3G21A

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: low ph
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
AGPWADIMQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Gag polyprotein
publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
total genus 25
structure length 77
sequence length 77
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g21A00
3VRLC 2M8LA 2L6EA 3G1GA 4PH1A 2KODA 2XXMA 3DS1A 4U0DA 4COCA 5I4TG 2JO0A 3H47A 3NTEA 1EIAA 2XT1A 3H4EA 3DS2A 4U0FA 3LRYA 4U0CA 5HGOA 4PH0A 2JYGA 2JYLA 3G21A 4XFXA 3DTJA 1EOQA 4XRQA 4U0EA 4XFYA 2M8NA 3G0VA 3P05A 4XROA 5HGNA 3G29A 1BAJA 4WYMA 5JPAA 2M8PA 3G26A 1AUMA 1A8OA 3G1IA 1QRJA 3G28A 3DPHA 3DS4A 4XFZA 2ONTA 5HGLA 5HGMA 1D1DA 2XV6A 4IPYA 1A43A 4U0AA 2LF4A 4U0BA 3DS5A 3DS0A 3MGEA 4QNBA 2BUOA 5DCKA 4M0IA 1E6JP 4COPA 2EIAA 3DS3A
chains in the Genus database with same CATH superfamily
1GXGA 1HQBA 5CZDB 1VQOP 2GZIA 1UNKA 1VQMP 2WPTA 2BHVA 3G26A 1L0HA 2DNWA 3HZQA 2Z46A 2LF4A 3EJEA 4BPGA 1Z6MA 2FAEA 1L0IA 1MZ8A 2EHSA 2PEOA 2N5HA 1AF8A 4PH1A 2N5IA 1RO0A 5KP7B 3NTEA 3H4EA 3LRYA 1M6NA 4U0CA 1M6EX 2GDWA 4XROA 1M1KQ 2L22A 4GR6A 1AUMA 3G6EP 4XFZA 3OW2O 4R0MA 2FADA 3CC4P 2FVEA 2MY5A 2K2QA 5DCKA 2K0YA 4COCA 2KOPA 2ERHA 3CCRP 2MVUA 4IZ6A 5BS2A 3CCSP 1Q82Q 2N50A 2MD9A 2PENA 1E0HA 1EOQA 2M8NA 3G0VA 2XZ1C 2AFDA 2KGCA 1Q86Q 3G28A 3EJDA 1DV5A 2KGDA 4U0BA 2KOOA 1ZMBA 1YHQP 1VQ9P 2MVVA 2L6EA 2KORA 2KODA 2K0XA 2K5XA 2KOSA 2PEIA 1VQPP 1VQNP 2KG6A 1QRJA 5HGMA 1K9MQ 2JQ4A 2MF4A 2VLNA 2EG5A 3G71P 2K94A 2BUOA 4QKOA 3GZMA 2M8LA 4U0DA 2FQ2A 1Q81Q 3CCUP 2JYGA 2Z45A 3H0DA 1NJIQ 5HGNA 2M8PA 1A8OA 2KR5A 4H2YC 3G4SP 3DS4A 1D1DA 1DNYA 5F2NA 3DS5A 2PEMA 2LTEA 4QNBA 1OR5A 1GPJA 1VHNA 1K73Q 2JO0A 3H47A 4UHPB 4HKGA 1YITP 4XFYA 3CCEP 2JBGA 2AFEA 3G1IA 3RG6C 1VKUA 3CE7A 4IPYA 2CQ8A 5F2OA 1VQ5P 3DS2A 3GJNA 2FQ1A 1S72P 2L4BA 3GZLA 3CC7P 2KGEA 2OTJP 1K30A 1JJ2O 1KLPA 2JB0A 2VLQA 2MR8A 2K93A 2AVAA 2KWLA 1VQLP 1EMVA 2NO8A 2L9FA 1EIAA 4U0FA 5HGOA 2LOLA 2FVFA 2QNWA 3NY7B 2ONTA 1RNIA 3RG2A 2L0QA 2CGQA 