4GR2A

Structure of atrbcx1 from arabidopsis thaliana.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
110
structure length
110
Chain Sequence
EASPEAKAAKHLHDFFTYVAVRIVSAQLESYNPEAYMELREFLDTNSVSDGDKFLATLMRRSSRHMNLALRILEVRSAYAKNDFEWDNMKRLAFKNVDDSNTRLMREYVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into eukaryotic Rubisco assembly - Crystal structures of RbcX chaperones from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Chaperone
molecule keywords AtRbcX1
total genus 45
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4gr2A00
2Z44A 3RG6C 4GR6A 2PEIA 2PEQA 2Z46A 2Z45A 4GR2A 2PENA 5BS2A 2PY8A 5BS1A 3HYBA 2PEKA 2PEOA 3Q20A 2PEMA 2PEJA
chains in the Genus database with same CATH superfamily
1D1DA 3G1GA 3LMOA 2EHTA 2FQ2A 3Q20A 2KWLA 1EIAA 2FVAA 2AF8A 2VLPA 2GZIA 2KOPA 1AYIA 4XFZA 2GYKA 4IZ6A 4COCA 1OR5A 4WYMA 3CCUP 2MF4A 3P05A 2GDXA 2M5RA 4NEOA 4PH0A 2EHSA 1ZMBA 3RG2A 1DNYA 2JAZA 2LPKA 2L6EA 2PNGA 1A43A 1KQSO 2LMLA 2ERHA 2NO8A 1VQPP 3G29A 5HGOA 3MGEA 1Q7YQ 3G0VA 3CC4P 2LIWA 2KG9A 2CNRA 2CWOA 1YIJP 5BS2A 2LTEA 3VRLC 4GR6A 3M1MA 3DS2A 3DS1A 5EW5E 2ONTA 1E0HA 2GZFA 2ROQA 3DTJA 1HY8A 2CG5B 4XROA 4IPYA 1M74A 3GZMA 2GZGA 2XV6A 2KOOA 1S72P 1GPJA 2VLOA 1M90Q 2E1MA 1YJWP 2PEMA 1NQ4A 2K0XA 3EJDA 1QVFO 4MRTC 3G26A 5CZDB 2FVEA 3OW2O 3G28A 3CD6P 4U0FA 2KG8A 3CCJP 1F80D 2K0DX 3GKLC 5HGMA 3CXCO 2KGCA 1VHNA 3H4EA 3G6EP 2N50A 1VQMP 1MZ8A 1HQBA 2EFJA 1N8RQ 2OARA 4CA3A 2N5HA 2FVFA 4XFYA 2CGQA 5F2OA 5HGLA 2FAEA 1QRJA 1L0IA 2MR8A 2LOLA 2VLNA 2GZEA 2FQ0A 2P9XA 2PENA 1KD1Q 2QA4P 2MVVA 5HGNA 2KGDA 2FACA 1Z6MA 1RNIA 5F2KA 2N98A 2M8LA 1BXIA 4U0EA 1JJ2O 1YJNP 2FADA 4BPGA 3I55P 3CPWO 2BHVA 2BUOA 2MR7A 2KOSA 3CCEP 2CQ8A 4R0MA 2JYLA 3NTEA 2KG6A 1VQ7P 2KGEA 2N5IA 2KORA 4QNBA 1YJ9P 2LKIA 4H2YC 2GZJA 2K5XA 1VQ5P 3CCSP 3CCVP 1E6JP 1T8KA 4BPFA 1CEIA 3CMEP 2XT1A 1L0HA 3WBHA 3CCRP 1QVGO 2XZ0D 1UNKA 7CEIA 2XZ1C 3CMAP 3NY7B 