3G21A

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: low ph
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
b'AGPWADIMQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gag polyprotein
publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
total genus 25
structure length 77
sequence length 77
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g21A00
4PH1A 4XROA 5I4TG 3DS0A 3G1GA 2JO0A 2XXMA 2EIAA 4COCA 3DS2A 2M8NA 2JYLA 2XV6A 4PH0A 2M8PA 4U0DA 1A8OA 1BAJA 3DS3A 3DTJA 3NTEA 3DS1A 3G26A 5HGOA 4U0CA 1EOQA 2KODA 3P05A 5HGMA 4XRQA 4U0BA 4U0FA 1AUMA 4IPYA 1E6JP 3H47A 2M8LA 4WYMA 5HGNA 3DPHA 3G21A 5JPAA 4U0AA 2LF4A 4XFXA 3G0VA 5DCKA 3G28A 4U0EA 2XT1A 3VRLC 3G1IA 2JYGA 1D1DA 1QRJA 4QNBA 2BUOA 3G29A 4M0IA 5HGLA 1EIAA 3DS4A 3LRYA 3MGEA 1A43A 2L6EA 3H4EA 3DS5A 4XFYA 4COPA 4XFZA 2ONTA
chains in the Genus database with same CATH superfamily
3EJBA 2XV6A 4BPFA 1VQ9P 1EOQA 1DNYA 5JPAA 1KC8Q 2MVVA 2FHSC 2MD9A 3CD6P 2CQ8A 2KG9A 3H0DA 1A43A 4XFYA 1VQOP 2M8NA 1A8OA 3DS3A 1E0HA 2KG8A 3CCQP 2NO8A 2FACA 1M1KQ 2LTEA 3G1IA 2L4BA 3I56P 2GZGA 3NY7B 1YIJP 2JU1A 1RO0A 1VQMP 3LMOA 2LIWA 2Z45A 2EIAA 1YI2P 1VQKP 3G26A 3CCSP 3CCLP 3CE7A 2JGPA 2VLPA 2OARA 1K73Q 1Q82Q 3U43A 2JU2A 3WBHA 1QRJA 1VHNA 2GDYA 4M0IA 2N5HA 1GXGA 3CXCO 4XROA 1K30A 1KLPA 1VQ6P 2PNGA 3RG2A 2VLQA 2EG5A 2JB0A 1L0IA 2Z46A 5HV8A 1S72P 1NQ4A 2BHVA 2M5RA 5F2NA 3G28A 3G4SP 2EHTA 2EFJA 2KWLA 4QNBA 2BUOA 3G29A 1KQSO 5KP8B 3B4QA 2LOLA 3EJEA 2WPTA 2JO0A 5EJDA 4U0DA 2X2BA 1W2BO 4BPHA 2KOOA 3Q20A 1UJZA 1KD1Q 2MY5A 1GPJA 3VRLC 4IZ6A 1DV5A 2PEQA 2FVEA 3CMEP 2OTJP 3DTJA 1M90Q 2L9FA 2MF4A 2OTLP 2K2QA 2QNWA 1ZNVA 2M8LA 1X3OA 3CCJP 1BXIA 2KW2A 3DS4A 4BPGA 3DS5A 2VSQA 1M74A 2VLNA 2FAEA 2PEMA 2KODA 4U0FA 1ACPA 3HZQA 1YITP 3G21A 1HQBA 2LF4A 2KOSA 4U0EA 1QVGO 3LRYA 1YJ9P 2L6EA 2KORA 2VLOA 3G1GA 5BS2A 3DS2A 2MR7A 3CCRP 2QEXP 1YHQP 2PEIA 3P05A 1ZMBA 4GR6A 1VQPP 4IPYA 2KGDA 3G6EP 2GYKA 2GZEA 4U0AA 5KP7B 3CCUP 3CPWO 4F37A 2KOQA 2PEKA 4COPA 4XFZA 2FQ1A 3HYBA 2GZJA 1OR5A 4QKOA 1M6EX 4MRTC 