4GR2A

Structure of atrbcx1 from arabidopsis thaliana.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
110
structure length
110
Chain Sequence
EASPEAKAAKHLHDFFTYVAVRIVSAQLESYNPEAYMELREFLDTNSVSDGDKFLATLMRRSSRHMNLALRILEVRSAYAKNDFEWDNMKRLAFKNVDDSNTRLMREYVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into eukaryotic Rubisco assembly - Crystal structures of RbcX chaperones from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Chaperone
molecule keywords AtRbcX1
total genus 45
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4gr2A00
2PEKA 5BS2A 2Z46A 5BS1A 2PEOA 2PY8A 3HYBA 4GR6A 3Q20A 2Z44A 4GR2A 2PEMA 2PEJA 3RG6C 2Z45A 2PEIA 2PENA 2PEQA
chains in the Genus database with same CATH superfamily
2FVEA 1T8KA 2LIUA 2JBGA 1ACPA 1CEIA 3GJNA 1K9MQ 2ROQA 2QEXP 4DG9A 1VQPP 1W2BO 3CCJP 2N5HA 2Z44A 2FVFA 1RO0A 4U0FA 3I56P 2M8PA 2AFEA 1MZ8A 1VQ6P 1D1DA 3DS4A 1FR2A 5EW5E 3G6EP 2QA4P 2LPKA 2PEKA 1VQKP 3H47A 3VRLC 2PEQA 2LL8A 2M8NA 2KG9A 7CEIA 2GDXA 2N6YA 2EIAA 3G1IA 4NEOA 4H2YC 2KW2A 2VLNA 2CQ8A 2PNGA 2MR7A 1BAJA 3NY7B 4MRTC 3I55P 5CZDB 1VQ7P 5F2OA 2P9XA 2MD9A 2Z46A 2GDYA 1YIJP 5HGOA 1VKUA 2FQ2A 2MVVA 2KWLA 3GKLC 2K94A 3CC4P 1DV5A 2K2QA 1Q81Q 3P05A 1HY8A 3H0DA 1A8OA 5F2KA 2MF4A 2JO0A 3DPHA 3HYBA 2FQ1A 2GYKA 3LRYA 4XRQA 3CCMP 2MY5A 5DCKA 3G1GA 2BUOA 2CGQA 5I4TG 3Q20A 1ZNVA 2LTEA 5BS2A 2OTJP 1AF8A 1F80D 5HVCA 1AUMA 1EIAA 3RG6C 1YI2P 1L0HA 3G21A 1K73Q 1VQ5P 2JB0A 3B4QA 4M0IA 3H4EA 3GZMA 2XZ1C 2LKIA 2EG5A 3G28A 3DS5A 3GZLA 3RG2A 5HGMA 1K30A 1E6JP 3DS0A 3CE7A 1QVGO 1K8AQ 3CD6P 3M1MA 1A43A 1VQLP 2WPTA 1M74A 2AFDA 2LMLA 2K0YA 1IUQA 1UJZA 2N5IA 2PEIA 2PENA 4PH1A 1N8RQ 4COCA 2XZ0D 1X3OA 5F2NA 3HZQA 2KORA 2EHTA 1M90Q 2KR5A 2OARA 1QRJA 2FHSC 4H2WC 2M8LA 2JU1A 2JQ4A 2QNWA 4IZ6A 2L6EA 2FACA 4F37A 4R0MA 3LMOA 4GR6A 1YJNP 1VQ8P 1JJ2O 3OW2O 5KP6B 5EJDA 1E0HA 4BPHA 2JU2A 2FADA 3EJBA 4COPA 2AVAA 4XFZA 2NO8A 2ONTA 2L0QA 