3G21A

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: low ph
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
AGPWADIMQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 25
structure length 77
sequence length 77
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g21A00
4XRQA 2EIAA 3G1GA 4U0EA 1EIAA 3G1IA 5HGMA 3G28A 2XV6A 2JYGA 3DS4A 3VRLC 4XROA 4COCA 1QRJA 4U0DA 5DCKA 1BAJA 3H47A 4IPYA 1A8OA 1AUMA 2KODA 3DTJA 4U0AA 2M8PA 4PH0A 5I4TG 5HGNA 3G29A 4COPA 1EOQA 2XT1A 2LF4A 3P05A 4M0IA 2L6EA 1A43A 2JO0A 5HGOA 3G26A 2M8LA 4XFXA 4QNBA 3DS5A 2ONTA 3DS1A 3MGEA 4XFZA 5JPAA 4U0CA 2JYLA 3DPHA 2XXMA 3DS2A 3G21A 3LRYA 2BUOA 1D1DA 5HGLA 2M8NA 4XFYA 1E6JP 4U0FA 4U0BA 4WYMA 3DS3A 4PH1A 3H4EA 3NTEA 3G0VA 3DS0A
chains in the Genus database with same CATH superfamily
2EIAA 3G28A 3G6EP 2GDWA 1N8RQ 4GR2A 1Q7YQ 2AFDA 4UHPB 1YITP 2FQ1A 2ONTA 2JQ4A 1T8KA 1K8AQ 4U0FA 1RO2A 4WYMA 5EJDA 1ACPA 1EOQA 1VQLP 4M0IA 2L6EA 2ERHA 2KG9A 1RNIA 3MGEA 1Q86Q 2JU2A 3DS2A 2LIUA 2OARA 2L22A 3G1GA 2KGDA 1YI2P 1VQ5P 1F80D 5KP6B 5KP8B 4R0MA 2M8PA 1UJZA 2LF4A 2AVAA 2K93A 2Z45A 3G71P 2KG8A 3DS5A 2MR7A 2XZ1C 5F2KA 3WBHA 2BHVA 4IPYA 1IMPA 1BXIA 3NY7B 1FR2A 3OW2O 3G29A 1Z6MA 2KGAA 1YHQP 2KOSA 1RO0A 4BPFA 4H2WC 2OTJP 2CGQA 2VLOA 1QVGO 3CCUP 2PEKA 1M1KQ 1Q81Q 2GZJA 3DS4A 1VKUA 2PEJA 2VLQA 2EHTA 4H2YC 2K92A 2AF8A 2KOPA 1M6EX 3E2DA 3G4SP 2PENA 3G21A 1D1DA 2MF4A 3NTEA 4CA3A 3CPWO 1M90Q 4MRTC 3CMEP 2P9XA 1HY8A 3LMOA 2KOQA 3VRLC 3I56P 1QRJA 1BAJA 2L0QA 2PEQA 1KC8Q 1VQ7P 5BS1A 2JO0A 2FQ2A 2MY5A 2PEOA 3CCEP 2KR5A 5F2OA 1DNYA 2K94A 2M8NA 1UNKA 1VQNP 1YJWP 2DGYA 5HGMA 2M5RA 2E1MA 4XROA 2FQ0A 2GDYA 3M1MA 4COPA 1GXHA 2XT1A 1VQOP 1OR5A 2PNGA 2OTLP 2LIWA 2GYKA 2CWOA 2FAEA 2FADA 2Z46A 4NEOA 2KOOA 1DV5A 1VQ9P 2Z44A 4PH1A 2ROQA 1GPJA 2FVAA 1AUMA 5HGNA 3CMAP 3P05A 1JJ2O 1KD1Q 3DS1A 2KGEA 1KLPA 1M6NA 3CC7P 4XFYA 2QEXP 1HQBA 2EG5A 1VHNA 1EIAA 2MR8A 3GJNA 5CZDB 1KQSO 2KGCA 4IZ6A 4DG9A 4XFZA 2N5HA 2FACA 4F37A 1K30A 2K2QA 2LOLA 2FHSC 3CCSP 5DCKA 1EMVA 1W2BO 1S72P 