4GR2A

Structure of atrbcx1 from arabidopsis thaliana.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
110
structure length
110
Chain Sequence
EASPEAKAAKHLHDFFTYVAVRIVSAQLESYNPEAYMELREFLDTNSVSDGDKFLATLMRRSSRHMNLALRILEVRSAYAKNDFEWDNMKRLAFKNVDDSNTRLMREYVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AtRbcX1
publication title Insights into eukaryotic Rubisco assembly - Crystal structures of RbcX chaperones from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Chaperone
total genus 45
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4gr2A00
2PENA 2PY8A 5BS1A 3HYBA 2PEIA 2Z45A 3Q20A 2Z46A 2PEMA 4GR2A 2PEOA 3RG6C 2Z44A 2PEQA 4GR6A 2PEJA 5BS2A 2PEKA
chains in the Genus database with same CATH superfamily
2JBGA 5F2OA 3CCJP 1S72P 1M6NA 3CCQP 2PEKA 3EJDA 1IMPA 1M90Q 1JJ2O 1EOQA 1YIJP 2K92A 2KGDA 1AYIA 3DS2A 4BPHA 2L6EA 1YHQP 4CA3A 3GKLC 2MVVA 2K0XA 4MRTC 2LOLA 2JYLA 4R0MA 1NQ4A 2XXMA 3G0VA 2KGAA 3RG2A 2N6YA 2AVAA 1ACPA 3CCSP 2LKIA 1GXHA 2CG5B 3CPWO 2LIUA 2JU1A 2BHVA 5CZDB 2K94A 2MVUA 2FAEA 4IPYA 2Z45A 1FR2A 4U0DA 3H0DA 3HYBA 5HGLA 2FVAA 2KW2A 2K0YA 3P05A 2LL8A 2XT1A 1VQLP 2GZIA 4M0IA 2AF8A 3B4QA 7CEIA 1YJNP 2L9FA 2PENA 4COCA 1K30A 2GYKA 3DS1A 1HQBA 2JU2A 1D1DA 5HGOA 3G28A 5HV8A 4BPGA 4HKGA 2NO8A 2KG9A 1N8RQ 3G29A 2DNWA 2GDXA 3DPHA 5HGMA 3G26A 5DCKA 3LMOA 3G21A 2N6ZA 4WYMA 1GXGA 2VLQA 2JGPA 1Z6MA 2L22A 4GR2A 4PH1A 2PEMA 2EFJA 4GR6A 2K93A 1VQPP 2FVEA 5F2KA 1KD1Q 2M5RA 4U0CA 3VRLC 2JAZA 1M74A 2PEOA 4H2XC 4U0EA 5F2NA 2FQ1A 4QNBA 2XZ0D 3G1IA 4XFXA 1Q82Q 3G4SP 2K0DX 1IUQA 5KP6B 1A43A 3DS5A 2GDWA 1QVFO 2FQ0A 2XZ1C 3I55P 1RO2A 3Q20A 2P9XA 3MGEA 2M8NA 1IMQA 5EW5E 3EJBA 1QRJA 2MR7A 3CC4P 2FQ2A 2LMLA 1T8KA 2E1MA 2LPKA 5EJDA 4U0AA 2K5XA 2KWLA 5KP8B 1F80D 1UNKA 2BUOA 1YJ9P 2N5HA 2PY8A 1QVGO 3H47A 1VQ4P 2WPTA 1KQSO 1ZNVA 4PXHB 4BPFA 1L0HA 1E6JP 2DGYA 1VQNP 3GZMA 1CEIA 4COPA 3LRYA 1VQ9P 3CC2P 3CXCO 4DG9A 