74A 1VQKP 2KODA 5HGMA 1VQ7P 2N98A 3EJEA 4MRTC 5CZDB 1K30A 4COPA 3P05A 2AFEA 2N50A 4NEOA 3CCVP 5JPAA 3EJDA 3NY7B 3U43A 2GDWA 2K0YA 2LL8A 1QVGO 4H2XC 3I55P 1EIAA 3CXCO 2FVEA 4PXHB 1OR5A 2AVAA 2L0QA 2M8PA 2X2BA 5EJDA 2VLPA 4PH0A 1KQSO 2CGQA 1ZNVA 4IPYA 4R0MA 2FVAA 3G0VA 3DS3A 4QNBA 2FQ0A 1K9MQ 2GZGA 4HKGA 2PY8A 2AFDA 2EHSA 2L22A 4XFXA 1YJNP 1M6NA 4BPGA 3G21A 2QA4P 1YJ9P 1VQPP 3GJNA 1DNYA 2PEKA 1KC8Q 2EIAA 1AYIA 1YIJP 4DG9A 1VQOP 1GXHA 2L4BA 1K73Q 1A43A 1GXGA 1BXIA 5HV8A 1L0HA 3I56P 2K0DX 2ONTA 2MR8A 2GDYA 3DS0A 1Q81Q 1Q82Q 1JJ2O 2LIWA 1Q7YQ 1IMQA 2KWLA 2EG5A 3RG2A 1RNIA 2VLQA 2MY5A 2KGAA 4F37A 3GZLA 3CCRP 2BHVA 2JAZA 1DV5A 2LMLA 2MD9A 2LPKA 3M1MA 1N8RQ 1VQ5P 2K5XA 5KP7B 1KD1Q 2GYKA 4U0BA 1Z6MA 2GZIA 2EHTA 3B5IA 1UNKA 5BS2A 3B4QA 4PWVB 1E6JP 1VQ9P 2JU1A 2LTEA 2WPTA 2KOPA 5HVCA 2LOLA 3CPWO 4XROA 3CCLP 2MR7A 5HGNA 3G26A 4XFZA 2EFJA 3EJBA 3CCMP 4XRQA 1CEIA 4U0AA 3DS4A 3CC7P 2L9FA
chains in the Genus database with same CATH topology
3CC2P 1VQ8P 3CD6P 1VQ6P 4WYMA 2JYLA 2JYGA 3DPHA 5DCKA 3HZQA 4U0EA 3DS1A 1W2BO 2PEKA 1YJWP 1KC8Q 1VQ4P 3G6EP 2EIAA 2OTJP 1VQNP 5HGOA 3CCEP 4U0DA 2PENA 1YIJP 1YITP 1S72P 1VQOP 3H4EA 4U0CA 4COCA 1QRJA 1K73Q 5HGLA 3G71P 3CCSP 1A43A 3VRLC 2M8LA 2Z45A 3HYBA 2DGYA 3I56P 4M0IA 1YI2P 1YHQP 2CWOA 2ONTA 1A8OA 4XFYA 1EOQA 1K8AQ 1D1DA 3DS0A 2OARA 3CMEP 1Q81Q 3Q20A 1Q82Q 2PEQA 1M74A 1VQKP 2KODA 5HGMA 1JJ2O 1VQ7P 3CCQP 3G1IA 1Q7YQ 2JO0A 3CCJP 1Q86Q 2L6EA 2OTLP 1ZMBA 2PEJA 2EG5A 1K30A 4COPA 3P05A 1RNIA 5F2KA 3CMAP 2Z44A 2E1MA 4GR6A 3G1GA 3CCRP 3CCVP 4PH1A 2PEIA 5JPAA 1RO2A 5BS1A 2BHVA 3H47A 3G28A 1RO0A 1M6EX 3DS2A 1QVGO 3G29A 3M1MA 1N8RQ 3I55P 2Z46A 3WBHA 1VQ5P 2XXMA 3H0DA 1KD1Q 3CC4P 3G4SP 1EIAA 4U0BA 3CXCO 3DS5A 2PEOA 3B5IA 3CCUP 3MGEA 3OW2O 5BS2A 3LRYA 1BAJA 3RG6C 1E6JP 1VQ9P 2M8NA 3NTEA 5I4TG 2M8PA 2PEMA 1AUMA 4U0FA 4PH0A 2BUOA 3DTJA 2XV6A 1KQSO 1M90Q 1VQMP 3CPWO 4IPYA 5F2NA 2LF4A 4XROA 3CCLP 1VQLP 1NJIQ 3G0VA 5HGNA 3DS3A 3E2DA 2XT1A 4QNBA 1K9MQ 1QVFO 1IUQA 2PY8A 2QEXP 1M1KQ 3G26A 