2MD9A 2QNWA 2AVAA 2LF4A 2VLQA 2PEKA 3DPHA 1DV5A 3G71P 1UJZA 1VQLP 4BPHA 3E2DA 1VKUA 2DNWA 1M6EX 3RG6C 3CC2P 1YHQP 3B4QA 2VSQA 2K2QA 2GDYA 4M0IA 4XRQA 3EJBA 1W2BO 1K9MQ 4H2WC 2K93A 1RO2A 2KW2A 3CCLP 2LIUA 2Z45A 2N6YA 1AUMA 4DG9A 3G4SP 2Z44A 2K92A 1GXHA 1YI2P 3HYBA 2OTJP 2Z46A 1KLPA 2FQ1A 2X2BA 1A8OA 1VQ8P 2PEQA 3GZLA 5BS1A 2LL8A 3H0DA 5DCKA 2K94A 5KP7B 2PEIA 3G21A 3GJNA 2KGAA 3DS4A 3H47A 2K0YA 5F2NA 2MVUA 2MY5A 1NJIQ 1K8AQ 5EJDA 4COPA 2XXMA 3U43A 1GXGA 4PWVB 5JPAA 1Q81Q 1Q82Q 2JU1A 1Q86Q 1K30A 2GDWA 2JQ4A 1RO0A 2PEJA 2L0QA 2DGYA 1ACPA 2N6ZA 1VQNP 2M8PA 1FR2A 5KP6B 1VQ4P 4U0CA 2L9FA 2JYGA 2JB0A 2JBGA 4HKGA 1VQ6P 2M8NA 4H2XC 1EOQA 2L22A 2PEOA 4XFXA 1IMPA 2AFEA 4U0DA 2OTLP 1YITP 4UHPB 3DS5A 4U0AA 3EJEA 2EG5A 1ZNVA 1VQ9P 2L4BA 1EMVA 2WPTA 4GR2A 2PY8A 1AF8A 3DS3A 5HVCA 2FHSC 5I4TG 3B5IA 3DS0A 1IMQA 2JU2A 2JO0A 2KODA 1M6NA 4QKOA 4PXHB 2KR5A 5HV8A 3CCQP 2JGPA 3I56P 3HZQA 2AFDA 3G1IA 3CCMP 2KOQA 2QEXP 1IUQA 4PH1A 1VQKP 4F37A 1K73Q 5KP8B 1BAJA 3CC7P 4U0BA 1M1KQ 2EIAA 3CE7A 1X3OA 1KC8Q 3LRYA 1VQOP
chains in the Genus database with same CATH topology
2DGYA 3G28A 1VQNP 2M8PA 2LF4A 3CD6P 1D1DA 4U0FA 3G1GA 2PEKA 3DPHA 1VQ4P 4U0CA 3Q20A 3CCJP 1EIAA 5HGMA 2JYGA 3G71P 3CXCO 1VQ6P 3H4EA 1VQLP 4XFZA 2M8NA 3G6EP 1EOQA 3E2DA 1VQMP 2PEOA 4XFXA 4COCA 3RG6C 1M6EX 2EFJA 3CC2P 1N8RQ 4U0DA 1YHQP 2OARA 2OTLP 4WYMA 3CCUP 1YITP 4M0IA 3P05A 4XRQA 4PH0A 3DS5A 4U0AA 4XFYA 1ZMBA 5F2OA 5HGLA 1W2BO 1K9MQ 1QRJA 1RO2A 2EG5A 3CCLP 2Z45A 2P9XA 2L6EA 2PENA 1KD1Q 2QA4P 5HGNA 1AUMA 1A43A 3G4SP 1KQSO 1VQ9P 2Z44A 1RNIA 4GR2A 2PY8A 5F2KA 1YI2P 3HYBA 2M8LA 3DS3A 2OTJP 1VQPP 3G29A 5HGOA 2Z46A 3MGEA 1Q7YQ 3G0VA 4U0EA 1JJ2O 5I4TG 1A8OA 3CC4P 1VQ8P 3B5IA 2CWOA 2PEQA 1YIJP 5BS2A 3DS0A 1YJNP 3VRLC 2JO0A 3I55P 3CPWO 2KODA 2BHVA 1M6NA 2BUOA 4GR6A 3M1MA 3DS2A 3DS1A 3CCEP 2ONTA 2JYLA 5BS1A 3NTEA 3H0DA 1VQ7P 5DCKA 3CCQP 2PEIA 3G21A 3I56P 3HZQA 3DS4A 3DTJA 