1OR5A 1VQKP 1VKUA 3CCUP 2OARA 4PH0A 2FADA 3I56P 2EHSA 1W2BO 4QKOA 2CGQA 4IZ6A 3DS3A 2FACA 3CMAP 3H4EA 2CNRA 4H2YC 2KOQA 1Q7YQ 2QEXP 1UJZA 4U0BA 2PEIA 3CCVP 2JB0A 4UHPB 3G1GA 3DS0A 1L0IA 4XRQA 2AFDA 1Q81Q 2KODA 2ROQA 3CCEP 2JO0A 2CWOA 3M1MA 2MY5A 3CCLP 2X2BA 3CMEP 2KOPA 2KR5A 5JPAA 5HVCA 1AF8A 1GPJA 3CCMP 2L4BA 1X3OA 1A8OA 3DS4A 2QNWA 5I4TG 1BXIA 2L0QA 3EJEA 3CC7P 3U43A 2M8LA 1DV5A 2M8PA 4XFZA 1VHNA 2PEQA 1K8AQ 2CQ8A 2VLOA 1ZMBA 1KC8Q 2JYGA 1K9MQ 1EMVA 2GDYA 3GZLA 3G71P 1RO0A 2AFEA 2ONTA 3HZQA 4U0FA 1DNYA 3B5IA 5BS1A 2KGEA 2GZFA 1HY8A 3RG6C 1YI2P 2EHTA 2XV6A 2MR8A 4NEOA 2KG6A 2FHSC 1EIAA 1NJIQ 1VQOP 2VLNA 1K73Q 1VQ6P 1MZ8A 5KP7B 2LIWA 2KG8A 4XFYA 2KORA 1VQMP 2KOSA 1VQ7P 1Q86Q 2VLPA 1RNIA 2OTJP 2PNGA 2PEJA 2KGCA 2LF4A 2QA4P 2Z46A 2OTLP 2GZJA 3CE7A 2ERHA 2MF4A 3DTJA 1VQ8P 2FVFA 1AUMA 5BS2A 2VSQA 3OW2O 2N50A 2GZGA 3GJNA 3NY7B 4F37A 1BAJA 2N98A 2GZEA 1VQ5P 1E0HA 2N5IA 3WBHA 4PWVB 2K2QA 2EG5A 1M6EX 2Z44A 3CCRP 1YJWP 2MD9A 1YITP 3G6EP 3NTEA 2KOOA 4H2WC 5HGNA 1M1KQ 1KLPA 2EIAA 3E2DA 2LTEA 3CD6P 4XROA 2JQ4A
chains in the Genus database with same CATH topology
4COPA 2XV6A 5F2OA 3CCJP 3LRYA 1VQ9P 4WYMA 1S72P 3CXCO 3CC2P 1M6NA 3CCQP 1VQKP 2PEKA 3CCUP 1EIAA 2OARA 4PH0A 1NJIQ 1M90Q 1VQOP 1JJ2O 1EOQA 1K73Q 1YIJP 3I56P 4GR2A 4PH1A 2PEMA 3DS2A 2EFJA 1W2BO 4GR6A 1VQ6P 2L6EA 1YHQP 4XFYA 1VQPP 3DS3A 5F2KA 1KD1Q 4U0CA 3VRLC 3CMAP 1VQMP 2JYLA 1M74A 1VQ7P 2XXMA 3G0VA 3H4EA 2PEOA 1Q86Q 4U0EA 5F2NA 1RNIA 1Q7YQ 2QEXP 2OTJP 2PEJA 4QNBA 4U0BA 1VQNP 2LF4A 2PEIA 2QA4P 3CCVP 2Z46A 3G1IA 4XFXA 3CCSP 3G1GA 1Q82Q 3DS0A 2OTLP 3CPWO 4XRQA 3G4SP 1IUQA 2BHVA 1Q81Q 1A43A 3DS5A 1QVFO 2KODA 3DTJA 1VQ8P 1AUMA 3CCEP 5BS2A 3I55P 3OW2O 2JO0A 4IPYA 1RO2A 3Q20A 2Z45A 2CWOA 3M1MA 2P9XA 3MGEA 4U0DA 3CCLP 2M8NA 3CMEP 3H0DA 5JPAA 3HYBA 3CCMP 5HGLA 1BAJA 1A8OA 1VQ5P 3DS4A 5I4TG 3CC7P 1QRJA 3P05A 2M8LA 2XT1A 3WBHA 2M8PA 1VQLP 4M0IA 4XFZA 2PEQA 3CC4P 1YJNP 