1KQSO 3G26A 1QVFO 1IMQA 3CC7P 2VSQA 2Z45A 1BXIA 1YITP 2FQ0A 4CA3A 1M1KQ 4XFYA 2LIWA 2DGYA 4XFXA 2JGPA 2KGAA 1GXHA 2KGEA 2X2BA 3CXCO 5HGLA 3DTJA 1RO2A 4IPYA 2BHVA 5KP7B 2FVAA 2MR8A 2GZIA 3U43A 3CMAP 2KG8A 3CMEP 4U0EA 4U0CA 5HV8A 3CPWO 1EMVA 1ZMBA 3CCQP 4HKGA 3G4SP 3CCVP 3DS1A 1VQNP 2KODA 2PEOA 2LOLA 1NJIQ 2ERHA 3CCLP 2OTLP 1M6EX 2DNWA 4QKOA 1YHQP 3E2DA 2GZFA 2K93A 1Q82Q 2VLPA 1KLPA 2N6ZA 3CCUP 1IMPA 2KOSA 2LF4A 3CCRP 3EJDA 4XROA 4H2XC 2N98A 2GZGA 2MVUA 1KD1Q 2CWOA 2EHSA 2AF8A 2GDWA 3B5IA 4GR2A 2JYGA 1VQ4P 4PWVB 5JPAA 4U0AA 3CCSP 3DS3A 3MGEA 2PEMA 2L9FA 1RNIA 5KP8B 2KOQA 5HGNA 2JYLA 2XXMA 2K92A 1AYIA 1EOQA 3G71P 4PXHB 2VLOA 2CNRA 4WYMA 1YJ9P 1Q7YQ 4BPFA 2GZEA 1YJWP 2JAZA 2KG6A 4BPGA 2PEJA 1OR5A 1NQ4A 2EFJA 1VHNA 1M6NA 2M5RA 1KC8Q 2L22A 2CG5B 3WBHA 2K0DX 3G0VA 2KOOA 5BS1A 4U0BA 4PH0A 3NTEA 3CCEP 2VLQA 3DS2A 2N50A 2KGCA 2E1MA 2PY8A 2XT1A 2XV6A 2K5XA 1L0IA 1GXGA 2K0XA 1VQMP 3G29A 1Q86Q 1VQ9P 2KOPA 1HQBA 1DNYA 2GZJA 2L4BA 3EJEA 4UHPB 1S72P 2KGDA 1Z6MA 2FAEA 1UNKA 1VQOP 4U0DA 4QNBA 3CC2P 1GPJA
chains in the Genus database with same CATH topology
1JJ2O 3P05A 3H0DA 1A8OA 5F2KA 3OW2O 3B5IA 4GR2A 2JYGA 2JO0A 3DPHA 3HYBA 1K9MQ 1VQ4P 3LRYA 4COPA 4XRQA 3CC2P 3CCMP 4XFZA 5DCKA 5JPAA 3G1GA 2ONTA 2QEXP 4U0AA 3CCSP 1KQSO 1VQPP 1W2BO 2BUOA 3DS3A 3G26A 3MGEA 3CCJP 1QVFO 5I4TG 3Q20A 2Z44A 3CC7P 2PEMA 2Z45A 1RNIA 1RO0A 5BS2A 2OTJP 4U0FA 3I56P 1YITP 2M8PA 1AUMA 1EIAA 3RG6C 1YI2P 5HGNA 1M1KQ 2JYLA 3G21A 2XXMA 4XFYA 2DGYA 4XFXA 1K73Q 1EOQA 3G71P 4WYMA 1VQ5P 1VQ6P 1D1DA 3DS4A 3CXCO 1YJ9P 4M0IA 3G6EP 5HGLA 2QA4P 3DTJA 1Q7YQ 1RO2A 3H4EA 4IPYA 2BHVA 2PEKA 2EG5A 1VQKP 3H47A 3G28A 2PEQA 3VRLC 3DS5A 2M8NA 1YJWP 2PEJA 5HGMA 1K30A 1E6JP 3DS0A 2EFJA 3CMAP 3CD6P 1QVGO 1K8AQ 1M6NA 3CMEP 2EIAA 3M1MA 4U0EA 1A43A 4U0CA 3G1IA 3CPWO 1KC8Q 1VQLP 1M74A 1ZMBA 3WBHA 3CCQP 3G4SP 3CCVP 3G0VA 1BAJA 3DS1A 1VQNP 2KODA 5BS1A 1IUQA 2PEOA 4U0BA 4PH0A 