4GR2A

Structure of atrbcx1 from arabidopsis thaliana.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
110
structure length
110
Chain Sequence
b'EASPEAKAAKHLHDFFTYVAVRIVSAQLESYNPEAYMELREFLDTNSVSDGDKFLATLMRRSSRHMNLALRILEVRSAYAKNDFEWDNMKRLAFKNVDDSNTRLMREYVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AtRbcX1
publication title Insights into eukaryotic Rubisco assembly - Crystal structures of RbcX chaperones from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Chaperone
total genus 45
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4gr2A00
2PEQA 2PEOA 4GR6A 2Z44A 3RG6C 2PEIA 2PEMA 2PENA 5BS1A 2PY8A 3Q20A 2Z45A 2PEKA 4GR2A 2Z46A 3HYBA 2PEJA 5BS2A
chains in the Genus database with same CATH superfamily
3DS0A 1L0HA 2N50A 1F80D 5HVCA 1M6NA 2KWLA 2VLNA 1KC8Q 1K9MQ 2GZEA 2GDYA 1X3OA 2MD9A 3G1GA 3HYBA 2FQ0A 2KGDA 3DS2A 3VRLC 1ACPA 1YIJP 3P05A 2CG5B 5BS2A 2OTJP 2KGEA 3EJDA 5KP7B 2KW2A 4IPYA 1UNKA 4GR6A 2E1MA 2K92A 1A8OA 1NJIQ 2K2QA 3G26A 2Z46A 2GDXA 1NQ4A 2LOLA 2AFEA 5F2NA 4BPFA 3CCSP 5HGOA 4QNBA 1EOQA 1M6EX 2GYKA 1DV5A 2QEXP 1YHQP 1VQ8P 3CXCO 3G0VA 4PWVB 2CGQA 2Z45A 2GZFA 1IMPA 4PH1A 2JYLA 2JAZA 1D1DA 2XZ0D 1KQSO 2CWOA 4XFYA 1YITP 2N5IA 1KLPA 3GKLC 4BPGA 2JBGA 2EG5A 1Q82Q 3G28A 3GJNA 5KP6B 5BS1A 1VKUA 1GXGA 2FADA 2EFJA 2N98A 3CC2P 1AF8A 1RO2A 2AFDA 4F37A 2KOOA 5EJDA 3G1IA 1VQOP 2N6ZA 1Z6MA 2L6EA 3DTJA 2MR7A 4XRQA 5KP8B 1W2BO 1EIAA 2MVUA 1RNIA 2PNGA 4XFZA 2FQ1A 3G6EP 2JYGA 1VQMP 2K93A 2JQ4A 3CCQP 3GZLA 2MF4A 2M8LA 3CMEP 1VQLP 1RO0A 3G71P 2VLQA 1VQ5P 2FAEA 2GZGA 2LIUA 3CC4P 2XZ1C 2LKIA 3CCUP 2AF8A 3EJEA 2PEQA 4U0EA 2PEIA 2KG9A 2MVVA 2LL8A 3CCRP 2CNRA 1T8KA 1YJ9P 2DGYA 2P9XA 3LMOA 4U0CA 3DS1A 3NTEA 1VQ6P 2BUOA 2N6YA 1GPJA 1BAJA 4M0IA 3B5IA 3U43A 5DCKA 1K73Q 4H2WC 1FR2A 4PH0A 2EIAA 1AYIA 3G21A 2FVEA 5F2OA 2L0QA 2Z44A 3DS4A 2FACA 1VQKP 3G29A 2JB0A 2L9FA 5I4TG 5EW5E 4XROA 2WPTA 4BPHA 1VHNA 3CC7P 