1IMQA 2X2BA 3E2DA 3VRLC 3CCVP 1ACPA 2XXMA 2PEQA 4PWVB 2E1MA 2OARA 4F37A 2PNGA 2VLPA 3DTJA 1KD1Q 4U0EA 2XZ0D 2FQ0A 2K92A 1N8RQ 1ZNVA 3LMOA 2ROQA 2FACA 3CXCO 3WBHA 3DS0A 1KQSO 1VQ8P 3HYBA 3DS1A 4DG9A 2LPKA 1VQ7P 2JGPA 5EJDA 3CCJP 1AYIA 2QEXP 2GYKA 1RO2A 2OTLP 2EFJA 2KW2A 1FR2A 1YJWP 2PEJA 4BPHA 1IMPA 3U43A 5I4TG 2XT1A 4XRQA 3CCQP 2FVAA 1BAJA 1F80D 1UJZA 4U0AA 2QA4P 2GZEA 1BXIA 1QVFO 3DS3A 3G1GA 2JYLA 1IUQA 2MR7A 4WYMA 2PY8A 7CEIA 4H2WC 2AF8A 2LMLA 5BS1A 5HV8A 3CMEP 2LKIA 3CCLP 2GDYA 2N6YA 2DGYA 3GKLC 2Z44A 2GZJA 1W2BO 1VQKP 1CEIA 3Q20A 2KGAA 2P9XA 4PH0A 3CCMP 4XFXA 2KG8A 5HVCA 1M74A 2CNRA 1YJNP 2KG9A 5F2KA 5KP8B 3M1MA 3B5IA 2VSQA 3I56P 1VQ4P 4CA3A 1T8KA 2GZGA 3G21A 3P05A 4NEOA 3G29A 2CG5B 2K0DX 2VLOA 1VQ6P 4BPFA 2N6ZA 4MRTC 2LIWA 2GDXA 1YJ9P 4GR2A 3CMAP 2EHTA 2LIUA 3EJBA 1QVGO 2FHSC 2GZFA 5EW5E 1K8AQ 5KP6B 4PXHB 1GXHA 3CC2P 3B4QA 5HGLA 2XV6A 2JAZA 2M5RA 2PEKA 3MGEA 2JU2A 3CD6P 1YI2P 4M0IA 4COPA 2EIAA 1Q7YQ 4H2XC 3I55P 1X3OA 3CPWO 2JU1A 2KOQA 1HY8A 5JPAA 1YIJP 1M90Q 3DPHA 1KC8Q 1A43A 2CWOA 2N98A 1NQ4A 1E6JP 2LL8A
chains in the Genus database with same CATH topology
3VRLC 2M8LA 2Z44A 4U0DA 2XXMA 3CCVP 2PEQA 1W2BO 2E1MA 2OARA 3CCUP 1Q81Q 1VQKP 3Q20A 1VQOP 2P9XA 4PH0A 3CCMP 2JYGA 4XFXA 3DTJA 1KD1Q 2Z45A 4U0EA 3H0DA 1NJIQ 1VQMP 2BHVA 1M74A 5HGNA 1YJNP 1N8RQ 2M8PA 3G26A 1A8OA 5F2KA 3G4SP 3DS4A 1D1DA 3HZQA 3M1MA 2Z46A 2LF4A 5F2NA 3DS5A 3B5IA 3CXCO 3WBHA 2PEMA 3DS0A 1KQSO 4QNBA 1VQ8P 2PEOA 1K73Q 3HYBA 4PH1A 3DS1A 1RO0A 2JO0A 3H47A 3I56P 1VQ4P 3NTEA 3H4EA 1VQ7P 3LRYA 1M6NA 4U0CA 1YITP 1M6EX 3CCJP 3G21A 4XFYA 3CCEP 3P05A 4XROA 2QEXP 3G29A 1M1KQ 4GR6A 1RO2A 1AUMA 3G1IA 3G6EP 2OTLP 2EFJA 4XFZA 3RG6C 3OW2O 1VQ6P 3CC4P 4IPYA 1YJWP 2PEJA 5DCKA 1YJ9P 4GR2A 3CMAP 4COCA 5F2OA 3CCRP 5I4TG 5BS2A 3CCSP 1VQ5P 1Q82Q 1QVGO 2XT1A 3DS2A 1K8AQ 2PENA 4XRQA 1EOQA 3CCQP 1S72P 2M8NA 3G0VA 3CC2P 1BAJA 1Q86Q 3G28A 3CC7P 5HGLA 2XV6A 2OTJP 4U0AA 2QA4P 1K30A 1JJ2O 4U0BA 1ZMBA 2PEKA 1YHQP 1VQ9P 3MGEA 1QVFO 3CD6P 1YI2P 4M0IA 4COPA 2EIAA 1Q7YQ 3DS3A 2L6EA 3G1GA 2KODA 