4XFZA 5F2OA 2EFJA 4XFXA 3CCMP 2P9XA 4XRQA 4U0AA 1YJNP 4GR2A 1M6NA 3G21A 2QA4P 3DS4A 3CC7P 1YJ9P 1VQPP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M0I A;  2ONT A;  4WYM A;  1A8O A;  4PH0 A;  2JYL A;  2JYG A;  3G1G A;  3DPH A;  1AUM A;  4PH1 A;  4U0F A;  2BUO A;  1EOQ A;  4XFY A;  4U0E A;  3DS1 A;  2XV6 A;  3DTJ A;  3H47 A;  5JPA A;  3DS0 A;  1D1D A;  3G28 A;  2EIA A;  3DS2 A;  2LF4 A;  3G29 A;  4IPY A;  4XRO A;  5HGO A;  5DCK A;  2XXM A;  3G0V A;  4U0D A;  2KOD A;  1EIA A;  4U0B A;  3DS3 A;  3DS5 A;  2XT1 A;  4QNB A;  5HGM A;  5HGN A;  3G1I A;  3H4E A;  2JO0 A;  4U0C A;  4COC A;  3MGE A;  1QRJ A;  2L6E A;  3G26 A;  4XFZ A;  5HGL A;  3LRY A;  1BAJ A;  1A43 A;  3VRL C;  4XFX A;  1E6J P;  2M8L A;  2M8N A;  4XRQ A;  4COP A;  3P05 A;  3NTE A;  4U0A A;  5I4T G;  3G21 A;  3DS4 A;  2M8P A; 
#chains in the Genus database with same CATH topology
 1VQ8 P;  1VQ6 P;  7CEI A;  3DPH A;  3HZQ A;  2KGE A;  4U0E A;  3G6E P;  2KW2 A;  1VQN P;  4U0D A;  2PEN A;  3GZM A;  3G71 P;  2N6Y A;  2VLN A;  3HYB A;  1YI2 P;  1YHQ P;  2CWO A;  1A8O A;  1VKU A;  4XFY A;  2ROQ A;  2JGP A;  2KG9 A;  4H2Y C;  3CCQ P;  3CCJ P;  2OTL P;  1ZMB A;  2FVF A;  3CMA P;  4GR6 A;  5EW5 E;  2KOR A;  3G28 A;  2GZF A;  3G29 A;  5KP8 B;  2MVV A;  2Z46 A;  3H0D A;  3G4S P;  3GKL C;  3DS5 A;  2PEO A;  3LMO A;  3CCU P;  3MGE A;  1F80 D;  2K92 A;  2K94 A;  3LRY A;  1AF8 A;  2FAC A;  3NTE A;  5I4T G;  2CQ8 A;  2K93 A;  4IZ6 A;  2JQ4 A;  2PEM A;  4CA3 A;  2QNW A;  1AUM A;  4U0F A;  2BUO A;  3DTJ A;  2XV6 A;  1M90 Q;  1VQM P;  5F2N A;  2LF4 A;  2DNW A;  1VQL P;  2KOO A;  1E0H A;  3E2D A;  2XT1 A;  2QEX P;  5F2O A;  1ACP A;  2KG8 A;  4GR2 A;  2CG5 B;  5KP6 B;  3CC2 P;  3CD6 P;  4WYM A;  1UJZ A;  1IMP A;  1W2B O;  1VQ4 P;  1T8K A;  1FR2 A;  4BPF A;  1X3O A;  1YIT P;  3H4E A;  4U0C A;  4COC A;  1QRJ A;  4UHP B;  2KGC A;  3CCS P;  3VRL C;  2M8L A;  2KGD A;  2FAE A;  2KOS A;  1EMV A;  2KOQ A;  2OAR A;  2VLO A;  2JBG A;  2PEQ A;  2N5I A;  3G1I