1Q81Q 1K30A 3CCJP 1S72P 2QNWA 4DG9A 3RG2A 3HZQA 1VQ9P 3H47A 2K0XA 1YJWP 2JU2A 2VLOA 1QVFO 2KODA 2KR5A 1N8RQ 2LMLA 2X2BA 3NY7B 2FVAA 1IMQA 2XT1A 2XV6A 3DS3A 1QVGO 2OARA 1M1KQ 4MRTC 5F2KA 2PEKA 2GZJA 4NEOA 2M8PA 1L0IA 4H2YC 2K5XA 2JU1A 1VQ4P 3I55P 4H2XC 2LIWA 1K8AQ 2KOSA 2MY5A 1VQNP 4QKOA 2ERHA 2KG8A 1IUQA 2GDWA 2VSQA 3CMAP 2M8NA 1KD1Q 1HY8A 3RG6C 1YJNP 4XFXA 4U0BA 2K0YA 4CA3A 3DPHA 2XXMA 1AUMA 2OTLP 1A43A 2KGAA 1ZMBA 1QRJA 2PEOA 2CQ8A 2PY8A 2FHSC 2JGPA 4UHPB 3MGEA 1M74A 2MR8A 3GZMA 3I56P 1YI2P 1UJZA 1Q86Q 3G4SP 4COCA 1OR5A 3CCMP 4IZ6A 2KOQA 7CEIA 3CD6P 2DNWA 3CPWO 1M90Q 3H4EA 2PEMA 2GZIA 3B4QA 2FQ2A 4HKGA 3WBHA 1BXIA 2ONTA 4U0AA 5JPAA 5HV8A 1JJ2O 2KG6A 2QA4P 4GR2A 4COPA 1MZ8A 2KORA 3E2DA 4U0DA 4U0FA 5CZDB 3DS5A 5HGNA 1E0HA 3M1MA 4WYMA 2M5RA 3H0DA 2KGCA 2VLPA 3CCEP 4PXHB 3OW2O 2KOPA 2K0DX 5HGMA 2JO0A 2K94A 2EHSA 2LTEA 1Q7YQ 2L4BA 5HGLA 2N5HA 3CCLP 2L22A 2FVFA 1GXHA 2ROQA 1ZNVA 1DNYA 3CE7A 3Q20A 1HQBA 2BHVA 3CCVP 2AVAA 1EMVA 1VQPP 2PEJA 2PENA 1VQ7P 3EJBA 1CEIA 2LPKA 1E6JP 3LRYA 2EHTA 4R0MA 2NO8A 2LF4A
chains in the Genus database with same CATH topology
1RO2A 3CD6P 5I4TG 4XROA 3CPWO 1M90Q 3H4EA 3DS0A 3G1IA 1VQOP 3CC7P 2L6EA 3DTJA 1Q81Q 1K30A 3CCJP 1S72P 2PEMA 4XRQA 1VQ9P 3HZQA 1W2BO 3H47A 1M6NA 1EIAA 1YJWP 1QVFO 1KC8Q 1RNIA 1K9MQ 2KODA 4XFZA 3WBHA 2ONTA 3G6EP 1N8RQ 3G1GA 3HYBA 4U0AA 2JYGA 1VQMP 5JPAA 3CCQP 3DS2A 2M8LA 2XT1A 3VRLC 1JJ2O 1YIJP 2XV6A 3DS3A 3P05A 3CMEP 1QVGO 1VQLP 1RO0A 3G71P 2QA4P 4GR2A 4COPA 5BS2A 2OTJP 2OARA 4IPYA 1M1KQ 5F2KA 1VQ5P 2PEKA 3E2DA 4U0DA 4GR6A 2E1MA 4U0FA 2M8PA 3CC4P 1A8OA 1NJIQ 3G26A 3DS5A 5HGNA 3CCUP 2Z46A 3M1MA 4WYMA 5F2NA 1VQ4P 3CCSP 5HGOA 3H0DA 3I55P 4QNBA 1EOQA 1K8AQ 3CCEP 1M6EX 2PEQA 4U0EA 2PEIA 1VQNP 3OW2O 2QEXP 5HGMA 1YHQP 1IUQA 2JO0A 1VQ8P 3CXCO 3G0VA 3CMAP 2Z45A 2M8NA 3CCRP 1KD1Q 4PH1A 3RG6C 1YJNP 4XFXA 4U0BA 1YJ9P 1Q7YQ 2DGYA 3DPHA 2JYLA 2XXMA 1AUMA 1D1DA 2P9XA 5HGLA 