4GR2A

Structure of atrbcx1 from arabidopsis thaliana.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
110
structure length
110
Chain Sequence
EASPEAKAAKHLHDFFTYVAVRIVSAQLESYNPEAYMELREFLDTNSVSDGDKFLATLMRRSSRHMNLALRILEVRSAYAKNDFEWDNMKRLAFKNVDDSNTRLMREYVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords AtRbcX1
publication title Insights into eukaryotic Rubisco assembly - Crystal structures of RbcX chaperones from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 45
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4gr2A00
2PENA 2Z44A 5BS1A 2PEJA 2PEIA 4GR6A 2PEQA 2PEMA 2Z46A 3HYBA 4GR2A 3RG6C 2Z45A 2PEOA 2PY8A 5BS2A 2PEKA 3Q20A
chains in the Genus database with same CATH superfamily
2XXMA 1YHQP 1HQBA 1VQ9P 4IZ6A 5CZDB 2AF8A 1K73Q 3HZQA 2QEXP 4BPHA 3U43A 4U0FA 2M8NA 2VLNA 2N5IA 2E1MA 1QRJA 2PNGA 1E6JP 2Z45A 2MD9A 1VQLP 4MRTC 1YITP 2BHVA 4NEOA 2AVAA 3GJNA 2KOPA 4PWVB 1VHNA 1OR5A 2NO8A 3H0DA 1MZ8A 3EJBA 1L0IA 2EHTA 2EG5A 2KG9A 1VQ5P 5HGMA 1T8KA 5KP7B 1FR2A 1E0HA 3G6EP 2FVEA 2PEQA 2AFEA 1A8OA 5F2KA 2AFDA 1QVFO 2LPKA 3B4QA 3G71P 4IPYA 2LL8A 2L4BA 2FQ0A 5BS2A 3DS1A 3CD6P 2Z44A 2K0DX 4GR2A 3LRYA 1M6NA 1M6EX 3EJEA 2OARA 2JGPA 3G29A 2OTJP 2PEIA 2XZ1C 1N8RQ 2KG8A 5EW5E 2P9XA 2EFJA 3EJDA 1VQ8P 1M74A 2MR7A 1VQ4P 1AUMA 3I56P 1RNIA 1AYIA 1UJZA 2GZIA 1UNKA 2K94A 5HGLA 2XZ0D 5HGOA 1M90Q 2JYLA 4H2YC 2LIUA 3P05A 4GR6A 4R0MA 4UHPB 3CMAP 5KP6B 1BXIA 3CCSP 4COPA 1F80D 3DS3A 2VLQA 2JU1A 3CCVP 1VQPP 2N6ZA 3H4EA 2FAEA 1EIAA 7CEIA 4QNBA 4BPFA 4PH0A 2VLPA 1VQ6P 4U0CA 5I4TG 1KD1Q 3Q20A 5BS1A 2KW2A 2N50A 3WBHA 3CCEP 1YI2P 1Q7YQ 1Q82Q 4F37A 3MGEA 2DGYA 4U0BA 2CNRA 2FQ2A 2JAZA 1W2BO 4PH1A 3NY7B 2KODA 4XFZA 2FACA 2LTEA 5DCKA 1GXHA 2JU2A 3GKLC 2M8LA 3RG2A 2MR8A 2GZFA 4U0EA 1QVGO 2JO0A 2CWOA 3LMOA 2VSQA 3CCMP 2FVAA 5EJDA 1BAJA 3G21A 2EIAA 1Q81Q 2CG5B 5JPAA 2Z46A 2OTLP 2FHSC 1M1KQ 2GYKA 1CEIA 3G1IA 3CE7A 4XROA 2KOOA 