A;  2JO0 A;  2LIU A;  4H2W C;  2L6E A;  2PEJ A;  1HY8 A;  4QKO A;  5F2K A;  2Z44 A;  2GDX A;  2E1M A;  2M5R A;  3G1G A;  2ERH A;  4PH1 A;  2PEI A;  1RO2 A;  5BS1 A;  3H47 A;  1RO0 A;  1M6E X;  3DS2 A;  3CC4 P;  3WBH A;  2XXM A;  1HQB A;  2JU2 A;  3OW2 O;  2AF8 A;  2MVU A;  3RG6 C;  1BAJ A;  2N6Z A;  2M8N A;  1VHN A;  2CNR A;  2MF4 A;  4BPH A;  2KG6 A;  1NJI Q;  1QVF O;  1IUQ A;  2FQ2 A;  1M1K Q;  2P9X A;  2XZ0 D;  2FHS C;  1Q86 Q;  1L0I A;  2K0X A;  2JYL A;  2JYG A;  5DCK A;  2FAD A;  2JB0 A;  3DS1 A;  1NQ4 A;  1YJW P;  2XZ1 C;  2OTJ P;  2NO8 A;  5HGO A;  2N5H A;  3CCE P;  1S72 P;  2LKI A;  3CE7 A;  5HGL A;  1GPJ A;  2Z45 A;  1KLP A;  2K2Q A;  2DGY A;  2GZE A;  4M0I A;  2GZJ A;  2KR5 A;  2PNG A;  1EOQ A;  1K8A Q;  1D1D A;  3CME P;  3Q20 A;  1MZ8 A;  2FQ1 A;  2VSQ A;  1M74 A;  1VQK P;  2KOD A;  5HGM A;  1VQ7 P;  2N98 A;  3EJE A;  4MRT C;  5CZD B;  1K30 A;  4COP A;  3P05 A;  2AFE A;  2N50 A;  4NEO A;  3CCV P;  5JPA A;  3EJD A;  3NY7 B;  3U43 A;  2GDW A;  2K0Y A;  2LL8 A;  1QVG O;  4H2X C;  3I55 P;  1EIA A;  3CXC O;  2FVE A;  4PXH B;  1OR5 A;  2AVA A;  2L0Q A;  2M8P A;  2X2B A;  5EJD A;  2VLP A;  4PH0 A;  1KQS O;  2CGQ A;  1ZNV A;  4IPY A;  4R0M A;  2FVA A;  3G0V A;  3DS3 A;  4QNB A;  2FQ0 A;  1K9M Q;  2GZG A;  4HKG A;  2PY8 A;  2AFD A;  2EHS A;  2L22 A;  4XFX A;  1YJN P;  1M6N A;  4BPG A;  3G21 A;  2QA4 P;  1YJ9 P;  1VQP P;  3GJN A;  1DNY A;  2PEK A;  1KC8 Q;  2EIA A;  1AYI A;  1YIJ P;  4DG9 A;  1VQO P;  1GXH A;  2L4B A;  1K73 Q;  1A43 A;  1GXG A;  1BXI A;  5HV8 A;  1L0H A;  3I56 P;  2K0D X;  2ONT A;  2MR8 A;  2GDY A;  3DS0 A;  1Q81 Q;  1Q82 Q;  1JJ2 O;  2LIW A;  1Q7Y Q;  1IMQ A;  2KWL A;  2EG5 A;  3RG2 A;  1RNI A;  2VLQ A;  2MY5 A;  2KGA A;  4F37 A;  3GZL A;  3CCR P;  2BHV A;  2JAZ A;  1DV5 A;  2LML A;  2MD9 A;  2LPK A;  3M1M A;  1N8R Q;  1VQ5 P;  2K5X A;  5KP7 B;  1KD1 Q;  2GYK A;  4U0B A;  1Z6M A;  2GZI A;  2EHT A;  3B5I A;  1UNK A;  5BS2 A;  3B4Q A;  4PWV B;  1E6J P;  1VQ9 P;  2JU1 A;  2LTE A;  2WPT A;  2KOP A;  5HVC A;  2LOL A;  3CPW O;  4XRO A;  3CCL P;  2MR7 A;  5HGN A;  3G26 A;  4XFZ A;  2EFJ A;  3EJB A;  3CCM P;  4XRQ A;  1CEI A;  4U0A A;  3DS4 A;  3CC7 P;  2L9F A; 