2OTLP 3CCLP 4U0CA 1A43A 2CWOA 3DS1A 3NTEA 1KQSO 4XFYA 1YITP 1ZMBA 1VQ6P 1QRJA 2PEOA 2BUOA 2PY8A 3Q20A 2BHVA 3CCVP 1BAJA 2EG5A 4M0IA 3B5IA 1Q82Q 3G28A 2EFJA 3MGEA 5DCKA 1M74A 1VQPP 1K73Q 3I56P 2PEJA 2PENA 4PH0A 2EIAA 1VQ7P 3G21A 5BS1A 5F2OA 1E6JP 3LRYA 1YI2P 2Z44A 3DS4A 1Q86Q 3G4SP 4COCA 1VQKP 3G29A 3CC2P 3CCMP 2LF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEQ A;  2PEO A;  4GR6 A;  2Z44 A;  3RG6 C;  2PEI A;  2PEM A;  2PEN A;  5BS1 A;  2PY8 A;  3Q20 A;  2Z45 A;  2PEK A;  4GR2 A;  2Z46 A;  3HYB A;  2PEJ A;  5BS2 A; 
#chains in the Genus database with same CATH topology
 3DS0 A;  1L0H A;  2N50 A;  1F80 D;  5HVC A;  1M6N A;  2KWL A;  2VLN A;  1KC8 Q;  1K9M Q;  2GZE A;  2GDY A;  1X3O A;  2MD9 A;  3G1G A;  3HYB A;  2FQ0 A;  2KGD A;  3DS2 A;  3VRL C;  1ACP A;  1YIJ P;  3P05 A;  2CG5 B;  5BS2 A;  2OTJ P;  2KGE A;  3EJD A;  5KP7 B;  2KW2 A;  4IPY A;  1UNK A;  4GR6 A;  2E1M A;  2K92 A;  1A8O A;  1NJI Q;  2K2Q A;  3G26 A;  2Z46 A;  2GDX A;  1NQ4 A;  2LOL A;  2AFE A;  5F2N A;  4BPF A;  3CCS P;  5HGO A;  4QNB A;  1EOQ A;  1M6E X;  2GYK A;  1DV5 A;  2QEX P;  1YHQ P;  1VQ8 P;  3CXC O;  3G0V A;  4PWV B;  2CGQ A;  2Z45 A;  2GZF A;  1IMP A;  4PH1 A;  2JYL A;  2JAZ A;  1D1D A;  2XZ0 D;  1KQS O;  2CWO A;  4XFY A;  1YIT P;  2N5I A;  1KLP A;  3GKL C;  4BPG A;  2JBG A;  2EG5 A;  1Q82 Q;  3G28 A;  3GJN A;  5KP6 B;  5BS1 A;  1VKU A;  1GXG A;  2FAD A;  2EFJ A;  2N98 A;  3CC2 P;  1AF8 A;  1RO2 A;  2AFD A;  4F37 A;  2KOO A;  5EJD A;  3G1I A;  1VQO P;  2N6Z A;  1Z6M A;  2L6E A;  3DTJ A;  2MR7 A;  4XRQ A;  5KP8 B;  1W2B O;  1EIA A;  2MVU A;  1RNI A;  2PNG A;  4XFZ A;  2FQ1 A;  3G6E P;  2JYG A;  1VQM P;  2K93 A;  2JQ4 A;  3CCQ P;  3GZL A;  2MF4 A;  2M8L A;  3CME P;  1VQL P;  1RO0 A;  3G71 P;  2VLQ A;  1VQ5 P;  2FAE A;  2GZG A;  2LIU A;  3CC4 P;  2XZ1 C;  2LKI A;  3CCU P;  2AF8 A;  3EJE A;  2PEQ A;  4U0E A;  2PEI A;  2KG9 