2LKIA 2JB0A 1EOQA 2ONTA 2LIWA 2LMLA 5F2OA 2BUOA 2GZGA 3CCLP 2GDYA 3CXCO 1HY8A 2KOQA 1DNYA 1KC8Q 1GXGA 3GZLA 1VQNP 4CA3A 5F2NA 4DG9A 2LOLA 3CC4P 2FQ1A 2K0YA 3CC2P 2ERHA 3CCRP 4M0IA 3CCJP 2EHSA 4WYMA 5HGNA 2N98A 3G0VA 5HVCA 1ACPA 1JJ2O 2CQ8A 4H2XC 4XFYA 4HKGA 2N6YA 1VQOP 2N5HA 2JYGA 1NJIQ 2MVVA 1NQ4A 5KP8B 4H2WC 4COCA 5HV8A 1ZNVA 2KR5A 2L22A 1VKUA 2M5RA 2K0XA 3DS2A 1VQMP 2PENA 3CCQP 2GDWA 3I55P 1GPJA 1X3OA 3G28A 3G26A 1RO2A 2KOSA 3DS5A 4PXHB 1VQKP 2K5XA 3CCUP 2PEOA 2QA4P 1K8AQ 1YJNP 3M1MA 2KGEA 2CGQA 1S72P 3GZMA 2L6EA 2M8PA 1IMQA 3CMEP 3B5IA 1IUQA 3DS4A 1RO0A 1YJ9P 4XFXA 2VLOA 1YIJP 2K92A 2ROQA 2PY8A 2KGCA 2JBGA 3DS0A 1K9MQ 2GZEA 1EMVA 2GZJA 2KG6A 3G4SP 2QNWA 1YJWP 4QKOA 1D1DA 2DNWA 1AF8A 1A43A 4XRQA 1DV5A 2FVFA 3H47A 2K2QA 4U0AA 1KLPA 2MVUA 3E2DA 2JQ4A 2PEKA 2PEJA 1K30A 2L0QA 2LF4A 3CPWO 2FADA 1Z6MA 2KGDA 2KORA 3HYBA 3CC7P 2WPTA 1ZMBA 3VRLC 2XT1A 1VQ7P 2MY5A 3G1GA 1KQSO 1L0HA 2K93A 3DPHA 2KGAA 3NTEA 2MF4A 2XV6A 2PEMA 1Q86Q 2GDXA 2X2BA 2KWLA 3DTJA 4BPGA 1IMPA 3OW2O 2L9FA 4U0DA 3RG6C
chains in the Genus database with same CATH topology
2XXMA 3G28A 4U0EA 1QVGO 1YHQP 3G26A 2JO0A 2P9XA 2CWOA 1RO2A 2EFJA 1VQ9P 3DS5A 1VQKP 1VQ8P 3CCUP 2PEOA 3CCMP 2QA4P 1K8AQ 1BAJA 3M1MA 1YJNP 1M74A 1VQ4P 1AUMA 3I56P 1K73Q 1S72P 1RNIA 3G21A 2L6EA 2M8PA 3HZQA 3CMEP 2QEXP 2EIAA 1IUQA 3B5IA 3DS4A 1Q81Q 1RO0A 1YJ9P 4XFXA 5JPAA 2Z46A 2OTLP 4U0FA 2M8NA 5HGLA 1M1KQ 1YIJP 3G1IA 4XROA 5HGOA 2E1MA 1QRJA 1EOQA 1M90Q 2JYLA 2PY8A 2ONTA 3DS0A 1E6JP 1K9MQ 3P05A 4GR6A 5F2OA 2BUOA 3CCLP 2Z45A 1VQLP 3CXCO 3CMAP 3G4SP 3CCSP 1KC8Q 4COPA 1YJWP 1YITP 3DS3A 2BHVA 5F2NA 1VQNP 3CCVP 1VQPP 1D1DA 3H4EA 1EIAA 1A43A 4QNBA 4PH0A 3CC4P 4XRQA 1VQ6P 4U0CA 3H0DA 3H47A 4U0AA 3E2DA 2EG5A 5I4TG 1KD1Q 1VQ5P 2PEKA 3Q20A 3CC2P 5BS1A 2PEJA 1K30A 5HGMA 2LF4A 3CPWO 3CCRP 4M0IA 3WBHA 3CCEP 3CCJP 4WYMA 5HGNA 3G6EP 2PEQA 1YI2P 1Q7YQ 3G0VA 1Q82Q 1A8OA 5F2KA 3HYBA 