1NJIQ 3NTEA 3I55P 3CCEP 2PEIA 2PENA 4PH1A 3CCLP 1VQ7P 2OTLP 1M6EX 3DS2A 1N8RQ 5F2OA 4COCA 5F2NA 3HZQA 1YHQP 3E2DA 2P9XA 2E1MA 2Z46A 1M90Q 2PY8A 2XT1A 1Q82Q 2XV6A 1YIJP 2OARA 1QRJA 5HGOA 1VQMP 3G29A 1Q86Q 1VQ9P 2M8LA 3CCUP 2LF4A 3CCRP 1S72P 3CC4P 2L6EA 4XROA 4U0DA 1VQOP 4QNBA 4GR6A 1VQ8P 1Q81Q 1KD1Q 2CWOA 1YJNP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEK A;  5BS2 A;  2Z46 A;  5BS1 A;  2PEO A;  2PY8 A;  3HYB A;  4GR6 A;  3Q20 A;  2Z44 A;  4GR2 A;  2PEM A;  2PEJ A;  3RG6 C;  2Z45 A;  2PEI A;  2PEN A;  2PEQ A; 
#chains in the Genus database with same CATH topology
 2FVE A;  1T8K A;  2LIU A;  2JBG A;  1ACP A;  1CEI A;  3GJN A;  1K9M Q;  2ROQ A;  2QEX P;  4DG9 A;  1VQP P;  1W2B O;  3CCJ P;  2N5H A;  2Z44 A;  2FVF A;  1RO0 A;  4U0F A;  3I56 P;  2M8P A;  2AFE A;  1MZ8 A;  1VQ6 P;  1D1D A;  3DS4 A;  1FR2 A;  5EW5 E;  3G6E P;  2QA4 P;  2LPK A;  2PEK A;  1VQK P;  3H47 A;  3VRL C;  2PEQ A;  2LL8 A;  2M8N A;  2KG9 A;  7CEI A;  2GDX A;  2N6Y A;  2EIA A;  3G1I A;  4NEO A;  4H2Y C;  2KW2 A;  2VLN A;  2CQ8 A;  2PNG A;  2MR7 A;  1BAJ A;  3NY7 B;  4MRT C;  3I55 P;  5CZD B;  1VQ7 P;  5F2O A;  2P9X A;  2MD9 A;  2Z46 A;  2GDY A;  1YIJ P;  5HGO A;  1VKU A;  2FQ2 A;  2MVV A;  2KWL A;  3GKL C;  2K94 A;  3CC4 P;  1DV5 A;  2K2Q A;  1Q81 Q;  3P05 A;  1HY8 A;  3H0D A;  1A8O A;  5F2K A;  2MF4 A;  2JO0 A;  3DPH A;  3HYB A;  2FQ1 A;  2GYK A;  3LRY A;  4XRQ A;  3CCM P;  2MY5 A;  5DCK A;  3G1G A;  2BUO A;  2CGQ A;  5I4T G;  3Q20 A;  1ZNV A;  2LTE A;  5BS2 A;  2OTJ P;  1AF8 A;  1F80 D;  5HVC A;  1AUM A;  1EIA A;  3RG6 C;  1YI2 P;  1L0H A;  3G21 A;  1K73 Q;  1VQ5 P;  2JB0 A;  3B4Q A;  4M0I A;  3H4E A;  3GZM A;  2XZ1 C;  2LKI A;  2EG5 A;  3G28 A;  3DS5 A;  3GZL A;  3RG2 A;  5HGM A;  1K30 A;  1E6J P;  3DS0 A;  3CE7 A;  1QVG O;  1K8A Q;  3CD6 P;  3M1M A;  1A43 A;  1VQL P;  2WPT A;  1M74 A;  2AFD A;  2LML A;  2K0Y A;  1IUQ A;  