1VQLP 3I55P 1EIAA 3CPWO 4U0FA 5HGOA 2PEIA 2JYLA 1IUQA 1VQPP 4WYMA 5JPAA 1VQNP 1YIJP 1M90Q 2PY8A 1QRJA 3DPHA 1KC8Q 2ONTA 5HGMA 1A43A 1K9MQ 1RNIA 2CWOA 5BS1A 2EG5A 3G71P 3CMEP 2BUOA 3CCLP 1E6JP 3E2DA 2DGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRL C;  2M8L A;  2L6E A;  3G1G A;  4PH1 A;  2KOD A;  2XXM A;  3DS1 A;  4U0D A;  4COC A;  5I4T G;  2JO0 A;  3H47 A;  3NTE A;  1EIA A;  2XT1 A;  3H4E A;  3DS2 A;  4U0F A;  3LRY A;  4U0C A;  5HGO A;  4PH0 A;  2JYG A;  2JYL A;  3G21 A;  4XFX A;  3DTJ A;  1EOQ A;  4XRQ A;  4U0E A;  4XFY A;  2M8N A;  3G0V A;  3P05 A;  4XRO A;  5HGN A;  3G29 A;  1BAJ A;  4WYM A;  5JPA A;  2M8P A;  3G26 A;  1AUM A;  1A8O A;  3G1I A;  1QRJ A;  3G28 A;  3DPH A;  3DS4 A;  4XFZ A;  2ONT A;  5HGL A;  5HGM A;  1D1D A;  2XV6 A;  4IPY A;  1A43 A;  4U0A A;  2LF4 A;  4U0B A;  3DS5 A;  3DS0 A;  3MGE A;  4QNB A;  2BUO A;  5DCK A;  4M0I A;  1E6J P;  4COP A;  2EIA A;  3DS3 A; 
#chains in the Genus database with same CATH topology
 1GXG A;  1HQB A;  5CZD B;  1VQO P;  2GZI A;  1UNK A;  1VQM P;  2WPT A;  2BHV A;  3G26 A;  1L0H A;  2DNW A;  3HZQ A;  2Z46 A;  2LF4 A;  3EJE A;  4BPG A;  1Z6M A;  2FAE A;  1L0I A;  1MZ8 A;  2EHS A;  2PEO A;  2N5H A;  1AF8 A;  4PH1 A;  2N5I A;  1RO0 A;  5KP7 B;  3NTE A;  3H4E A;  3LRY A;  1M6N A;  4U0C A;  1M6E X;  2GDW A;  4XRO A;  1M1K Q;  2L22 A;  4GR6 A;  1AUM A;  3G6E P;  4XFZ A;  3OW2 O;  4R0M A;  2FAD A;  3CC4 P;  2FVE A;  2MY5 A;  2K2Q A;  5DCK A;  2K0Y A;  4COC A;  2KOP A;  2ERH A;  3CCR P;  2MVU A;  4IZ6 A;  5BS2 A;  3CCS P;  1Q82 Q;  2N50 A;  2MD9 A;  2PEN A;  1E0H A;  1EOQ A;  2M8N A;  3G0V A;  2XZ1 C;  2AFD A;  2KGC A;  1Q86 Q;  3G28 A;  3EJD A;  1DV5 A;  2KGD A;  4U0B A;  2KOO A;  1ZMB A;  1YHQ P;  1VQ9 P;  2MVV A;  2L6E A;  2KOR A;  2KOD A;  2K0X A;  2K5X A;  2KOS A;  2PEI A;  1VQP P;  1VQN P;  2KG6 A;  1QRJ A;  5HGM A;  1K9M Q;  2JQ4 A;  2MF4 A;  2VLN A;  2EG5 A;  3G71 P;  2K94 A;  2BUO A;  4QKO A;  3GZM A;  2M8L A;  4U0D A;  2FQ2 A;  1Q81 Q;  3CCU P;  2JYG A;  2Z45 A;  