A;  2MVV A;  2LL8 A;  3CCR P;  2CNR A;  1T8K A;  1YJ9 P;  2DGY A;  2P9X A;  3LMO A;  4U0C A;  3DS1 A;  3NTE A;  1VQ6 P;  2BUO A;  2N6Y A;  1GPJ A;  1BAJ A;  4M0I A;  3B5I A;  3U43 A;  5DCK A;  1K73 Q;  4H2W C;  1FR2 A;  4PH0 A;  2EIA A;  1AYI A;  3G21 A;  2FVE A;  5F2O A;  2L0Q A;  2Z44 A;  3DS4 A;  2FAC A;  1VQK P;  3G29 A;  2JB0 A;  2L9F A;  5I4T G;  5EW5 E;  4XRO A;  2WPT A;  4BPH A;  1VHN A;  3CC7 P;  1Q81 Q;  1K30 A;  3CCJ P;  1S72 P;  2QNW A;  4DG9 A;  3RG2 A;  3HZQ A;  1VQ9 P;  3H47 A;  2K0X A;  1YJW P;  2JU2 A;  2VLO A;  1QVF O;  2KOD A;  2KR5 A;  1N8R Q;  2LML A;  2X2B A;  3NY7 B;  2FVA A;  1IMQ A;  2XT1 A;  2XV6 A;  3DS3 A;  1QVG O;  2OAR A;  1M1K Q;  4MRT C;  5F2K A;  2PEK A;  2GZJ A;  4NEO A;  2M8P A;  1L0I A;  4H2Y C;  2K5X A;  2JU1 A;  1VQ4 P;  3I55 P;  4H2X C;  2LIW A;  1K8A Q;  2KOS A;  2MY5 A;  1VQN P;  4QKO A;  2ERH A;  2KG8 A;  1IUQ A;  2GDW A;  2VSQ A;  3CMA P;  2M8N A;  1KD1 Q;  1HY8 A;  3RG6 C;  1YJN P;  4XFX A;  4U0B A;  2K0Y A;  4CA3 A;  3DPH A;  2XXM A;  1AUM A;  2OTL P;  1A43 A;  2KGA A;  1ZMB A;  1QRJ A;  2PEO A;  2CQ8 A;  2PY8 A;  2FHS C;  2JGP A;  4UHP B;  3MGE A;  1M74 A;  2MR8 A;  3GZM A;  3I56 P;  1YI2 P;  1UJZ A;  1Q86 Q;  3G4S P;  4COC A;  1OR5 A;  3CCM P;  4IZ6 A;  2KOQ A;  7CEI A;  3CD6 P;  2DNW A;  3CPW O;  1M90 Q;  3H4E A;  2PEM A;  2GZI A;  3B4Q A;  2FQ2 A;  4HKG A;  3WBH A;  1BXI A;  2ONT A;  4U0A A;  5JPA A;  5HV8 A;  1JJ2 O;  2KG6 A;  2QA4 P;  4GR2 A;  4COP A;  1MZ8 A;  2KOR A;  3E2D A;  4U0D A;  4U0F A;  5CZD B;  3DS5 A;  5HGN A;  1E0H A;  3M1M A;  4WYM A;  2M5R A;  3H0D A;  2KGC A;  2VLP A;  3CCE P;  4PXH B;  3OW2 O;  2KOP A;  2K0D X;  5HGM A;  2JO0 A;  2K94 A;  2EHS A;  2LTE A;  1Q7Y Q;  2L4B A;  5HGL A;  2N5H A;  3CCL P;  2L22 A;  2FVF A;  1GXH A;  2ROQ A;  1ZNV A;  1DNY A;  3CE7 A;  3Q20 A;  1HQB A;  2BHV A;  3CCV P;  2AVA A;  1EMV A;  1VQP P;  2PEJ A;  2PEN A;  1VQ7 P;  3EJB A;  1CEI A;  2LPK A;  1E6J P;  3LRY A;  2EHT A;  4R0M A;  2NO8 A;  2LF4 A; 