2EFJA 2PY8A 1VQPP 2N5IA 1NJIQ 2N98A 2LMLA 2CNRA 2FVEA 3H0DA 2XXMA 2QNWA 1E6JP 2JAZA 3B5IA 4QKOA 3EJBA 4BPHA 3GZMA 4PWVB 2XV6A 2EHSA 2FVFA 2DNWA 2KG6A 2LPKA 2GDXA 1M74A 2NO8A 3GKLC 3CCQP 2K5XA 2X2BA 4HKGA 2WPTA 2LKIA 2BUOA 1YJNP 1VQMP 3GZLA 3DS3A 1GXGA 4XRQA 2CQ8A 1ZNVA 2L4BA 1MZ8A 3CD6P 3CCLP 2PEMA 1A8OA 4U0AA 4PH0A 1YIJP 2XZ0D 2AFEA 2K0XA 3G26A 4QNBA 5JPAA 3Q20A 2MD9A 1VQ4P 2JBGA 4U0BA 4U0DA 3G0VA 5F2NA 1AF8A 3G1IA 1VQ8P 2MVVA 2N6YA 1QVFO 2PEIA 4PXHB 2GZIA 1VQKP 3EJDA 3CCRP 3U43A 5HVCA 3DPHA 3LRYA 3CC4P 5HGLA 1E0HA 3CE7A 3CCVP 1X3OA 4U0EA 2KORA 2VSQA 5BS2A 2GZGA 2JU1A 1Q82Q 2KODA 4BPGA 3B4QA 3DTJA 1VQ6P 5HGOA 7CEIA 2JGPA 2KWLA 2JB0A 1K73Q 3HZQA 1AYIA 1L0IA 3H4EA 2QA4P 3DS0A 2N50A 1IUQA 1CEIA 2JYGA 1L0HA 5KP7B 2K0YA 3HYBA 1ZMBA 1NQ4A 5EW5E 2GZFA 2M8LA 3CC2P 1K9MQ 3CCJP 4XFXA 4GR6A 4U0CA 5HV8A 3CXCO 3I55P 2MVUA 3RG2A 2GZEA 3RG6C 2N6ZA 3EJEA 3CCMP 2VLPA 4COCA 2L9FA 3H47A 2LL8A 5I4TG 2CG5B 2K0DX 1YJ9P 1A43A 2VLNA 2KW2A 1IMQA 4H2XC 2JYLA 2LTEA
chains in the Genus database with same CATH topology
5F2NA 2EIAA 2PEKA 1EIAA 3G1IA 3G28A 1M1KQ 1Q81Q 3DS4A 1VQ8P 3G6EP 1QVFO 2PEJA 1KQSO 1N8RQ 2PEIA 4GR2A 1Q7YQ 1VQKP 1YITP 3CCRP 1M6EX 2ONTA 3E2DA 4XFZA 3G4SP 2PENA 3DPHA 3G21A 3LRYA 1D1DA 3CC4P 1K8AQ 5HGLA 4U0FA 1RO2A 4WYMA 3CCVP 3NTEA 1M90Q 3CPWO 3CMEP 1K30A 2P9XA 4U0EA 5BS2A 3VRLC 1Q82Q 3CCSP 3I56P 1QRJA 5DCKA 1BAJA 2PEQA 1KC8Q 1VQ7P 2KODA 3DTJA 5BS1A 1W2BO 1VQ6P 1EOQA 1VQLP 1S72P 2EFJA 4M0IA 2L6EA 2PY8A 2JO0A 5HGOA 1VQPP 1NJIQ 1RNIA 2PEOA 3CCEP 1K73Q 5F2OA 3MGEA 1Q86Q 3HZQA 3H0DA 2XXMA 3DS2A 2OARA 2M8NA 1E6JP 3B5IA 1VQNP 3H4EA 2QA4P 1YJWP 3G1GA 3DS0A 1YI2P 2DGYA 1VQ5P 5HGMA 1IUQA 2XV6A 2JYGA 2E1MA 4XROA 2M8PA 3M1MA 4COPA 2XT1A 3HYBA 1VQOP 2LF4A 1ZMBA 2Z45A 3G71P 2OTLP 1M74A 2M8LA 3CCJP 1K9MQ 3CC2P 4XFXA 2CWOA 3CCQP 3DS5A 4GR6A 4U0CA 3CXCO 2Z46A 2BUOA 1YJNP 3I55P 1VQMP 1VQ9P 2Z44A 3DS3A 4PH1A 5F2KA 3RG6C 4XRQA 3WBHA 3CCMP 4COCA 3CD6P 2BHVA 3H47A 4IPYA 2PEMA 3CCLP 1A8OA 1AUMA 4U0AA 4PH0A 1YIJP 5I4TG 5HGNA 3G29A 3OW2O 