4QNBA 1YJ9P 3H47A 5F2NA 3G1IA 3CCMP 1NJIQ 1K8AQ 4COPA 4XROA 4IPYA 1M74A 2QEXP 2XXMA 1VQ5P 1IUQA 4PH1A 2XV6A 3CCSP 1E6JP 5JPAA 3CCVP 1K73Q 1VQKP 1S72P 1BAJA 3CMEP 1Q81Q 2XT1A 1M90Q 2E1MA 3CC7P 4U0BA 3WBHA 1YJWP 1Q82Q 1M1KQ 1Q86Q 2PEMA 2EIAA 1K30A 3CCRP 1QVGO 1KC8Q 1QVFO 1RO0A 3G26A 3LRYA 3CMAP 1VQOP 3OW2O 2PEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z44 A;  3RG6 C;  4GR6 A;  2PEI A;  2PEQ A;  2Z46 A;  2Z45 A;  4GR2 A;  2PEN A;  5BS2 A;  2PY8 A;  5BS1 A;  3HYB A;  2PEK A;  2PEO A;  3Q20 A;  2PEM A;  2PEJ A; 
#chains in the Genus database with same CATH topology
 1D1D A;  3G1G A;  3LMO A;  2EHT A;  2FQ2 A;  3Q20 A;  2KWL A;  1EIA A;  2FVA A;  2AF8 A;  2VLP A;  2GZI A;  2KOP A;  1AYI A;  4XFZ A;  2GYK A;  4IZ6 A;  4COC A;  1OR5 A;  4WYM A;  3CCU P;  2MF4 A;  3P05 A;  2GDX A;  2M5R A;  4NEO A;  4PH0 A;  2EHS A;  1ZMB A;  3RG2 A;  1DNY A;  2JAZ A;  2LPK A;  2L6E A;  2PNG A;  1A43 A;  1KQS O;  2LML A;  2ERH A;  2NO8 A;  1VQP P;  3G29 A;  5HGO A;  3MGE A;  1Q7Y Q;  3G0V A;  3CC4 P;  2LIW A;  2KG9 A;  2CNR A;  2CWO A;  1YIJ P;  5BS2 A;  2LTE A;  3VRL C;  4GR6 A;  3M1M A;  3DS2 A;  3DS1 A;  5EW5 E;  2ONT A;  1E0H A;  2GZF A;  2ROQ A;  3DTJ A;  1HY8 A;  2CG5 B;  4XRO A;  4IPY A;  1M74 A;  3GZM A;  2GZG A;  2XV6 A;  2KOO A;  1S72 P;  1GPJ A;  2VLO A;  1M90 Q;  2E1M A;  1YJW P;  2PEM A;  1NQ4 A;  2K0X A;  3EJD A;  1QVF O;  4MRT C;  3G26 A;  5CZD B;  2FVE A;  3OW2 O;  3G28 A;  3CD6 P;  4U0F A;  2KG8 A;  3CCJ P;  1F80 D;  2K0D X;  3GKL C;  5HGM A;  3CXC O;  2KGC A;  1VHN A;  3H4E A;  3G6E P;  2N50 A;  1VQM P;  1MZ8 A;  1HQB A;  2EFJ A;  1N8R Q;  2OAR A;  4CA3 A;  2N5H A;  2FVF A;  4XFY A;  2CGQ A;  5F2O A;  5HGL A;  2FAE A;  1QRJ A;  1L0I A;  2MR8 A;  2LOL A;  2VLN A;  2GZE A;  2FQ0 A;  2P9X A;  2PEN A;  1KD1 Q;  2QA4 P;  2MVV A;  5HGN A;  2KGD A;  2FAC A;  1Z6M A;  1RNI A;  5F2K A;  2N98 A;  2M8L A;  