1K8AQ 2PENA 4COCA 2EG5A 1ZMBA 2E1MA 1K30A 1KC8Q 1M6EX 2Z44A 4U0AA 3DS1A 3CCRP 1YJWP 2JYGA 1K9MQ 1D1DA 5HGOA 3G28A 2BUOA 1YITP 1YJ9P 3G6EP 3G71P 1RO0A 3NTEA 1N8RQ 2PY8A 1QVGO 2ONTA 3G29A 3H47A 3HZQA 4U0FA 1VQ4P 3B5IA 1KQSO 5BS1A 5HGNA 1M1KQ 3DPHA 2EIAA 3E2DA 5HGMA 1E6JP 3G26A 3RG6C 3CD6P 4XROA 5DCKA 2DGYA 1YI2P 3G21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEN A;  2PY8 A;  5BS1 A;  3HYB A;  2PEI A;  2Z45 A;  3Q20 A;  2Z46 A;  2PEM A;  4GR2 A;  2PEO A;  3RG6 C;  2Z44 A;  2PEQ A;  4GR6 A;  2PEJ A;  5BS2 A;  2PEK A; 
#chains in the Genus database with same CATH topology
 2JBG A;  5F2O A;  3CCJ P;  1S72 P;  1M6N A;  3CCQ P;  2PEK A;  3EJD A;  1IMP A;  1M90 Q;  1JJ2 O;  1EOQ A;  1YIJ P;  2K92 A;  2KGD A;  1AYI A;  3DS2 A;  4BPH A;  2L6E A;  1YHQ P;  4CA3 A;  3GKL C;  2MVV A;  2K0X A;  4MRT C;  2LOL A;  2JYL A;  4R0M A;  1NQ4 A;  2XXM A;  3G0V A;  2KGA A;  3RG2 A;  2N6Y A;  2AVA A;  1ACP A;  3CCS P;  2LKI A;  1GXH A;  2CG5 B;  3CPW O;  2LIU A;  2JU1 A;  2BHV A;  5CZD B;  2K94 A;  2MVU A;  2FAE A;  4IPY A;  2Z45 A;  1FR2 A;  4U0D A;  3H0D A;  3HYB A;  5HGL A;  2FVA A;  2KW2 A;  2K0Y A;  3P05 A;  2LL8 A;  2XT1 A;  1VQL P;  2GZI A;  4M0I A;  2AF8 A;  3B4Q A;  7CEI A;  1YJN P;  2L9F A;  2PEN A;  4COC A;  1K30 A;  2GYK A;  3DS1 A;  1HQB A;  2JU2 A;  1D1D A;  5HGO A;  3G28 A;  5HV8 A;  4BPG A;  4HKG A;  2NO8 A;  2KG9 A;  1N8R Q;  3G29 A;  2DNW A;  2GDX A;  3DPH A;  5HGM A;  3G26 A;  5DCK A;  3LMO A;  3G21 A;  2N6Z A;  4WYM A;  1GXG A;  2VLQ A;  2JGP A;  1Z6M A;  2L22 A;  4GR2 A;  4PH1 A;  2PEM A;  2EFJ A;  4GR6 A;  2K93 A;  1VQP P;  2FVE A;  5F2K A;  1KD1 Q;  2M5R A;  4U0C A;  3VRL C;  2JAZ A;  1M74 A;  2PEO A;  4H2X C;  4U0E A;  5F2N A;  2FQ1 A;  4QNB A;  2XZ0 D;  3G1I A;  4XFX A;  1Q82 Q;  3G4S P;  2K0D X;  1IUQ A;  5KP6 B;  1A43 A;  3DS5 A;  2GDW A;  1QVF O;  2FQ0 A;  2XZ1 C;  3I55 P;  1RO2 A;  3Q20 