#chains in the Genus database with same CATH homology
 3CC2 P;  1VQ8 P;  3CD6 P;  1VQ6 P;  4WYM A;  2JYL A;  2JYG A;  3DPH A;  5DCK A;  3HZQ A;  4U0E A;  3DS1 A;  1W2B O;  2PEK A;  1YJW P;  1KC8 Q;  1VQ4 P;  3G6E P;  2EIA A;  2OTJ P;  1VQN P;  5HGO A;  3CCE P;  4U0D A;  2PEN A;  1YIJ P;  1YIT P;  1S72 P;  1VQO P;  3H4E A;  4U0C A;  4COC A;  1QRJ A;  1K73 Q;  5HGL A;  3G71 P;  3CCS P;  1A43 A;  3VRL C;  2M8L A;  2Z45 A;  3HYB A;  2DGY A;  3I56 P;  4M0I A;  1YI2 P;  1YHQ P;  2CWO A;  2ONT A;  1A8O A;  4XFY A;  1EOQ A;  1K8A Q;  1D1D A;  3DS0 A;  2OAR A;  3CME P;  1Q81 Q;  3Q20 A;  1Q82 Q;  2PEQ A;  1M74 A;  1VQK P;  2KOD A;  5HGM A;  1JJ2 O;  1VQ7 P;  3CCQ P;  3G1I A;  1Q7Y Q;  2JO0 A;  3CCJ P;  1Q86 Q;  2L6E A;  2OTL P;  1ZMB A;  2PEJ A;  2EG5 A;  1K30 A;  4COP A;  3P05 A;  1RNI A;  5F2K A;  3CMA P;  2Z44 A;  2E1M A;  4GR6 A;  3G1G A;  3CCR P;  3CCV P;  4PH1 A;  2PEI A;  5JPA A;  1RO2 A;  5BS1 A;  2BHV A;  3H47 A;  3G28 A;  1RO0 A;  1M6E X;  3DS2 A;  1QVG O;  3G29 A;  3M1M A;  1N8R Q;  3I55 P;  2Z46 A;  3WBH A;  1VQ5 P;  2XXM A;  3H0D A;  1KD1 Q;  3CC4 P;  3G4S P;  1EIA A;  4U0B A;  3CXC O;  3DS5 A;  2PEO A;  3B5I A;  3CCU P;  3MGE A;  3OW2 O;  5BS2 A;  3LRY A;  1BAJ A;  3RG6 C;  1E6J P;  1VQ9 P;  2M8N A;  3NTE A;  5I4T G;  2M8P A;  2PEM A;  1AUM A;  4U0F A;  4PH0 A;  2BUO A;  3DTJ A;  2XV6 A;  1KQS O;  1M90 Q;  1VQM P;  3CPW O;  4IPY A;  5F2N A;  2LF4 A;  4XRO A;  3CCL P;  1VQL P;  1NJI Q;  3G0V A;  5HGN A;  3DS3 A;  3E2D A;  2XT1 A;  4QNB A;  1K9M Q;  1QVF O;  1IUQ A;  2PY8 A;  2QEX P;  1M1K Q;  3G26 A;  4XFZ A;  5F2O A;  2EFJ A;  4XFX A;  3CCM P;  2P9X A;  4XRQ A;  4U0A A;  1YJN P;  4GR2 A;  1M6N A;  3G21 A;  2QA4 P;  3DS4 A;  3CC7 P;  1YJ9 P;  1VQP P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...