1BXI A;  4U0E A;  1JJ2 O;  1YJN P;  2FAD A;  4BPG A;  3I55 P;  3CPW O;  2BHV A;  2BUO A;  2MR7 A;  2KOS A;  3CCE P;  2CQ8 A;  4R0M A;  2JYL A;  3NTE A;  2KG6 A;  1VQ7 P;  2KGE A;  2N5I A;  2KOR A;  4QNB A;  1YJ9 P;  2LKI A;  4H2Y C;  2GZJ A;  2K5X A;  1VQ5 P;  3CCS P;  3CCV P;  1E6J P;  1T8K A;  4BPF A;  1CEI A;  3CME P;  2XT1 A;  1L0H A;  3WBH A;  3CCR P;  1QVG O;  2XZ0 D;  1UNK A;  7CEI A;  2XZ1 C;  3CMA P;  3NY7 B;  2MD9 A;  2QNW A;  2AVA A;  2LF4 A;  2VLQ A;  2PEK A;  3DPH A;  1DV5 A;  3G71 P;  1UJZ A;  1VQL P;  4BPH A;  3E2D A;  1VKU A;  2DNW A;  1M6E X;  3RG6 C;  3CC2 P;  1YHQ P;  3B4Q A;  2VSQ A;  2K2Q A;  2GDY A;  4M0I A;  4XRQ A;  3EJB A;  1W2B O;  1K9M Q;  4H2W C;  2K93 A;  1RO2 A;  2KW2 A;  3CCL P;  2LIU A;  2Z45 A;  2N6Y A;  1AUM A;  4DG9 A;  3G4S P;  2Z44 A;  2K92 A;  1GXH A;  1YI2 P;  3HYB A;  2OTJ P;  2Z46 A;  1KLP A;  2FQ1 A;  2X2B A;  1A8O A;  1VQ8 P;  2PEQ A;  3GZL A;  5BS1 A;  2LL8 A;  3H0D A;  5DCK A;  2K94 A;  5KP7 B;  2PEI A;  3G21 A;  3GJN A;  2KGA A;  3DS4 A;  3H47 A;  2K0Y A;  5F2N A;  2MVU A;  2MY5 A;  1NJI Q;  1K8A Q;  5EJD A;  4COP A;  2XXM A;  3U43 A;  1GXG A;  4PWV B;  5JPA A;  1Q81 Q;  1Q82 Q;  2JU1 A;  1Q86 Q;  1K30 A;  2GDW A;  2JQ4 A;  1RO0 A;  2PEJ A;  2L0Q A;  2DGY A;  1ACP A;  2N6Z A;  1VQN P;  2M8P A;  1FR2 A;  5KP6 B;  1VQ4 P;  4U0C A;  2L9F A;  2JYG A;  2JB0 A;  2JBG A;  4HKG A;  1VQ6 P;  2M8N A;  4H2X C;  1EOQ A;  2L22 A;  2PEO A;  4XFX A;  1IMP A;  2AFE A;  4U0D A;  2OTL P;  1YIT P;  4UHP B;  3DS5 A;  4U0A A;  3EJE A;  2EG5 A;  1ZNV A;  1VQ9 P;  2L4B A;  1EMV A;  2WPT A;  4GR2 A;  2PY8 A;  1AF8 A;  3DS3 A;  5HVC A;  2FHS C;  5I4T G;  3B5I A;  3DS0 A;  1IMQ A;  2JU2 A;  2JO0 A;  2KOD A;  1M6N A;  4QKO A;  4PXH B;  2KR5 A;  5HV8 A;  3CCQ P;  2JGP A;  3I56 P;  3HZQ A;  2AFD A;  3G1I A;  3CCM P;  2KOQ A;  2QEX P;  1IUQ A;  4PH1 A;  1VQK P;  4F37 A;  1K73 Q;  5KP8 B;  1BAJ A;  3CC7 P;  4U0B A;  1M1K Q;  2EIA A;  3CE7 A;  1X3O A;  1KC8 Q;  3LRY A;  1VQO P; 