A;  2P9X A;  3MGE A;  2M8N A;  1IMQ A;  5EW5 E;  3EJB A;  1QRJ A;  2MR7 A;  3CC4 P;  2FQ2 A;  2LML A;  1T8K A;  2E1M A;  2LPK A;  5EJD A;  4U0A A;  2K5X A;  2KWL A;  5KP8 B;  1F80 D;  1UNK A;  2BUO A;  1YJ9 P;  2N5H A;  2PY8 A;  1QVG O;  3H47 A;  1VQ4 P;  2WPT A;  1KQS O;  1ZNV A;  4PXH B;  4BPF A;  1L0H A;  1E6J P;  2DGY A;  1VQN P;  3GZM A;  1CEI A;  4COP A;  3LRY A;  1VQ9 P;  3CC2 P;  3CXC O;  4DG9 A;  1OR5 A;  1VQK P;  1VKU A;  3CCU P;  2OAR A;  4PH0 A;  2FAD A;  3I56 P;  2EHS A;  1W2B O;  4QKO A;  2CGQ A;  4IZ6 A;  3DS3 A;  2FAC A;  3CMA P;  3H4E A;  2CNR A;  4H2Y C;  2KOQ A;  1Q7Y Q;  2QEX P;  1UJZ A;  4U0B A;  2PEI A;  3CCV P;  2JB0 A;  4UHP B;  3G1G A;  3DS0 A;  1L0I A;  4XRQ A;  2AFD A;  1Q81 Q;  2KOD A;  2ROQ A;  3CCE P;  2JO0 A;  2CWO A;  3M1M A;  2MY5 A;  3CCL P;  2X2B A;  3CME P;  2KOP A;  2KR5 A;  5JPA A;  5HVC A;  1AF8 A;  1GPJ A;  3CCM P;  2L4B A;  1X3O A;  1A8O A;  3DS4 A;  2QNW A;  5I4T G;  1BXI A;  2L0Q A;  3EJE A;  3CC7 P;  3U43 A;  2M8L A;  1DV5 A;  2M8P A;  4XFZ A;  1VHN A;  2PEQ A;  1K8A Q;  2CQ8 A;  2VLO A;  1ZMB A;  1KC8 Q;  2JYG A;  1K9M Q;  1EMV A;  2GDY A;  3GZL A;  3G71 P;  1RO0 A;  2AFE A;  2ONT A;  3HZQ A;  4U0F A;  1DNY A;  3B5I A;  5BS1 A;  2KGE A;  2GZF A;  1HY8 A;  3RG6 C;  1YI2 P;  2EHT A;  2XV6 A;  2MR8 A;  4NEO A;  2KG6 A;  2FHS C;  1EIA A;  1NJI Q;  1VQO P;  2VLN A;  1K73 Q;  1VQ6 P;  1MZ8 A;  5KP7 B;  2LIW A;  2KG8 A;  4XFY A;  2KOR A;  1VQM P;  2KOS A;  1VQ7 P;  1Q86 Q;  2VLP A;  1RNI A;  2OTJ P;  2PNG A;  2PEJ A;  2KGC A;  2LF4 A;  2QA4 P;  2Z46 A;  2OTL P;  2GZJ A;  3CE7 A;  2ERH A;  2MF4 A;  3DTJ A;  1VQ8 P;  2FVF A;  1AUM A;  5BS2 A;  2VSQ A;  3OW2 O;  2N50 A;  2GZG A;  3GJN A;  3NY7 B;  4F37 A;  1BAJ A;  2N98 A;  2GZE A;  1VQ5 P;  1E0H A;  2N5I A;  3WBH A;  4PWV B;  2K2Q A;  2EG5 A;  1M6E X;  2Z44 A;  3CCR P;  1YJW P;  2MD9 A;  1YIT P;  3G6E P;  3NTE A;  2KOO A;  4H2W C;  5HGN A;  1M1K Q;  1KLP A;  2EIA A;  3E2D A;  2LTE A;  3CD6 P;  4XRO A;  2JQ4 A; 