1QVFO 3CC7P 1JJ2O 3G71P 4IPYA 4XFYA 3MGEA 2DGYA 5BS2A 3DS1A 4U0BA 1ZMBA 3CD6P 2Z44A 3VRLC 1VQOP 2JYGA 1NJIQ 4GR2A 1W2BO 2XT1A 1VQ7P 3G1GA 3LRYA 1M6NA 1KQSO 4PH1A 4COCA 2KODA 4XFZA 3DPHA 3NTEA 1M6EX 2OARA 2XV6A 2PEMA 3G29A 1Q86Q 3DS2A 1VQMP 2OTJP 3DTJA 5DCKA 2PENA 3OW2O 3CCQP 2PEIA 4U0DA 1N8RQ 3I55P 3RG6C 2M8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEN A;  2Z44 A;  5BS1 A;  2PEJ A;  2PEI A;  4GR6 A;  2PEQ A;  2PEM A;  2Z46 A;  3HYB A;  4GR2 A;  3RG6 C;  2Z45 A;  2PEO A;  2PY8 A;  5BS2 A;  2PEK A;  3Q20 A; 
#chains in the Genus database with same CATH topology
 2XXM A;  1YHQ P;  1HQB A;  1VQ9 P;  4IZ6 A;  5CZD B;  2AF8 A;  1K73 Q;  3HZQ A;  2QEX P;  4BPH A;  3U43 A;  4U0F A;  2M8N A;  2VLN A;  2N5I A;  2E1M A;  1QRJ A;  2PNG A;  1E6J P;  2Z45 A;  2MD9 A;  1VQL P;  4MRT C;  1YIT P;  2BHV A;  4NEO A;  2AVA A;  3GJN A;  2KOP A;  4PWV B;  1VHN A;  1OR5 A;  2NO8 A;  3H0D A;  1MZ8 A;  3EJB A;  1L0I A;  2EHT A;  2EG5 A;  2KG9 A;  1VQ5 P;  5HGM A;  1T8K A;  5KP7 B;  1FR2 A;  1E0H A;  3G6E P;  2FVE A;  2PEQ A;  2AFE A;  1A8O A;  5F2K A;  2AFD A;  1QVF O;  2LPK A;  3B4Q A;  3G71 P;  4IPY A;  2LL8 A;  2L4B A;  2FQ0 A;  5BS2 A;  3DS1 A;  3CD6 P;  2Z44 A;  2K0D X;  4GR2 A;  3LRY A;  1M6N A;  1M6E X;  3EJE A;  2OAR A;  2JGP A;  3G29 A;  2OTJ P;  2PEI A;  2XZ1 C;  1N8R Q;  2KG8 A;  5EW5 E;  2P9X A;  2EFJ A;  3EJD A;  1VQ8 P;  1M74 A;  2MR7 A;  1VQ4 P;  1AUM A;  3I56 P;  1RNI A;  1AYI A;  1UJZ A;  2GZI A;  1UNK A;  2K94 A;  5HGL A;  2XZ0 D;  5HGO A;  1M90 Q;  2JYL A;  4H2Y C;  2LIU A;  3P05 A;  4GR6 A;  4R0M A;  4UHP B;  3CMA P;  5KP6 B;  1BXI A;  3CCS P;  4COP A;  1F80 D;  3DS3 A;  2VLQ A;  2JU1 A;  3CCV P;  1VQP P;  2N6Z A;  3H4E A;  2FAE A;  1EIA A;  7CEI A;  4QNB A;  4BPF A;  4PH0 A;  2VLP A;  1VQ6 P;  4U0C A;  5I4T G;  1KD1 Q;  3Q20 A;  5BS1 A;  2KW2 A;  2N50 A;  3WBH A;  3CCE P;  1YI2 P;  1Q7Y Q;  1Q82 