#chains in the Genus database with same CATH homology
 2DGY A;  3G28 A;  1VQN P;  2M8P A;  2LF4 A;  3CD6 P;  1D1D A;  4U0F A;  3G1G A;  2PEK A;  3DPH A;  1VQ4 P;  4U0C A;  3Q20 A;  3CCJ P;  1EIA A;  5HGM A;  2JYG A;  3G71 P;  3CXC O;  1VQ6 P;  3H4E A;  1VQL P;  4XFZ A;  2M8N A;  3G6E P;  1EOQ A;  3E2D A;  1VQM P;  2PEO A;  4XFX A;  4COC A;  3RG6 C;  1M6E X;  2EFJ A;  3CC2 P;  1N8R Q;  4U0D A;  1YHQ P;  2OAR A;  2OTL P;  4WYM A;  3CCU P;  1YIT P;  4M0I A;  3P05 A;  4XRQ A;  4PH0 A;  3DS5 A;  4U0A A;  4XFY A;  1ZMB A;  5F2O A;  5HGL A;  1W2B O;  1K9M Q;  1QRJ A;  1RO2 A;  2EG5 A;  3CCL P;  2Z45 A;  2P9X A;  2L6E A;  2PEN A;  1KD1 Q;  2QA4 P;  5HGN A;  1AUM A;  1A43 A;  3G4S P;  1KQS O;  1VQ9 P;  2Z44 A;  1RNI A;  4GR2 A;  2PY8 A;  5F2K A;  1YI2 P;  3HYB A;  2M8L A;  3DS3 A;  2OTJ P;  1VQP P;  3G29 A;  5HGO A;  2Z46 A;  3MGE A;  1Q7Y Q;  3G0V A;  4U0E A;  1JJ2 O;  5I4T G;  1A8O A;  3CC4 P;  1VQ8 P;  3B5I A;  2CWO A;  2PEQ A;  1YIJ P;  5BS2 A;  3DS0 A;  1YJN P;  3VRL C;  2JO0 A;  3I55 P;  3CPW O;  2KOD A;  2BHV A;  1M6N A;  2BUO A;  4GR6 A;  3M1M A;  3DS2 A;  3DS1 A;  3CCE P;  2ONT A;  2JYL A;  5BS1 A;  3NTE A;  3H0D A;  1VQ7 P;  5DCK A;  3CCQ P;  2PEI A;  3G21 A;  3I56 P;  3HZQ A;  3DS4 A;  3DTJ A;  4QNB A;  1YJ9 P;  3H47 A;  5F2N A;  3G1I A;  3CCM P;  1NJI Q;  1K8A Q;  4COP A;  4XRO A;  4IPY A;  1M74 A;  2QEX P;  2XXM A;  1VQ5 P;  1IUQ A;  4PH1 A;  2XV6 A;  3CCS P;  1E6J P;  5JPA A;  3CCV P;  1K73 Q;  1VQK P;  1S72 P;  1BAJ A;  3CME P;  1Q81 Q;  2XT1 A;  1M90 Q;  2E1M A;  3CC7 P;  4U0B A;  3WBH A;  1YJW P;  1Q82 Q;  1M1K Q;  1Q86 Q;  2PEM A;  2EIA A;  1K30 A;  3CCR P;  1QVG O;  1KC8 Q;  1QVF O;  1RO0 A;  3G26 A;  3LRY A;  3CMA P;  1VQO P;  3OW2 O;  2PEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...