3CMAP 3P05A 1YHQP 1YJ9P 1A43A 1JJ2O 3G26A 1KD1Q 1RO0A 4QNBA 3DS1A 5JPAA 3Q20A 1M6NA 2JYLA 2OTJP 3CC7P 1QVGO 1VQ4P 3CCUP 4XFYA 2QEXP 4U0BA 2EG5A 4U0DA 3G0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRQ A;  2EIA A;  3G1G A;  4U0E A;  1EIA A;  3G1I A;  5HGM A;  3G28 A;  2XV6 A;  2JYG A;  3DS4 A;  3VRL C;  4XRO A;  4COC A;  1QRJ A;  4U0D A;  5DCK A;  1BAJ A;  3H47 A;  4IPY A;  1A8O A;  1AUM A;  2KOD A;  3DTJ A;  4U0A A;  2M8P A;  4PH0 A;  5I4T G;  5HGN A;  3G29 A;  4COP A;  1EOQ A;  2XT1 A;  2LF4 A;  3P05 A;  4M0I A;  2L6E A;  1A43 A;  2JO0 A;  5HGO A;  3G26 A;  2M8L A;  4XFX A;  4QNB A;  3DS5 A;  2ONT A;  3DS1 A;  3MGE A;  4XFZ A;  5JPA A;  4U0C A;  2JYL A;  3DPH A;  2XXM A;  3DS2 A;  3G21 A;  3LRY A;  2BUO A;  1D1D A;  5HGL A;  2M8N A;  4XFY A;  1E6J P;  4U0F A;  4U0B A;  4WYM A;  3DS3 A;  4PH1 A;  3H4E A;  3NTE A;  3G0V A;  3DS0 A; 
#chains in the Genus database with same CATH topology
 2EIA A;  3G28 A;  3G6E P;  2GDW A;  1N8R Q;  4GR2 A;  1Q7Y Q;  2AFD A;  4UHP B;  1YIT P;  2FQ1 A;  2ONT A;  2JQ4 A;  1T8K A;  1K8A Q;  4U0F A;  1RO2 A;  4WYM A;  5EJD A;  1ACP A;  1EOQ A;  1VQL P;  4M0I A;  2L6E A;  2ERH A;  2KG9 A;  1RNI A;  3MGE A;  1Q86 Q;  2JU2 A;  3DS2 A;  2LIU A;  2OAR A;  2L22 A;  3G1G A;  2KGD A;  1YI2 P;  1VQ5 P;  1F80 D;  5KP6 B;  5KP8 B;  4R0M A;  2M8P A;  1UJZ A;  2LF4 A;  2AVA A;  2K93 A;  2Z45 A;  3G71 P;  2KG8 A;  3DS5 A;  2MR7 A;  2XZ1 C;  5F2K A;  3WBH A;  2BHV A;  4IPY A;  1IMP A;  1BXI A;  3NY7 B;  1FR2 A;  3OW2 O;  3G29 A;  1Z6M A;  2KGA A;  1YHQ P;  2KOS A;  1RO0 A;  4BPF A;  4H2W C;  2OTJ P;  2CGQ A;  2VLO A;  1QVG O;  3CCU P;  2PEK A;  1M1K Q;  1Q81 Q;  2GZJ A;  3DS4 A;  1VKU A;  2PEJ A;  2VLQ A;  2EHT A;  4H2Y C;  2K92 A;  2AF8 A;  2KOP A;  1M6E X;  3E2D A;  3G4S P;  2PEN A;  3G21 A;  1D1D A;  2MF4 A;  3NTE A;  4CA3 A;  3CPW O;  1M90 Q;  4MRT C;  3CME P;  2P9X A;  1HY8 A;  3LMO A;  2KOQ A;  3VRL C;  3I56 P;  1QRJ A;  1BAJ A;  2L0Q A;  2PEQ A;  1KC8 Q;  1VQ7 P;  5BS1 A;  2JO0 