Q;  4F37 A;  3MGE A;  2DGY A;  4U0B A;  2CNR A;  2FQ2 A;  2JAZ A;  1W2B O;  4PH1 A;  3NY7 B;  2KOD A;  4XFZ A;  2FAC A;  2LTE A;  5DCK A;  1GXH A;  2JU2 A;  3GKL C;  2M8L A;  3RG2 A;  2MR8 A;  2GZF A;  4U0E A;  1QVG O;  2JO0 A;  2CWO A;  3LMO A;  2VSQ A;  3CCM P;  2FVA A;  5EJD A;  1BAJ A;  3G21 A;  2EIA A;  1Q81 Q;  2CG5 B;  5JPA A;  2Z46 A;  2OTL P;  2FHS C;  1M1K Q;  2GYK A;  1CEI A;  3G1I A;  3CE7 A;  4XRO A;  2KOO A;  2LKI A;  2JB0 A;  1EOQ A;  2ONT A;  2LIW A;  2LML A;  5F2O A;  2BUO A;  2GZG A;  3CCL P;  2GDY A;  3CXC O;  1HY8 A;  2KOQ A;  1DNY A;  1KC8 Q;  1GXG A;  3GZL A;  1VQN P;  4CA3 A;  5F2N A;  4DG9 A;  2LOL A;  3CC4 P;  2FQ1 A;  2K0Y A;  3CC2 P;  2ERH A;  3CCR P;  4M0I A;  3CCJ P;  2EHS A;  4WYM A;  5HGN A;  2N98 A;  3G0V A;  5HVC A;  1ACP A;  1JJ2 O;  2CQ8 A;  4H2X C;  4XFY A;  4HKG A;  2N6Y A;  1VQO P;  2N5H A;  2JYG A;  1NJI Q;  2MVV A;  1NQ4 A;  5KP8 B;  4H2W C;  4COC A;  5HV8 A;  1ZNV A;  2KR5 A;  2L22 A;  1VKU A;  2M5R A;  2K0X A;  3DS2 A;  1VQM P;  2PEN A;  3CCQ P;  2GDW A;  3I55 P;  1GPJ A;  1X3O A;  3G28 A;  3G26 A;  1RO2 A;  2KOS A;  3DS5 A;  4PXH B;  1VQK P;  2K5X A;  3CCU P;  2PEO A;  2QA4 P;  1K8A Q;  1YJN P;  3M1M A;  2KGE A;  2CGQ A;  1S72 P;  3GZM A;  2L6E A;  2M8P A;  1IMQ A;  3CME P;  3B5I A;  1IUQ A;  3DS4 A;  1RO0 A;  1YJ9 P;  4XFX A;  2VLO A;  1YIJ P;  2K92 A;  2ROQ A;  2PY8 A;  2KGC A;  2JBG A;  3DS0 A;  1K9M Q;  2GZE A;  1EMV A;  2GZJ A;  2KG6 A;  3G4S P;  2QNW A;  1YJW P;  4QKO A;  1D1D A;  2DNW A;  1AF8 A;  1A43 A;  4XRQ A;  1DV5 A;  2FVF A;  3H47 A;  2K2Q A;  4U0A A;  1KLP A;  2MVU A;  3E2D A;  2JQ4 A;  2PEK A;  2PEJ A;  1K30 A;  2L0Q A;  2LF4 A;  3CPW O;  2FAD A;  1Z6M A;  2KGD A;  2KOR A;  3HYB A;  3CC7 P;  2WPT A;  1ZMB A;  3VRL C;  2XT1 A;  1VQ7 P;  2MY5 A;  3G1G A;  1KQS O;  1L0H A;  2K93 A;  3DPH A;  2KGA A;  3NTE A;  2MF4 A;  2XV6 A;  2PEM A;  1Q86 Q;  2GDX A;  2X2B A;  2KWL A;  3DTJ A;  4BPG A;  1IMP A;  3OW2 O;  2L9F A;  4U0D A;  3RG6 C; 