5HVCA 1VQ8P 1JJ2O 4PWVB 3GZLA 2DGYA 2N98A 4NEOA 1K8AQ 1RO2A 2JYGA 1YJNP 2K92A 1EIAA 1N8RQ 3CC7P 2JQ4A 2N6ZA 1VQNP 2LMLA 2XXMA 4PH0A 2CNRA 3NTEA 2PEJA 1IUQA 2LPKA 3DS1A 2AFDA 4H2XC 2GDWA 4H2YC 1IMPA 2AF8A 1Q81Q 3G71P 2L22A 1D1DA 2N50A 2FQ0A 1RNIA 3I55P 2FADA 2QA4P 2K0DX 4COCA 4HKGA 1BAJA 5HGOA 3CCEP 4DG9A 1VQ7P 5HGMA 1MZ8A 1HY8A 3M1MA 3CCVP 2N6YA 4R0MA 2ERHA 2ONTA 4GR2A 5I4TG 2AFEA 3DS0A 2P9XA 3E2DA 1EMVA 2XZ1C 3CC2P 5HGNA 1AF8A 2Z44A 1Z6MA 2LIUA 1NJIQ 3H4EA 2K5XA 1T8KA 3CCMP 2KGCA 2JYLA 3OW2O 2K0YA 2MR8A 2CG5B 1QVFO 3H47A 2ROQA 2MVUA 2GZFA 3G0VA 2JAZA 2KOPA 3CMAP 1YJWP 4PH1A 3RG6C 2M8PA 2L0QA 2FVFA 3GKLC 2FQ2A 2K0XA 3CC4P 2CWOA 1AUMA 2AVAA 3DPHA 3B5IA 4UHPB 1IMQA 4CA3A 2KGAA 1Q7YQ 5EW5E 1GXHA 2KR5A 1VQ5P 5F2KA 1L0HA 2PY8A 2KG6A 2KGEA 3GZMA 2PENA 1K9MQ 1VQ4P 1AYIA 1F80D 4U0CA 1UNKA 1FR2A 2CGQA 2K93A 3GJNA 2E1MA 4XFXA 5DCKA 2XT1A 3EJDA 1M6NA 2K94A 2GZIA 4H2WC 5CZDB 2DNWA 2XZ0D 2N5IA 5KP6B 1CEIA 4XRQA 4U0BA 1E6JP 2JBGA 4WYMA 1VQLP 4PXHB 5BS1A 5F2OA 2GDXA 7CEIA 5HGLA 2EHSA 1VKUA 2FVAA 1Q86Q 2PEOA 3MGEA 2LL8A 2LKIA
chains in the Genus database with same CATH topology
3HYBA 2JO0A 3CCMP 2JYLA 2XV6A 4U0DA 3OW2O 1W2BO 1M6EX 1VQ9P 1EOQA 1VQ8P 1JJ2O 3Q20A 1QVFO 2DGYA 3H47A 1KD1Q 1K8AQ 1RO2A 5JPAA 1KC8Q 3G0VA 3VRLC 2JYGA 3CD6P 1YJNP 3CMAP 1EIAA 1N8RQ 3H0DA 1A43A 2PEQA 3CC7P 4XFYA 1YJWP 4PH1A 1VQNP 3RG6C 2XXMA 1VQOP 3CMEP 2M8NA 4PH0A 2OTJP 2M8PA 1A8OA 3DTJA 3DS3A 2PEJA 3NTEA 1IUQA 3DS1A 1M90Q 3CCQP 2OTLP 3CC4P 2CWOA 1AUMA 2M8LA 1M1KQ 3DPHA 3B5IA 1Q81Q 1Q7YQ 3CCJP 3G1IA 3I56P 3G71P 1VQ5P 1D1DA 1YIJP 3DS4A 5F2KA 1RNIA 3I55P 2PY8A 3DS5A 1RO0A 1VQMP 2QA4P 2PENA 2Z45A 1K9MQ 2EIAA 4COCA 1YI2P 1VQ4P 1VQKP 1M74A 1BAJA 2PEMA 3G26A 3CCSP 5HGOA 4U0CA 3CCEP 3CCLP 1VQ7P 2KODA 5HGMA 4U0FA 2OARA 2E1MA 3G21A 3HZQA 1YITP 2LF4A 3M1MA 4XFXA 1K73Q 5DCKA 1Q82Q 3CCVP 4U0EA 2XT1A 3WBHA 1M6NA 1QRJA 1QVGO 4M0IA 3LRYA 1YJ9P 2L6EA 3CXCO 2ONTA 4XROA 4GR2A 5I4TG 3DS0A 1K30A 3G1GA 5BS2A 1VQ6P 3DS2A 2P9XA 3E2DA 3CCRP 2EG5A 2QEXP 1YHQP 2PEIA 3P05A 1ZMBA 4U0BA 4GR6A 4XRQA 