A;  2FQ2 A;  2MY5 A;  2PEO A;  3CCE P;  2KR5 A;  5F2O A;  1DNY A;  2K94 A;  2M8N A;  1UNK A;  1VQN P;  1YJW P;  2DGY A;  5HGM A;  2M5R A;  2E1M A;  4XRO A;  2FQ0 A;  2GDY A;  3M1M A;  4COP A;  1GXH A;  2XT1 A;  1VQO P;  1OR5 A;  2PNG A;  2OTL P;  2LIW A;  2GYK A;  2CWO A;  2FAE A;  2FAD A;  2Z46 A;  4NEO A;  2KOO A;  1DV5 A;  1VQ9 P;  2Z44 A;  4PH1 A;  2ROQ A;  1GPJ A;  2FVA A;  1AUM A;  5HGN A;  3CMA P;  3P05 A;  1JJ2 O;  1KD1 Q;  3DS1 A;  2KGE A;  1KLP A;  1M6N A;  3CC7 P;  4XFY A;  2QEX P;  1HQB A;  2EG5 A;  1VHN A;  1EIA A;  2MR8 A;  3GJN A;  5CZD B;  1KQS O;  2KGC A;  4IZ6 A;  4DG9 A;  4XFZ A;  2N5H A;  2FAC A;  4F37 A;  1K30 A;  2K2Q A;  2LOL A;  2FHS C;  3CCS P;  5DCK A;  1EMV A;  1W2B O;  1S72 P;  2EFJ A;  2PY8 A;  1VQP P;  2N5I A;  1NJI Q;  2N98 A;  2LML A;  2CNR A;  2FVE A;  3H0D A;  2XXM A;  2QNW A;  1E6J P;  2JAZ A;  3B5I A;  4QKO A;  3EJB A;  4BPH A;  3GZM A;  4PWV B;  2XV6 A;  2EHS A;  2FVF A;  2DNW A;  2KG6 A;  2LPK A;  2GDX A;  1M74 A;  2NO8 A;  3GKL C;  3CCQ P;  2K5X A;  2X2B A;  4HKG A;  2WPT A;  2LKI A;  2BUO A;  1YJN P;  1VQM P;  3GZL A;  3DS3 A;  1GXG A;  4XRQ A;  2CQ8 A;  1ZNV A;  2L4B A;  1MZ8 A;  3CD6 P;  3CCL P;  2PEM A;  1A8O A;  4U0A A;  4PH0 A;  1YIJ P;  2XZ0 D;  2AFE A;  2K0X A;  3G26 A;  4QNB A;  5JPA A;  3Q20 A;  2MD9 A;  1VQ4 P;  2JBG A;  4U0B A;  4U0D A;  3G0V A;  5F2N A;  1AF8 A;  3G1I A;  1VQ8 P;  2MVV A;  2N6Y A;  1QVF O;  2PEI A;  4PXH B;  2GZI A;  1VQK P;  3EJD A;  3CCR P;  3U43 A;  5HVC A;  3DPH A;  3LRY A;  3CC4 P;  5HGL A;  1E0H A;  3CE7 A;  3CCV P;  1X3O A;  4U0E A;  2KOR A;  2VSQ A;  5BS2 A;  2GZG A;  2JU1 A;  1Q82 Q;  2KOD A;  4BPG A;  3B4Q A;  3DTJ A;  1VQ6 P;  5HGO A;  7CEI A;  2JGP A;  2KWL A;  2JB0 A;  1K73 Q;  3HZQ A;  1AYI A;  1L0I A;  3H4E A;  2QA4 P;  3DS0 A;  2N50 A;  1IUQ A;  1CEI A;  2JYG A;  1L0H A;  5KP7 B;  2K0Y A;  3HYB A;  1ZMB A;  1NQ4 A;  5EW5 E;  2GZF A;  2M8L A;  3CC2 P;  1K9M Q;  3CCJ P;  4XFX A;  4GR6 A;  4U0C A;  5HV8 A;  3CXC O;  3I55 P;  2MVU A;  3RG2 A;  2GZE A;  3RG6 C;  2N6Z A;  3EJE A;  3CCM P;  2VLP A;  4COC A;  2L9F A;  3H47 A;  2LL8 A;  5I4T G;  2CG5 B;  2K0D X;  1YJ9 P;  1A43 A;  2VLN A;  2KW2 A;  1IMQ A;  4H2X C;  2JYL A;  2LTE A; 
