3G1GA

Crystal structure of the c-terminal domain from the rous sarcoma virus capsid protein: high ph
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
GPWADIMQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gag polyprotein
publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
total genus 24
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g1gA00
3DS4A 1EIAA 2XT1A 2L6EA 1EOQA 3DS0A 3G29A 3LRYA 3H47A 4QNBA 5HGNA 2M8PA 3DS3A 1D1DA 4U0EA 3G1GA 2JYGA 4XFXA 4XFYA 4XFZA 5HGLA 2M8LA 4COPA 5JPAA 4WYMA 2LF4A 1BAJA 5DCKA 2ONTA 2M8NA 2EIAA 4PH0A 2KODA 3G26A 1QRJA 4U0BA 5HGMA 4XROA 3NTEA 1AUMA 2XV6A 4IPYA 3DS5A 3G0VA 3H4EA 3DS1A 3P05A 4PH1A 2BUOA 5I4TG 4U0DA 4COCA 4M0IA 4U0FA 3G21A 4U0AA 3DPHA 5HGOA 1E6JP 1A43A 2JYLA 3DTJA 3VRLC 2XXMA 4U0CA 2JO0A 3DS2A 4XRQA 3MGEA 1A8OA 3G28A 3G1IA
chains in the Genus database with same CATH superfamily
2JU2A 3EJBA 5CZDB 1RO2A 1VQKP 2KOPA 2GDYA 2X2BA 1K73Q 5HVCA 1VQPP 3H0DA 1YITP 2JGPA 1N8RQ 2KODA 2KOSA 1GPJA 3NTEA 4H2YC 1UNKA 1ZNVA 1E6JP 3CCLP 1GXHA 1A8OA 1EOQA 1NQ4A 1M6NA 2M8PA 1VQ6P 1VQ8P 1AF8A 1OR5A 2L4BA 2LIUA 1KC8Q 3DS5A 2CGQA 4HKGA 2AF8A 2N5IA 3DPHA 2E1MA 2EG5A 2N5HA 3DTJA 3E2DA 4R0MA 1EIAA 2KG8A 3EJDA 2GZEA 1CEIA 5F2NA 2LF4A 3RG6C 2VLQA 2N6ZA 4IPYA 1M74A 1K8AQ 1ZMBA 1YJWP 2OTJP 2K0XA 3GZMA 2L9FA 3B5IA 3B4QA 3I56P 1UJZA 2QEXP 4NEOA 1FR2A 4XFYA 1KQSO 2ERHA 3I55P 2MD9A 2Z46A 5DCKA 1W2BO 2GZJA 2GYKA 4PXHB 4U0BA 4CA3A 4XROA 2P9XA 2GDXA 2CNRA 4BPGA 1BXIA 1YI2P 2N50A 1VQ5P 2FQ2A 2K93A 2XT1A 2XZ1C 2GZGA 2LOLA 2KGEA 1YHQP 1VQ4P 4F37A 1YIJP 1DV5A 1BAJA 5EJDA 5KP8B 2OTLP 2MVVA 1Q82Q 2XV6A 2LL8A 3H4EA 3G4SP 1IUQA 3EJEA 1VQOP 4DG9A 3LMOA 5BS2A 2LKIA 4U0CA 3CCSP 3CCRP 2PEMA 4MRTC 1M6EX 2PNGA 1MZ8A 5JPAA 3GKLC 2EIAA 1QVFO 2GZIA 2M5RA 1A43A 3U43A 3CPWO 3MGEA 3DS4A 1VQ7P 1HQBA 3DS3A 1AYIA 1S72P 4COPA 4WYMA 2NO8A 4GR2A 2JB0A 1QVGO 5F2KA 2PEOA 2KG6A 4H2XC 3CCQP 2DNWA 1IMPA 1L0IA 2N98A 2FVEA 2WPTA 3CCEP 2PEKA 5BS1A 3CCMP 1NJIQ 1KLPA 1Q7YQ 2MVUA 2K0YA 3CC2P 1VKUA 3DS0A 3G29A 1Q81Q 1M1KQ 1E0HA 3G1GA 2L22A 5KP7B 2FHSC 3GJNA 2EHTA 1AUMA 5I4TG 2BUOA 2Z44A 2KGAA 4XRQA 3GZLA 3Q20A 2K94A 1K9MQ 2DGYA 1D1DA 3HYBA 2PEJA 5F2OA 2PY8A 2BHVA 3G26A 2VLOA 2JQ4A 4PH1A 1T8KA 2ROQA 2KOOA 1VQMP 3G28A 2LPKA 5KP6B 2FQ1A 3LRYA 5HGNA 3G71P 4XFXA 1RO0A 4H2WC 2M8LA 2K2QA 3HZQA 2JU1A 2KGDA 5HGMA 2KOQA 2VLPA 3G0VA 1X3OA 4M0IA 2CWOA 1IMQA 1ACPA 1VHNA 7CEIA 3CC4P 