3H0D A;  1NJI Q;  5HGN A;  2M8P A;  1A8O A;  2KR5 A;  4H2Y C;  3G4S P;  3DS4 A;  1D1D A;  1DNY A;  5F2N A;  3DS5 A;  2PEM A;  2LTE A;  4QNB A;  1OR5 A;  1GPJ A;  1VHN A;  1K73 Q;  2JO0 A;  3H47 A;  4UHP B;  4HKG A;  1YIT P;  4XFY A;  3CCE P;  2JBG A;  2AFE A;  3G1I A;  3RG6 C;  1VKU A;  3CE7 A;  4IPY A;  2CQ8 A;  5F2O A;  1VQ5 P;  3DS2 A;  3GJN A;  2FQ1 A;  1S72 P;  2L4B A;  3GZL A;  3CC7 P;  2KGE A;  2OTJ P;  1K30 A;  1JJ2 O;  1KLP A;  2JB0 A;  2VLQ A;  2MR8 A;  2K93 A;  2AVA A;  2KWL A;  1VQL P;  1EMV A;  2NO8 A;  2L9F A;  1EIA A;  4U0F A;  5HGO A;  2LOL A;  2FVF A;  2QNW A;  3NY7 B;  2ONT A;  1RNI A;  3RG2 A;  2L0Q A;  2CGQ A;  1IMQ A;  2X2B A;  3E2D A;  3VRL C;  3CCV P;  1ACP A;  2XXM A;  2PEQ A;  4PWV B;  2E1M A;  2OAR A;  4F37 A;  2PNG A;  2VLP A;  3DTJ A;  1KD1 Q;  4U0E A;  2XZ0 D;  2FQ0 A;  2K92 A;  1N8R Q;  1ZNV A;  3LMO A;  2ROQ A;  2FAC A;  3CXC O;  3WBH A;  3DS0 A;  1KQS O;  1VQ8 P;  3HYB A;  3DS1 A;  4DG9 A;  2LPK A;  1VQ7 P;  2JGP A;  5EJD A;  3CCJ P;  1AYI A;  2QEX P;  2GYK A;  1RO2 A;  2OTL P;  2EFJ A;  2KW2 A;  1FR2 A;  1YJW P;  2PEJ A;  4BPH A;  1IMP A;  3U43 A;  5I4T G;  2XT1 A;  4XRQ A;  3CCQ P;  2FVA A;  1BAJ A;  1F80 D;  1UJZ A;  4U0A A;  2QA4 P;  2GZE A;  1BXI A;  1QVF O;  3DS3 A;  3G1G A;  2JYL A;  1IUQ A;  2MR7 A;  4WYM A;  2PY8 A;  7CEI A;  4H2W C;  2AF8 A;  2LML A;  5BS1 A;  5HV8 A;  3CME P;  2LKI A;  3CCL P;  2GDY A;  2N6Y A;  2DGY A;  3GKL C;  2Z44 A;  2GZJ A;  1W2B O;  1VQK P;  1CEI A;  3Q20 A;  2KGA A;  2P9X A;  4PH0 A;  3CCM P;  4XFX A;  2KG8 A;  5HVC A;  1M74 A;  2CNR A;  1YJN P;  2KG9 A;  5F2K A;  5KP8 B;  3M1M A;  3B5I A;  2VSQ A;  3I56 P;  1VQ4 P;  4CA3 A;  1T8K A;  2GZG A;  3G21 A;  3P05 A;  4NEO A;  3G29 A;  2CG5 B;  2K0D X;  2VLO A;  1VQ6 P;  4BPF A;  2N6Z A;  4MRT C;  2LIW A;  2GDX A;  1YJ9 P;  4GR2 A;  3CMA P;  2EHT A;  2LIU A;  3EJB A;  1QVG O;  2FHS C;  2GZF A;  5EW5 E;  1K8A Q;  5KP6 B;  4PXH B;  1GXH A;  3CC2 P;  3B4Q A;  5HGL A;  2XV6 A;  2JAZ A;  2M5R A;  2PEK A;  3MGE A;  2JU2 A;  3CD6 P;  1YI2 P;  4M0I A;  4COP A;  2EIA A;  1Q7Y Q;  4H2X C;  3I55 P;  1X3O A;  3CPW O;  2JU1 A;  2KOQ A;  1HY8 A;  5JPA A;  1YIJ P;  1M90 Q;  3DPH A;  1KC8 Q;  1A43 A;  2CWO A;  2N98 A;  1NQ4 A;  1E6J P;  2LL8 A; 