#chains in the Genus database with same CATH homology
 5F2N A;  2EIA A;  2PEK A;  1EIA A;  3G1I A;  3G28 A;  1M1K Q;  1Q81 Q;  3DS4 A;  1VQ8 P;  3G6E P;  1QVF O;  2PEJ A;  1KQS O;  1N8R Q;  2PEI A;  4GR2 A;  1Q7Y Q;  1VQK P;  1YIT P;  3CCR P;  1M6E X;  2ONT A;  3E2D A;  4XFZ A;  3G4S P;  2PEN A;  3DPH A;  3G21 A;  3LRY A;  1D1D A;  3CC4 P;  1K8A Q;  5HGL A;  4U0F A;  1RO2 A;  4WYM A;  3CCV P;  3NTE A;  1M90 Q;  3CPW O;  3CME P;  1K30 A;  2P9X A;  4U0E A;  5BS2 A;  3VRL C;  1Q82 Q;  3CCS P;  3I56 P;  1QRJ A;  5DCK A;  1BAJ A;  2PEQ A;  1KC8 Q;  1VQ7 P;  2KOD A;  3DTJ A;  5BS1 A;  1W2B O;  1VQ6 P;  1EOQ A;  1VQL P;  1S72 P;  2EFJ A;  4M0I A;  2L6E A;  2PY8 A;  2JO0 A;  5HGO A;  1VQP P;  1NJI Q;  1RNI A;  2PEO A;  3CCE P;  1K73 Q;  5F2O A;  3MGE A;  1Q86 Q;  3HZQ A;  3H0D A;  2XXM A;  3DS2 A;  2OAR A;  2M8N A;  1E6J P;  3B5I A;  1VQN P;  3H4E A;  2QA4 P;  1YJW P;  3G1G A;  3DS0 A;  1YI2 P;  2DGY A;  1VQ5 P;  5HGM A;  1IUQ A;  2XV6 A;  2JYG A;  2E1M A;  4XRO A;  2M8P A;  3M1M A;  4COP A;  2XT1 A;  3HYB A;  1VQO P;  2LF4 A;  1ZMB A;  2Z45 A;  3G71 P;  2OTL P;  1M74 A;  2M8L A;  3CCJ P;  1K9M Q;  3CC2 P;  4XFX A;  2CWO A;  3CCQ P;  3DS5 A;  4GR6 A;  4U0C A;  3CXC O;  2Z46 A;  2BUO A;  1YJN P;  3I55 P;  1VQM P;  1VQ9 P;  2Z44 A;  3DS3 A;  4PH1 A;  5F2K A;  3RG6 C;  4XRQ A;  3WBH A;  3CCM P;  4COC A;  3CD6 P;  2BHV A;  3H47 A;  4IPY A;  2PEM A;  3CCL P;  1A8O A;  1AUM A;  4U0A A;  4PH0 A;  1YIJ P;  5I4T G;  5HGN A;  3G29 A;  3OW2 O;  3CMA P;  3P05 A;  1YHQ P;  1YJ9 P;  1A43 A;  1JJ2 O;  3G26 A;  1KD1 Q;  1RO0 A;  4QNB A;  3DS1 A;  5JPA A;  3Q20 A;  1M6N A;  2JYL A;  2OTJ P;  3CC7 P;  1QVG O;  1VQ4 P;  3CCU P;  4XFY A;  2QEX P;  4U0B A;  2EG5 A;  4U0D A;  3G0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...