#chains in the Genus database with same CATH homology
 2XXM A;  3G28 A;  4U0E A;  1QVG O;  1YHQ P;  3G26 A;  2JO0 A;  2P9X A;  2CWO A;  1RO2 A;  2EFJ A;  1VQ9 P;  3DS5 A;  1VQK P;  1VQ8 P;  3CCU P;  2PEO A;  3CCM P;  2QA4 P;  1K8A Q;  1BAJ A;  3M1M A;  1YJN P;  1M74 A;  1VQ4 P;  1AUM A;  3I56 P;  1K73 Q;  1S72 P;  1RNI A;  3G21 A;  2L6E A;  2M8P A;  3HZQ A;  3CME P;  2QEX P;  2EIA A;  1IUQ A;  3B5I A;  3DS4 A;  1Q81 Q;  1RO0 A;  1YJ9 P;  4XFX A;  5JPA A;  2Z46 A;  2OTL P;  4U0F A;  2M8N A;  5HGL A;  1M1K Q;  1YIJ P;  3G1I A;  4XRO A;  5HGO A;  2E1M A;  1QRJ A;  1EOQ A;  1M90 Q;  2JYL A;  2PY8 A;  2ONT A;  3DS0 A;  1E6J P;  1K9M Q;  3P05 A;  4GR6 A;  5F2O A;  2BUO A;  3CCL P;  2Z45 A;  1VQL P;  3CXC O;  3CMA P;  3G4S P;  3CCS P;  1KC8 Q;  4COP A;  1YJW P;  1YIT P;  3DS3 A;  2BHV A;  5F2N A;  1VQN P;  3CCV P;  1VQP P;  1D1D A;  3H4E A;  1EIA A;  1A43 A;  4QNB A;  4PH0 A;  3CC4 P;  4XRQ A;  1VQ6 P;  4U0C A;  3H0D A;  3H47 A;  4U0A A;  3E2D A;  2EG5 A;  5I4T G;  1KD1 Q;  1VQ5 P;  2PEK A;  3Q20 A;  3CC2 P;  5BS1 A;  2PEJ A;  1K30 A;  5HGM A;  2LF4 A;  3CPW O;  3CCR P;  4M0I A;  3WBH A;  3CCE P;  3CCJ P;  4WYM A;  5HGN A;  3G6E P;  2PEQ A;  1YI2 P;  1Q7Y Q;  3G0V A;  1Q82 Q;  1A8O A;  5F2K A;  3HYB A;  1QVF O;  3CC7 P;  1JJ2 O;  3G71 P;  4IPY A;  4XFY A;  3MGE A;  2DGY A;  5BS2 A;  3DS1 A;  4U0B A;  1ZMB A;  3CD6 P;  2Z44 A;  3VRL C;  1VQO P;  2JYG A;  1NJI Q;  4GR2 A;  1W2B O;  2XT1 A;  1VQ7 P;  3G1G A;  3LRY A;  1M6N A;  1KQS O;  4PH1 A;  4COC A;  2KOD A;  4XFZ A;  3DPH A;  3NTE A;  1M6E X;  2OAR A;  2XV6 A;  2PEM A;  3G29 A;  1Q86 Q;  3DS2 A;  1VQM P;  2OTJ P;  3DTJ A;  5DCK A;  2PEN A;  3OW2 O;  3CCQ P;  2PEI A;  4U0D A;  1N8R Q;  3I55 P;  3RG6 C;  2M8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...