4GR2A

Structure of atrbcx1 from arabidopsis thaliana.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
110
structure length
110
Chain Sequence
EASPEAKAAKHLHDFFTYVAVRIVSAQLESYNPEAYMELREFLDTNSVSDGDKFLATLMRRSSRHMNLALRILEVRSAYAKNDFEWDNMKRLAFKNVDDSNTRLMREYVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AtRbcX1
publication title Insights into eukaryotic Rubisco assembly - Crystal structures of RbcX chaperones from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Chaperone
total genus 45
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4gr2A00
3RG6C 5BS2A 3Q20A 2PEJA 2PEKA 2Z44A 2PEQA 2Z45A 4GR2A 5BS1A 2PEOA 2PY8A 2PENA 2Z46A 2PEMA 4GR6A 3HYBA 2PEIA
chains in the Genus database with same CATH superfamily
2KG8A 2KOSA 4BPGA 3CCJP 3G0VA 4MRTC 2K92A 2EFJA 1VQ5P 1YJNP 2CG5B 2BHVA 2KOQA 2K0YA 3CCVP 2GDXA 2WPTA 3DS2A 2N50A 4PH0A 2P9XA 1AYIA 3I55P 2Z44A 1M6NA 3G29A 2KOPA 5HGMA 2FVEA 1JJ2O 2JAZA 1YIJP 2Z45A 1VQNP 2EG5A 1T8KA 2Z46A 2MF4A 1EIAA 2JQ4A 1ZMBA 1E0HA 2OTJP 2KGCA 2M8PA 4XFYA 1BXIA 2X2BA 3I56P 2LOLA 3DS0A 2XZ0D 2N98A 2L0QA 2KODA 2FHSC 3HZQA 4HKGA 1X3OA 3EJEA 2PEJA 4CA3A 2K0DX 1N8RQ 3VRLC 2FACA 2GZGA 1K8AQ 2AFEA 2KGEA 1NQ4A 2PNGA 2MR8A 1RO0A 5F2OA 4DG9A 3CCSP 2E1MA 2FVFA 5HGNA 1S72P 3MGEA 2QA4P 2LPKA 2DGYA 2N5HA 4COPA 1YHQP 1M74A 2GZJA 1VQ7P 1M1KQ 5JPAA 3CCQP 3CC7P 1UJZA 4M0IA 3CE7A 2KR5A 1HY8A 1BAJA 2LIUA 1KQSO 2LKIA 2AFDA 1OR5A 2MVUA 1K73Q 1HQBA 2EHSA 2M5RA 2ONTA 3M1MA 3CCMP 4BPFA 2XZ1C 2LMLA 1W2BO 2LTEA 4XROA 1GXGA 2KG6A 5EJDA 4XRQA 1Z6MA 3EJDA 2N6YA 1VKUA 1L0IA 4U0EA 4U0DA 1VQMP 5CZDB 3NY7B 3CXCO 5KP8B 1EOQA 1KLPA 3H0DA 1GXHA 4PWVB 2XXMA 2DNWA 2N6ZA 1YJ9P 3CCUP 3G1GA 1A43A 1M90Q 2VLPA 3DPHA 4U0FA 5DCKA 5BS2A 5EW5E 1Q7YQ 1A8OA 5F2NA 3G28A 1VHNA 4BPHA 2VLNA 4H2WC 1DNYA 2QNWA 4IPYA 2CGQA 3P05A 3LRYA 3EJBA 3G6EP 4H2XC 2PEIA 1KD1Q 2JYLA 1VQOP 1D1DA 3E2DA 3B5IA 2PY8A 1L0HA 3DS1A 4QKOA 3G1IA 