#chains in the Genus database with same CATH homology
 3VRL C;  2M8L A;  2Z44 A;  4U0D A;  2XXM A;  3CCV P;  2PEQ A;  1W2B O;  2E1M A;  2OAR A;  3CCU P;  1Q81 Q;  1VQK P;  3Q20 A;  1VQO P;  2P9X A;  4PH0 A;  3CCM P;  2JYG A;  4XFX A;  3DTJ A;  1KD1 Q;  2Z45 A;  4U0E A;  3H0D A;  1NJI Q;  1VQM P;  2BHV A;  1M74 A;  5HGN A;  1YJN P;  1N8R Q;  2M8P A;  3G26 A;  1A8O A;  5F2K A;  3G4S P;  3DS4 A;  1D1D A;  3HZQ A;  3M1M A;  2Z46 A;  2LF4 A;  5F2N A;  3DS5 A;  3B5I A;  3CXC O;  3WBH A;  2PEM A;  3DS0 A;  1KQS O;  4QNB A;  1VQ8 P;  2PEO A;  1K73 Q;  3HYB A;  4PH1 A;  3DS1 A;  1RO0 A;  2JO0 A;  3H47 A;  3I56 P;  1VQ4 P;  3NTE A;  3H4E A;  1VQ7 P;  3LRY A;  1M6N A;  4U0C A;  1YIT P;  1M6E X;  3CCJ P;  3G21 A;  4XFY A;  3CCE P;  3P05 A;  4XRO A;  2QEX P;  3G29 A;  1M1K Q;  4GR6 A;  1RO2 A;  1AUM A;  3G1I A;  3G6E P;  2OTL P;  2EFJ A;  4XFZ A;  3RG6 C;  3OW2 O;  1VQ6 P;  3CC4 P;  4IPY A;  1YJW P;  2PEJ A;  5DCK A;  1YJ9 P;  4GR2 A;  3CMA P;  4COC A;  5F2O A;  3CCR P;  5I4T G;  5BS2 A;  3CCS P;  1VQ5 P;  1Q82 Q;  1QVG O;  2XT1 A;  3DS2 A;  1K8A Q;  2PEN A;  4XRQ A;  1EOQ A;  3CCQ P;  1S72 P;  2M8N A;  3G0V A;  3CC2 P;  1BAJ A;  1Q86 Q;  3G28 A;  3CC7 P;  5HGL A;  2XV6 A;  2OTJ P;  4U0A A;  2QA4 P;  1K30 A;  1JJ2 O;  4U0B A;  1ZMB A;  2PEK A;  1YHQ P;  1VQ9 P;  3MGE A;  1QVF O;  3CD6 P;  1YI2 P;  4M0I A;  4COP A;  2EIA A;  1Q7Y Q;  3DS3 A;  2L6E A;  3G1G A;  2KOD A;  1VQL P;  3I55 P;  1EIA A;  3CPW O;  4U0F A;  5HGO A;  2PEI A;  2JYL A;  1IUQ A;  1VQP P;  4WYM A;  5JPA A;  1VQN P;  1YIJ P;  1M90 Q;  2PY8 A;  1QRJ A;  3DPH A;  1KC8 Q;  2ONT A;  5HGM A;  1A43 A;  1K9M Q;  1RNI A;  2CWO A;  5BS1 A;  2EG5 A;  3G71 P;  3CME P;  2BUO A;  3CCL P;  1E6J P;  3E2D A;  2DGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...