1UJZ A;  2N5I A;  2PEI A;  2PEN A;  4PH1 A;  1N8R Q;  4COC A;  2XZ0 D;  1X3O A;  5F2N A;  3HZQ A;  2KOR A;  2EHT A;  1M90 Q;  2KR5 A;  2OAR A;  1QRJ A;  2FHS C;  4H2W C;  2M8L A;  2JU1 A;  2JQ4 A;  2QNW A;  4IZ6 A;  2L6E A;  2FAC A;  4F37 A;  4R0M A;  3LMO A;  4GR6 A;  1YJN P;  1VQ8 P;  1JJ2 O;  3OW2 O;  5KP6 B;  5EJD A;  1E0H A;  4BPH A;  2JU2 A;  2FAD A;  3EJB A;  4COP A;  2AVA A;  4XFZ A;  2NO8 A;  2ONT A;  2L0Q A;  1KQS O;  3G26 A;  1QVF O;  1IMQ A;  3CC7 P;  2VSQ A;  2Z45 A;  1BXI A;  1YIT P;  2FQ0 A;  4CA3 A;  1M1K Q;  4XFY A;  2LIW A;  2DGY A;  4XFX A;  2JGP A;  2KGA A;  1GXH A;  2KGE A;  2X2B A;  3CXC O;  5HGL A;  3DTJ A;  1RO2 A;  4IPY A;  2BHV A;  5KP7 B;  2FVA A;  2MR8 A;  2GZI A;  3U43 A;  3CMA P;  2KG8 A;  3CME P;  4U0E A;  4U0C A;  5HV8 A;  3CPW O;  1EMV A;  1ZMB A;  3CCQ P;  4HKG A;  3G4S P;  3CCV P;  3DS1 A;  1VQN P;  2KOD A;  2PEO A;  2LOL A;  1NJI Q;  2ERH A;  3CCL P;  2OTL P;  1M6E X;  2DNW A;  4QKO A;  1YHQ P;  3E2D A;  2GZF A;  2K93 A;  1Q82 Q;  2VLP A;  1KLP A;  2N6Z A;  3CCU P;  1IMP A;  2KOS A;  2LF4 A;  3CCR P;  3EJD A;  4XRO A;  4H2X C;  2N98 A;  2GZG A;  2MVU A;  1KD1 Q;  2CWO A;  2EHS A;  2AF8 A;  2GDW A;  3B5I A;  4GR2 A;  2JYG A;  1VQ4 P;  4PWV B;  5JPA A;  4U0A A;  3CCS P;  3DS3 A;  3MGE A;  2PEM A;  2L9F A;  1RNI A;  5KP8 B;  2KOQ A;  5HGN A;  2JYL A;  2XXM A;  2K92 A;  1AYI A;  1EOQ A;  3G71 P;  4PXH B;  2VLO A;  2CNR A;  4WYM A;  1YJ9 P;  1Q7Y Q;  4BPF A;  2GZE A;  1YJW P;  2JAZ A;  2KG6 A;  4BPG A;  2PEJ A;  1OR5 A;  1NQ4 A;  2EFJ A;  1VHN A;  1M6N A;  2M5R A;  1KC8 Q;  2L22 A;  2CG5 B;  3WBH A;  2K0D X;  3G0V A;  2KOO A;  5BS1 A;  4U0B A;  4PH0 A;  3NTE A;  3CCE P;  2VLQ A;  3DS2 A;  2N50 A;  2KGC A;  2E1M A;  2PY8 A;  2XT1 A;  2XV6 A;  2K5X A;  1L0I A;  1GXG A;  2K0X A;  1VQM P;  3G29 A;  1Q86 Q;  1VQ9 P;  2KOP A;  1HQB A;  1DNY A;  2GZJ A;  2L4B A;  3EJE A;  4UHP B;  1S72 P;  2KGD A;  1Z6M A;  2FAE A;  1UNK A;  1VQO P;  4U0D A;  4QNB A;  3CC2 P;  1GPJ A; 