5F2KA 4H2YC 2JO0A 4R0MA 1Q82Q 2PEQA 2OARA 5KP7B 5HGOA 3Q20A 3GJNA 4PH1A 2L6EA 2GZEA 1M6EX 4COCA 3G26A 2L4BA 1EMVA 1AUMA 3RG2A 3G71P 1QRJA 3OW2O 4U0AA 3CC2P 4F37A 3GZLA 1IMQA 1DV5A 3CPWO 5KP6B 3DTJA 1KC8Q 1GPJA 3DS5A 3CMEP 1Q86Q 3CD6P 2XT1A 4IZ6A 2K93A 4WYMA 2PENA 3DS3A 5HVCA 3U43A 5HV8A 2LIWA 3CCLP 1K30A 2CWOA 2EIAA 2LF4A 2VSQA 3GKLC 1CEIA 2QEXP 2OTLP 2K2QA 1ZNVA 1E6JP 2MD9A 2FQ2A 2L22A 1NJIQ 4U0BA 4NEOA 1VQKP 1Q81Q 1VQ9P 3G4SP 2GDWA 4GR6A 2ERHA 1VQ4P 1IMPA 2FAEA 2K5XA 1YJWP 3CMAP 2JU1A 2CNRA 2CQ8A 2M8LA 2GZIA 1VQLP 3WBHA 2FQ1A 1VQ6P 5I4TG 7CEIA 2KGDA 2GDYA 3CCEP 1K9MQ 2JBGA 2GYKA 2KW2A 1ACPA 3NTEA 2EHTA 2N5IA 3G21A 2L9FA 3DS4A 2MVVA 3HYBA 2LL8A 2M8NA 3CC4P 1QVFO 5BS1A 4XFZA 2KWLA 2AVAA 1UNKA 1YI2P 1FR2A 3GZMA 2KOOA 3H4EA 2FADA 4U0CA 1RO2A 1QVGO 3H47A 3LMOA 3B4QA 2MY5A 4UHPB 1MZ8A 2KGAA 2K94A 2FQ0A 2JB0A 2MR7A 4XFXA 2ROQA 3RG6C 4QNBA 1IUQA 2FVAA 2AF8A 2NO8A 2JGPA 2VLQA 2KORA 2XV6A 2PEOA 2PEKA 1RNIA 2VLOA 2JU2A 2PEMA 2BUOA 4PXHB 2JYGA 3CCRP 1VQ8P 1F80D 1AF8A 5HGLA 2K0XA 4GR2A 2KG9A 1VQPP 1YITP 2GZFA
chains in the Genus database with same CATH topology
1KD1Q 4COPA 3CMAP 1YJWP 1YHQP 1M74A 1VQ7P 2JYLA 1VQOP 1M1KQ 3CCJP 3G0VA 5JPAA 3CCQP 1D1DA 3E2DA 3B5IA 2EFJA 2PY8A 2M8LA 1VQ5P 3DS1A 3CC7P 1VQLP 3WBHA 3G1IA 1YJNP 4M0IA 5F2KA 1VQ6P 5I4TG 2BHVA 1BAJA 2JO0A 1KQSO 3CCVP 1K73Q 1Q82Q 2PEQA 2OARA 3DS2A 4PH0A 3CCEP 1K9MQ 2P9XA 5HGOA 3I55P 3Q20A 2Z44A 3NTEA 1M6NA 3G29A 4PH1A 2ONTA 2L6EA 3M1MA 3G21A 3CCMP 1M6EX 4COCA 3DS4A 5HGMA 3G26A 1JJ2O 3HYBA 1AUMA 1W2BO 2M8NA 1QRJA 4XROA 3G71P 3OW2O 1YIJP 3CC4P 1QVFO 4U0AA 2Z45A 5BS1A 3CC2P 2EG5A 4XRQA 2Z46A 1VQNP 4XFZA 1EIAA 1ZMBA 1YI2P 2OTJP 3H4EA 2M8PA 4U0EA 4U0CA 1RO2A 4U0DA 4XFYA 1QVGO 1VQMP 3CPWO 3DTJA 3H47A 3CXCO 1KC8Q 3DS5A 1EOQA 3I56P 3CMEP 3DS0A 3H0DA 1Q86Q 2XXMA 3CD6P 2XT1A 2KODA 1YJ9P 3G1GA 3HZQA 1A43A 3CCUP 1M90Q 4WYMA 4XFXA 2PENA 3DS3A 3DPHA 3RG6C 4U0FA 5DCKA 5BS2A 