2Z46A 1VQPP 4IPYA 1S72P 1E6JP 2BHVA 3CC2P 3G6EP 4WYMA 5HGNA 2Z44A 1VQLP 4U0AA 5F2NA 3CCUP 3G28A 5BS1A 3CPWO 3G4SP 1NJIQ 2EFJA 5F2OA 4QNBA 2BUOA 3G29A 5HGLA 1KQSO 1Q86Q 2PEOA 3MGEA 3H4EA 2PEKA 4COPA 4XFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PH1 A;  4XRO A;  5I4T G;  3DS0 A;  3G1G A;  2JO0 A;  2XXM A;  2EIA A;  4COC A;  3DS2 A;  2M8N A;  2JYL A;  2XV6 A;  4PH0 A;  2M8P A;  4U0D A;  1A8O A;  1BAJ A;  3DS3 A;  3DTJ A;  3NTE A;  3DS1 A;  3G26 A;  5HGO A;  4U0C A;  1EOQ A;  2KOD A;  3P05 A;  5HGM A;  4XRQ A;  4U0B A;  4U0F A;  1AUM A;  4IPY A;  1E6J P;  3H47 A;  2M8L A;  4WYM A;  5HGN A;  3DPH A;  3G21 A;  5JPA A;  4U0A A;  2LF4 A;  4XFX A;  3G0V A;  5DCK A;  3G28 A;  4U0E A;  2XT1 A;  3VRL C;  3G1I A;  2JYG A;  1D1D A;  1QRJ A;  4QNB A;  2BUO A;  3G29 A;  4M0I A;  5HGL A;  1EIA A;  3DS4 A;  3LRY A;  3MGE A;  1A43 A;  2L6E A;  3H4E A;  3DS5 A;  4XFY A;  4COP A;  4XFZ A;  2ONT A; 
#chains in the Genus database with same CATH topology
 3EJB A;  2XV6 A;  4BPF A;  1VQ9 P;  1EOQ A;  1DNY A;  5JPA A;  1KC8 Q;  2MVV A;  2FHS C;  2MD9 A;  3CD6 P;  2CQ8 A;  2KG9 A;  3H0D A;  1A43 A;  4XFY A;  1VQO P;  2M8N A;  1A8O A;  3DS3 A;  1E0H A;  2KG8 A;  3CCQ P;  2NO8 A;  2FAC A;  1M1K Q;  2LTE A;  3G1I A;  2L4B A;  3I56 P;  2GZG A;  3NY7 B;  1YIJ P;  2JU1 A;  1RO0 A;  1VQM P;  3LMO A;  2LIW A;  2Z45 A;  2EIA A;  1YI2 P;  1VQK P;  3G26 A;  3CCS P;  3CCL P;  3CE7 A;  2JGP A;  2VLP A;  2OAR A;  1K73 Q;  1Q82 Q;  3U43 A;  2JU2 A;  3WBH A;  1QRJ A;  1VHN A;  2GDY A;  4M0I A;  2N5H A;  1GXG A;  3CXC O;  4XRO A;  1K30 A;  1KLP A;  1VQ6 P;  2PNG A;  3RG2 A;  2VLQ A;  2EG5 A;  2JB0 A;  1L0I A;  2Z46 A;  5HV8 A;  1S72 P;  1NQ4 A;  2BHV A;  2M5R A;  5F2N A;  3G28 A;  3G4S P;  2EHT A;  2EFJ A;  2KWL A;  4QNB A;  2BUO A;  3G29 A;  1KQS O;  5KP8 B;  3B4Q A;  2LOL A;  3EJE A;  2WPT A;  2JO0 A;  5EJD A;  4U0D A;  2X2B A;  1W2B O;  4BPH A;  2KOO A;  3Q20 A;  1UJZ A;  1KD1 Q;  2MY5 A;  1GPJ A;  3VRL C;  4IZ6 A;  1DV5 A;  2PEQ A;  2FVE A;  3CME P;  