#chains in the Genus database with same CATH homology
 1RO2 A;  3CD6 P;  5I4T G;  4XRO A;  3CPW O;  1M90 Q;  3H4E A;  3DS0 A;  3G1I A;  1VQO P;  3CC7 P;  2L6E A;  3DTJ A;  1Q81 Q;  1K30 A;  3CCJ P;  1S72 P;  2PEM A;  4XRQ A;  1VQ9 P;  3HZQ A;  1W2B O;  3H47 A;  1M6N A;  1EIA A;  1YJW P;  1QVF O;  1KC8 Q;  1RNI A;  1K9M Q;  2KOD A;  4XFZ A;  3WBH A;  2ONT A;  3G6E P;  1N8R Q;  3G1G A;  3HYB A;  4U0A A;  2JYG A;  1VQM P;  5JPA A;  3CCQ P;  3DS2 A;  2M8L A;  2XT1 A;  3VRL C;  1JJ2 O;  1YIJ P;  2XV6 A;  3DS3 A;  3P05 A;  3CME P;  1QVG O;  1VQL P;  1RO0 A;  3G71 P;  2QA4 P;  4GR2 A;  4COP A;  5BS2 A;  2OTJ P;  2OAR A;  4IPY A;  1M1K Q;  5F2K A;  1VQ5 P;  2PEK A;  3E2D A;  4U0D A;  4GR6 A;  2E1M A;  4U0F A;  2M8P A;  3CC4 P;  1A8O A;  1NJI Q;  3G26 A;  3DS5 A;  5HGN A;  3CCU P;  2Z46 A;  3M1M A;  4WYM A;  5F2N A;  1VQ4 P;  3CCS P;  5HGO A;  3H0D A;  3I55 P;  4QNB A;  1EOQ A;  1K8A Q;  3CCE P;  1M6E X;  2PEQ A;  4U0E A;  2PEI A;  1VQN P;  3OW2 O;  2QEX P;  5HGM A;  1YHQ P;  1IUQ A;  2JO0 A;  1VQ8 P;  3CXC O;  3G0V A;  3CMA P;  2Z45 A;  2M8N A;  3CCR P;  1KD1 Q;  4PH1 A;  3RG6 C;  1YJN P;  4XFX A;  4U0B A;  1YJ9 P;  1Q7Y Q;  2DGY A;  3DPH A;  2JYL A;  2XXM A;  1AUM A;  1D1D A;  2P9X A;  5HGL A;  2OTL P;  3CCL P;  4U0C A;  1A43 A;  2CWO A;  3DS1 A;  3NTE A;  1KQS O;  4XFY A;  1YIT P;  1ZMB A;  1VQ6 P;  1QRJ A;  2PEO A;  2BUO A;  2PY8 A;  3Q20 A;  2BHV A;  3CCV P;  1BAJ A;  2EG5 A;  4M0I A;  3B5I A;  1Q82 Q;  3G28 A;  2EFJ A;  3MGE A;  5DCK A;  1M74 A;  1VQP P;  1K73 Q;  3I56 P;  2PEJ A;  2PEN A;  4PH0 A;  2EIA A;  1VQ7 P;  3G21 A;  5BS1 A;  5F2O A;  1E6J P;  3LRY A;  1YI2 P;  2Z44 A;  3DS4 A;  1Q86 Q;  3G4S P;  4COC A;  1VQK P;  3G29 A;  3CC2 P;  3CCM P;  2LF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...