4QNBA 1IUQA 2PEJA 1N8RQ 1K30A 2CWOA 2EIAA 3CCLP 3VRLC 1Q7YQ 2LF4A 1A8OA 5F2NA 1K8AQ 3G28A 2XV6A 2PEOA 2QEXP 2OTLP 2PEKA 1RO0A 1E6JP 1RNIA 5F2OA 3CCSP 2PEMA 1NJIQ 2E1MA 2BUOA 4U0BA 1VQKP 1Q81Q 1VQ9P 2JYGA 4IPYA 5HGNA 1S72P 3G4SP 3CCRP 1VQ8P 3MGEA 2QA4P 5HGLA 3P05A 3LRYA 2DGYA 4GR2A 3G6EP 1VQPP 1YITP 4GR6A 1VQ4P 2PEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RG6 C;  5BS2 A;  3Q20 A;  2PEJ A;  2PEK A;  2Z44 A;  2PEQ A;  2Z45 A;  4GR2 A;  5BS1 A;  2PEO A;  2PY8 A;  2PEN A;  2Z46 A;  2PEM A;  4GR6 A;  3HYB A;  2PEI A; 
#chains in the Genus database with same CATH topology
 2KG8 A;  2KOS A;  4BPG A;  3CCJ P;  3G0V A;  4MRT C;  2K92 A;  2EFJ A;  1VQ5 P;  1YJN P;  2CG5 B;  2BHV A;  2KOQ A;  2K0Y A;  3CCV P;  2GDX A;  2WPT A;  3DS2 A;  2N50 A;  4PH0 A;  2P9X A;  1AYI A;  3I55 P;  2Z44 A;  1M6N A;  3G29 A;  2KOP A;  5HGM A;  2FVE A;  1JJ2 O;  2JAZ A;  1YIJ P;  2Z45 A;  1VQN P;  2EG5 A;  1T8K A;  2Z46 A;  2MF4 A;  1EIA A;  2JQ4 A;  1ZMB A;  1E0H A;  2OTJ P;  2KGC A;  2M8P A;  4XFY A;  1BXI A;  2X2B A;  3I56 P;  2LOL A;  3DS0 A;  2XZ0 D;  2N98 A;  2L0Q A;  2KOD A;  2FHS C;  3HZQ A;  4HKG A;  1X3O A;  3EJE A;  2PEJ A;  4CA3 A;  2K0D X;  1N8R Q;  3VRL C;  2FAC A;  2GZG A;  1K8A Q;  2AFE A;  2KGE A;  1NQ4 A;  2PNG A;  2MR8 A;  1RO0 A;  5F2O A;  4DG9 A;  3CCS P;  2E1M A;  2FVF A;  5HGN A;  1S72 P;  3MGE A;  2QA4 P;  2LPK A;  2DGY A;  2N5H A;  4COP A;  1YHQ P;  1M74 A;  2GZJ A;  1VQ7 P;  1M1K Q;  5JPA A;  3CCQ P;  3CC7 P;  1UJZ A;  4M0I A;  3CE7 A;  2KR5 A;  1HY8 A;  1BAJ A;  2LIU A;  1KQS O;  2LKI A;  2AFD A;  1OR5 A;  2MVU A;  1K73 Q;  1HQB A;  2EHS A;  2M5R A;  2ONT A;  3M1M A;  3CCM P;  4BPF A;  2XZ1 C;  2LML A;  1W2B O;  2LTE A;  4XRO A;  1GXG A;  2KG6 A;  5EJD A;  4XRQ A;  1Z6M A;  3EJD A;  2N6Y A;  1VKU A;  1L0I A;  4U0E A;  4U0D A;  1VQM P;  5CZD B;  3NY7 B;  3CXC O;  5KP8 B;  1EOQ A;  1KLP A;  3H0D