2OTJ P;  3DTJ A;  1M90 Q;  2L9F A;  2MF4 A;  2OTL P;  2K2Q A;  2QNW A;  1ZNV A;  2M8L A;  1X3O A;  3CCJ P;  1BXI A;  2KW2 A;  3DS4 A;  4BPG A;  3DS5 A;  2VSQ A;  1M74 A;  2VLN A;  2FAE A;  2PEM A;  2KOD A;  4U0F A;  1ACP A;  3HZQ A;  1YIT P;  3G21 A;  1HQB A;  2LF4 A;  2KOS A;  4U0E A;  1QVG O;  3LRY A;  1YJ9 P;  2L6E A;  2KOR A;  2VLO A;  3G1G A;  5BS2 A;  3DS2 A;  2MR7 A;  3CCR P;  2QEX P;  1YHQ P;  2PEI A;  3P05 A;  1ZMB A;  4GR6 A;  1VQP P;  4IPY A;  2KGD A;  3G6E P;  2GYK A;  2GZE A;  4U0A A;  5KP7 B;  3CCU P;  3CPW O;  4F37 A;  2KOQ A;  2PEK A;  4COP A;  4XFZ A;  2FQ1 A;  3HYB A;  2GZJ A;  1OR5 A;  4QKO A;  1M6E X;  4MRT C;  5HVC A;  1VQ8 P;  1JJ2 O;  4PWV B;  3GZL A;  2DGY A;  2N98 A;  4NEO A;  1K8A Q;  1RO2 A;  2JYG A;  1YJN P;  2K92 A;  1EIA A;  1N8R Q;  3CC7 P;  2JQ4 A;  2N6Z A;  1VQN P;  2LML A;  2XXM A;  4PH0 A;  2CNR A;  3NTE A;  2PEJ A;  1IUQ A;  2LPK A;  3DS1 A;  2AFD A;  4H2X C;  2GDW A;  4H2Y C;  1IMP A;  2AF8 A;  1Q81 Q;  3G71 P;  2L22 A;  1D1D A;  2N50 A;  2FQ0 A;  1RNI A;  3I55 P;  2FAD A;  2QA4 P;  2K0D X;  4COC A;  4HKG A;  1BAJ A;  5HGO A;  3CCE P;  4DG9 A;  1VQ7 P;  5HGM A;  1MZ8 A;  1HY8 A;  3M1M A;  3CCV P;  2N6Y A;  4R0M A;  2ERH A;  2ONT A;  4GR2 A;  5I4T G;  2AFE A;  3DS0 A;  2P9X A;  3E2D A;  1EMV A;  2XZ1 C;  3CC2 P;  5HGN A;  1AF8 A;  2Z44 A;  1Z6M A;  2LIU A;  1NJI Q;  3H4E A;  2K5X A;  1T8K A;  3CCM P;  2KGC A;  2JYL A;  3OW2 O;  2K0Y A;  2MR8 A;  2CG5 B;  1QVF O;  3H47 A;  2ROQ A;  2MVU A;  2GZF A;  3G0V A;  2JAZ A;  2KOP A;  3CMA P;  1YJW P;  4PH1 A;  3RG6 C;  2M8P A;  2L0Q A;  2FVF A;  3GKL C;  2FQ2 A;  2K0X A;  3CC4 P;  2CWO A;  1AUM A;  2AVA A;  3DPH A;  3B5I A;  4UHP B;  1IMQ A;  4CA3 A;  2KGA A;  1Q7Y Q;  5EW5 E;  1GXH A;  2KR5 A;  1VQ5 P;  5F2K A;  1L0H A;  2PY8 A;  2KG6 A;  2KGE A;  3GZM A;  2PEN A;  1K9M Q;  1VQ4 P;  1AYI A;  1F80 D;  4U0C A;  1UNK A;  1FR2 A;  2CGQ A;  2K93 A;  3GJN A;  2E1M A;  4XFX A;  5DCK A;  2XT1 A;  3EJD A;  1M6N A;  2K94 A;  2GZI A;  4H2W C;  5CZD B;  2DNW A;  2XZ0 D;  2N5I A;  5KP6 B;  1CEI A;  4XRQ A;  4U0B A;  1E6J P;  2JBG A;  4WYM A;  1VQL P;  4PXH B;  5BS1 A;  5F2O A;  2GDX A;  7CEI A;  5HGL A;  2EHS A;  1VKU A;  2FVA A;  1Q86 Q;  2PEO A;  3MGE A;  2LL8 A;  2LKI A; 