#chains in the Genus database with same CATH homology
 4COP A;  2XV6 A;  5F2O A;  3CCJ P;  3LRY A;  1VQ9 P;  4WYM A;  1S72 P;  3CXC O;  3CC2 P;  1M6N A;  3CCQ P;  1VQK P;  2PEK A;  3CCU P;  1EIA A;  2OAR A;  4PH0 A;  1NJI Q;  1M90 Q;  1VQO P;  1JJ2 O;  1EOQ A;  1K73 Q;  1YIJ P;  3I56 P;  4GR2 A;  4PH1 A;  2PEM A;  3DS2 A;  2EFJ A;  1W2B O;  4GR6 A;  1VQ6 P;  2L6E A;  1YHQ P;  4XFY A;  1VQP P;  3DS3 A;  5F2K A;  1KD1 Q;  4U0C A;  3VRL C;  3CMA P;  1VQM P;  2JYL A;  1M74 A;  1VQ7 P;  2XXM A;  3G0V A;  3H4E A;  2PEO A;  1Q86 Q;  4U0E A;  5F2N A;  1RNI A;  1Q7Y Q;  2QEX P;  2OTJ P;  2PEJ A;  4QNB A;  4U0B A;  1VQN P;  2LF4 A;  2PEI A;  2QA4 P;  3CCV P;  2Z46 A;  3G1I A;  4XFX A;  3CCS P;  3G1G A;  1Q82 Q;  3DS0 A;  2OTL P;  3CPW O;  4XRQ A;  3G4S P;  1IUQ A;  2BHV A;  1Q81 Q;  1A43 A;  3DS5 A;  1QVF O;  2KOD A;  3DTJ A;  1VQ8 P;  1AUM A;  3CCE P;  5BS2 A;  3I55 P;  3OW2 O;  2JO0 A;  4IPY A;  1RO2 A;  3Q20 A;  2Z45 A;  2CWO A;  3M1M A;  2P9X A;  3MGE A;  4U0D A;  3CCL P;  2M8N A;  3CME P;  3H0D A;  5JPA A;  3HYB A;  3CCM P;  5HGL A;  1BAJ A;  1A8O A;  1VQ5 P;  3DS4 A;  5I4T G;  3CC7 P;  1QRJ A;  3P05 A;  2M8L A;  2XT1 A;  3WBH A;  2M8P A;  1VQL P;  4M0I A;  4XFZ A;  2PEQ A;  3CC4 P;  1YJN P;  1K8A Q;  2PEN A;  4COC A;  2EG5 A;  1ZMB A;  2E1M A;  1K30 A;  1KC8 Q;  1M6E X;  2Z44 A;  4U0A A;  3DS1 A;  3CCR P;  1YJW P;  2JYG A;  1K9M Q;  1D1D A;  5HGO A;  3G28 A;  2BUO A;  1YIT P;  1YJ9 P;  3G6E P;  3G71 P;  1RO0 A;  3NTE A;  1N8R Q;  2PY8 A;  1QVG O;  2ONT A;  3G29 A;  3H47 A;  3HZQ A;  4U0F A;  1VQ4 P;  3B5I A;  1KQS O;  5BS1 A;  5HGN A;  1M1K Q;  3DPH A;  2EIA A;  3E2D A;  5HGM A;  1E6J P;  3G26 A;  3RG6 C;  3CD6 P;  4XRO A;  5DCK A;  2DGY A;  1YI2 P;  3G21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...