A;  1GXH A;  4PWV B;  2XXM A;  2DNW A;  2N6Z A;  1YJ9 P;  3CCU P;  3G1G A;  1A43 A;  1M90 Q;  2VLP A;  3DPH A;  4U0F A;  5DCK A;  5BS2 A;  5EW5 E;  1Q7Y Q;  1A8O A;  5F2N A;  3G28 A;  1VHN A;  4BPH A;  2VLN A;  4H2W C;  1DNY A;  2QNW A;  4IPY A;  2CGQ A;  3P05 A;  3LRY A;  3EJB A;  3G6E P;  4H2X C;  2PEI A;  1KD1 Q;  2JYL A;  1VQO P;  1D1D A;  3E2D A;  3B5I A;  2PY8 A;  1L0H A;  3DS1 A;  4QKO A;  3G1I A;  5F2K A;  4H2Y C;  2JO0 A;  4R0M A;  1Q82 Q;  2PEQ A;  2OAR A;  5KP7 B;  5HGO A;  3Q20 A;  3GJN A;  4PH1 A;  2L6E A;  2GZE A;  1M6E X;  4COC A;  3G26 A;  2L4B A;  1EMV A;  1AUM A;  3RG2 A;  3G71 P;  1QRJ A;  3OW2 O;  4U0A A;  3CC2 P;  4F37 A;  3GZL A;  1IMQ A;  1DV5 A;  3CPW O;  5KP6 B;  3DTJ A;  1KC8 Q;  1GPJ A;  3DS5 A;  3CME P;  1Q86 Q;  3CD6 P;  2XT1 A;  4IZ6 A;  2K93 A;  4WYM A;  2PEN A;  3DS3 A;  5HVC A;  3U43 A;  5HV8 A;  2LIW A;  3CCL P;  1K30 A;  2CWO A;  2EIA A;  2LF4 A;  2VSQ A;  3GKL C;  1CEI A;  2QEX P;  2OTL P;  2K2Q A;  1ZNV A;  1E6J P;  2MD9 A;  2FQ2 A;  2L22 A;  1NJI Q;  4U0B A;  4NEO A;  1VQK P;  1Q81 Q;  1VQ9 P;  3G4S P;  2GDW A;  4GR6 A;  2ERH A;  1VQ4 P;  1IMP A;  2FAE A;  2K5X A;  1YJW P;  3CMA P;  2JU1 A;  2CNR A;  2CQ8 A;  2M8L A;  2GZI A;  1VQL P;  3WBH A;  2FQ1 A;  1VQ6 P;  5I4T G;  7CEI A;  2KGD A;  2GDY A;  3CCE P;  1K9M Q;  2JBG A;  2GYK A;  2KW2 A;  1ACP A;  3NTE A;  2EHT A;  2N5I A;  3G21 A;  2L9F A;  3DS4 A;  2MVV A;  3HYB A;  2LL8 A;  2M8N A;  3CC4 P;  1QVF O;  5BS1 A;  4XFZ A;  2KWL A;  2AVA A;  1UNK A;  1YI2 P;  1FR2 A;  3GZM A;  2KOO A;  3H4E A;  2FAD A;  4U0C A;  1RO2 A;  1QVG O;  3H47 A;  3LMO A;  3B4Q A;  2MY5 A;  4UHP B;  1MZ8 A;  2KGA A;  2K94 A;  2FQ0 A;  2JB0 A;  2MR7 A;  4XFX A;  2ROQ A;  3RG6 C;  4QNB A;  1IUQ A;  2FVA A;  2AF8 A;  2NO8 A;  2JGP A;  2VLQ A;  2KOR A;  2XV6 A;  2PEO A;  2PEK A;  1RNI A;  2VLO A;  2JU2 A;  2PEM A;  2BUO A;  4PXH B;  2JYG A;  3CCR P;  1VQ8 P;  1F80 D;  1AF8 A;  5HGL A;  2K0X A;  4GR2 A;  2KG9 A;  1VQP P;  1YIT P;  2GZF A; 