#chains in the Genus database with same CATH homology
 3HYB A;  2JO0 A;  3CCM P;  2JYL A;  2XV6 A;  4U0D A;  3OW2 O;  1W2B O;  1M6E X;  1VQ9 P;  1EOQ A;  1VQ8 P;  1JJ2 O;  3Q20 A;  1QVF O;  2DGY A;  3H47 A;  1KD1 Q;  1K8A Q;  1RO2 A;  5JPA A;  1KC8 Q;  3G0V A;  3VRL C;  2JYG A;  3CD6 P;  1YJN P;  3CMA P;  1EIA A;  1N8R Q;  3H0D A;  1A43 A;  2PEQ A;  3CC7 P;  4XFY A;  1YJW P;  4PH1 A;  1VQN P;  3RG6 C;  2XXM A;  1VQO P;  3CME P;  2M8N A;  4PH0 A;  2OTJ P;  2M8P A;  1A8O A;  3DTJ A;  3DS3 A;  2PEJ A;  3NTE A;  1IUQ A;  3DS1 A;  1M90 Q;  3CCQ P;  2OTL P;  3CC4 P;  2CWO A;  1AUM A;  2M8L A;  1M1K Q;  3DPH A;  3B5I A;  1Q81 Q;  1Q7Y Q;  3CCJ P;  3G1I A;  3I56 P;  3G71 P;  1VQ5 P;  1D1D A;  1YIJ P;  3DS4 A;  5F2K A;  1RNI A;  3I55 P;  2PY8 A;  3DS5 A;  1RO0 A;  1VQM P;  2QA4 P;  2PEN A;  2Z45 A;  1K9M Q;  2EIA A;  4COC A;  1YI2 P;  1VQ4 P;  1VQK P;  1M74 A;  1BAJ A;  2PEM A;  3G26 A;  3CCS P;  5HGO A;  4U0C A;  3CCE P;  3CCL P;  1VQ7 P;  2KOD A;  5HGM A;  4U0F A;  2OAR A;  2E1M A;  3G21 A;  3HZQ A;  1YIT P;  2LF4 A;  3M1M A;  4XFX A;  1K73 Q;  5DCK A;  1Q82 Q;  3CCV P;  4U0E A;  2XT1 A;  3WBH A;  1M6N A;  1QRJ A;  1QVG O;  4M0I A;  3LRY A;  1YJ9 P;  2L6E A;  3CXC O;  2ONT A;  4XRO A;  4GR2 A;  5I4T G;  3DS0 A;  1K30 A;  3G1G A;  5BS2 A;  1VQ6 P;  3DS2 A;  2P9X A;  3E2D A;  3CCR P;  2EG5 A;  2QEX P;  1YHQ P;  2PEI A;  3P05 A;  1ZMB A;  4U0B A;  4GR6 A;  4XRQ A;  2Z46 A;  1VQP P;  4IPY A;  1S72 P;  1E6J P;  2BHV A;  3CC2 P;  3G6E P;  4WYM A;  5HGN A;  2Z44 A;  1VQL P;  4U0A A;  5F2N A;  3CCU P;  3G28 A;  5BS1 A;  3CPW O;  3G4S P;  1NJI Q;  2EFJ A;  5F2O A;  4QNB A;  2BUO A;  3G29 A;  5HGL A;  1KQS O;  1Q86 Q;  2PEO A;  3MGE A;  3H4E A;  2PEK A;  4COP A;  4XFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...