#chains in the Genus database with same CATH homology
 1JJ2 O;  3P05 A;  3H0D A;  1A8O A;  5F2K A;  3OW2 O;  3B5I A;  4GR2 A;  2JYG A;  2JO0 A;  3DPH A;  3HYB A;  1K9M Q;  1VQ4 P;  3LRY A;  4COP A;  4XRQ A;  3CC2 P;  3CCM P;  4XFZ A;  5DCK A;  5JPA A;  3G1G A;  2ONT A;  2QEX P;  4U0A A;  3CCS P;  1KQS O;  1VQP P;  1W2B O;  2BUO A;  3DS3 A;  3G26 A;  3MGE A;  3CCJ P;  1QVF O;  5I4T G;  3Q20 A;  2Z44 A;  3CC7 P;  2PEM A;  2Z45 A;  1RNI A;  1RO0 A;  5BS2 A;  2OTJ P;  4U0F A;  3I56 P;  1YIT P;  2M8P A;  1AUM A;  1EIA A;  3RG6 C;  1YI2 P;  5HGN A;  1M1K Q;  2JYL A;  3G21 A;  2XXM A;  4XFY A;  2DGY A;  4XFX A;  1K73 Q;  1EOQ A;  3G71 P;  4WYM A;  1VQ5 P;  1VQ6 P;  1D1D A;  3DS4 A;  3CXC O;  1YJ9 P;  4M0I A;  3G6E P;  5HGL A;  2QA4 P;  3DTJ A;  1Q7Y Q;  1RO2 A;  3H4E A;  4IPY A;  2BHV A;  2PEK A;  2EG5 A;  1VQK P;  3H47 A;  3G28 A;  2PEQ A;  3VRL C;  3DS5 A;  2M8N A;  1YJW P;  2PEJ A;  5HGM A;  1K30 A;  1E6J P;  3DS0 A;  2EFJ A;  3CMA P;  3CD6 P;  1QVG O;  1K8A Q;  1M6N A;  3CME P;  2EIA A;  3M1M A;  4U0E A;  1A43 A;  4U0C A;  3G1I A;  3CPW O;  1KC8 Q;  1VQL P;  1M74 A;  1ZMB A;  3WBH A;  3CCQ P;  3G4S P;  3CCV P;  3G0V A;  1BAJ A;  3DS1 A;  1VQN P;  2KOD A;  5BS1 A;  1IUQ A;  2PEO A;  4U0B A;  4PH0 A;  1NJI Q;  3NTE A;  3I55 P;  3CCE P;  2PEI A;  2PEN A;  4PH1 A;  3CCL P;  1VQ7 P;  2OTL P;  1M6E X;  3DS2 A;  1N8R Q;  5F2O A;  4COC A;  5F2N A;  3HZQ A;  1YHQ P;  3E2D A;  2P9X A;  2E1M A;  2Z46 A;  1M90 Q;  2PY8 A;  2XT1 A;  1Q82 Q;  2XV6 A;  1YIJ P;  2OAR A;  1QRJ A;  5HGO A;  1VQM P;  3G29 A;  1Q86 Q;  1VQ9 P;  2M8L A;  3CCU P;  2LF4 A;  3CCR P;  1S72 P;  3CC4 P;  2L6E A;  4XRO A;  4U0D A;  1VQO P;  4QNB A;  4GR6 A;  1VQ8 P;  1Q81 Q;  1KD1 Q;  2CWO A;  1YJN P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...