#chains in the Genus database with same CATH homology
 1KD1 Q;  4COP A;  3CMA P;  1YJW P;  1YHQ P;  1M74 A;  1VQ7 P;  2JYL A;  1VQO P;  1M1K Q;  3CCJ P;  3G0V A;  5JPA A;  3CCQ P;  1D1D A;  3E2D A;  3B5I A;  2EFJ A;  2PY8 A;  2M8L A;  1VQ5 P;  3DS1 A;  3CC7 P;  1VQL P;  3WBH A;  3G1I A;  1YJN P;  4M0I A;  5F2K A;  1VQ6 P;  5I4T G;  2BHV A;  1BAJ A;  2JO0 A;  1KQS O;  3CCV P;  1K73 Q;  1Q82 Q;  2PEQ A;  2OAR A;  3DS2 A;  4PH0 A;  3CCE P;  1K9M Q;  2P9X A;  5HGO A;  3I55 P;  3Q20 A;  2Z44 A;  3NTE A;  1M6N A;  3G29 A;  4PH1 A;  2ONT A;  2L6E A;  3M1M A;  3G21 A;  3CCM P;  1M6E X;  4COC A;  3DS4 A;  5HGM A;  3G26 A;  1JJ2 O;  3HYB A;  1AUM A;  1W2B O;  2M8N A;  1QRJ A;  4XRO A;  3G71 P;  3OW2 O;  1YIJ P;  3CC4 P;  1QVF O;  4U0A A;  2Z45 A;  5BS1 A;  3CC2 P;  2EG5 A;  4XRQ A;  2Z46 A;  1VQN P;  4XFZ A;  1EIA A;  1ZMB A;  1YI2 P;  2OTJ P;  3H4E A;  2M8P A;  4U0E A;  4U0C A;  1RO2 A;  4U0D A;  4XFY A;  1QVG O;  1VQM P;  3CPW O;  3DTJ A;  3H47 A;  3CXC O;  1KC8 Q;  3DS5 A;  1EOQ A;  3I56 P;  3CME P;  3DS0 A;  3H0D A;  1Q86 Q;  2XXM A;  3CD6 P;  2XT1 A;  2KOD A;  1YJ9 P;  3G1G A;  3HZQ A;  1A43 A;  3CCU P;  1M90 Q;  4WYM A;  4XFX A;  2PEN A;  3DS3 A;  3DPH A;  3RG6 C;  4U0F A;  5DCK A;  5BS2 A;  4QNB A;  1IUQ A;  2PEJ A;  1N8R Q;  1K30 A;  2CWO A;  2EIA A;  3CCL P;  3VRL C;  1Q7Y Q;  2LF4 A;  1A8O A;  5F2N A;  1K8A Q;  3G28 A;  2XV6 A;  2PEO A;  2QEX P;  2OTL P;  2PEK A;  1RO0 A;  1E6J P;  1RNI A;  5F2O A;  3CCS P;  2PEM A;  1NJI Q;  2E1M A;  2BUO A;  4U0B A;  1VQK P;  1Q81 Q;  1VQ9 P;  2JYG A;  4IPY A;  5HGN A;  1S72 P;  3G4S P;  3CCR P;  1VQ8 P;  3MGE A;  2QA4 P;  5HGL A;  3P05 A;  3LRY A;  2DGY A;  4GR2 A;  3G6E P;  1VQP P;  1YIT P;  4GR6 A;  1VQ4 P;  2PEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...