1KD1Q 3G1IA 3CC7P 2L6EA 4U0EA 2FQ0A 3OW2O 2FVFA 2AFDA 2ONTA 3CXCO 2LMLA 2M8NA 1EMVA 2KG9A 1VQNP 2K92A 2FACA 4U0FA 2CG5B 1K30A 2JBGA 3CD6P 4QNBA 1VQ9P 4BPHA 2FVAA 5EW5E 1Q86Q 1DNYA 2QNWA 3CMEP 1F80D 3CE7A 2EFJA 4PH0A 3RG2A 2Z45A 1HY8A 4U0DA 4COCA 1YJNP 4U0AA 2JYLA 3VRLC 1M90Q 3CMAP 2JAZA 1GXGA 2MR8A 1YJ9P 3H47A 2KORA 2JYGA 2AFEA 2PEIA 4GR6A 4PWVB 2L0QA 2EHSA 2MF4A 2GDWA 2GZFA 2MR7A 2K5XA 2OARA 2CQ8A 2QA4P 3NY7B 2KWLA 2FADA 2LIWA 4XFZA 5HGLA 2PENA 2VSQA 1VQLP 1QRJA 2MY5A 2XZ0D 5HV8A 2K0DX 3M1MA 2N6YA 3P05A 3G6EP 5HGOA 4QKOA 2XXMA 2VLNA 3CCVP 2KGCA 4IZ6A 1L0HA 2KR5A 3WBHA 3CCUP 4UHPB 2AVAA 1Z6MA 2LTEA 1JJ2O 4BPFA 3DS1A 1RNIA 2PEQA 3CCJP 3G21A 2FAEA 2JO0A 3DS2A 2KW2A
chains in the Genus database with same CATH topology
2XT1A 3DS0A 3G29A 1YHQP 1Q81Q 1VQ4P 3CD6P 1RO2A 1VQKP 1M1KQ 4QNBA 1VQ9P 3G1GA 1YIJP 1K73Q 1VQPP 3H0DA 1BAJA 1YITP 1Q86Q 2OTLP 3CMEP 1N8RQ 4PH0A 2EFJA 2KODA 1Q82Q 3NTEA 1AUMA 2XV6A 2Z45A 3H4EA 5I4TG 3G4SP 2BUOA 4U0DA 1IUQA 4COCA 1YJNP 4U0AA 2Z44A 1VQOP 1E6JP 2JYLA 3VRLC 5BS2A 1M90Q 3CCLP 4U0CA 4XRQA 3CMAP 3CCSP 1A8OA 3Q20A 3CCRP 1K9MQ 2PEMA 1EOQA 1YJ9P 2DGYA 3H47A 1M6EX 1D1DA 1M6NA 2M8PA 3HYBA 2JYGA 1VQ6P 2PEJA 5JPAA 1VQ8P 5F2OA 2PY8A 2EIAA 2BHVA 3G26A 1QVFO 2PEIA 4GR6A 1KC8Q 3DS5A 4PH1A 3DPHA 3E2DA 2E1MA 1A43A 2EG5A 3DTJA 3CPWO 3MGEA 1VQMP 3G28A 3DS4A 1EIAA 2OARA 1VQ7P 3LRYA 2QA4P 5HGNA 3DS3A 3G71P 4XFXA 5F2NA 1S72P 1RO0A 4XFZA 2PENA 5HGLA 2M8LA 4COPA 3HZQA 4WYMA 2LF4A 4GR2A 1VQLP 3RG6C 1QRJA 5HGMA 4IPYA 1M74A 3M1MA 3G0VA 3P05A 1K8AQ 1ZMBA 3G6EP 1YJWP 5HGOA 4M0IA 2OTJP 2CWOA 3B5IA 1QVGO 2XXMA 3CCVP 3CC4P 5F2KA 3G1IA 3I56P 1KD1Q 3CC7P 2PEOA 2QEXP 2L6EA 4U0EA 4XFYA 3CCQP 1KQSO 3I55P 3OW2O 3WBHA 2Z46A 5DCKA 2ONTA 3CXCO 3CCUP 2M8NA 1W2BO 1VQNP 4U0BA 4XROA 3CCEP 2PEKA 2P9XA 1JJ2O 5BS1A 3CCMP 1NJIQ 3DS1A 1RNIA 2PEQA 3CCJP 1Q7YQ 4U0FA 3G21A 1YI2P 1K30A 2JO0A 3DS2A 1VQ5P 3CC2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS4 A;  1EIA A;  2XT1 A;  2L6E A;  1EOQ A;  3DS0 A;  3G29 A;  3LRY A;  3H47 A;  4QNB A;  5HGN A;  2M8P A;  3DS3 A;  1D1D A;  4U0E A;  3G1G A;  2JYG A;  4XFX A;  4XFY A;  4XFZ A;  5HGL A;  2M8L A;  4COP A;  5JPA A;  4WYM A;  2LF4 A;  1BAJ A;  5DCK A;  2ONT A;  2M8N A;  2EIA A;  4PH0 A;  2KOD A;  3G26 A;  1QRJ A;  4U0B A;  5HGM A;  4XRO A;  3NTE A;  1AUM A;  2XV6 A;  4IPY A;  3DS5 A;  3G0V A;  3H4E A;  3DS1 A;  3P05 A;  4PH1 A;  2BUO A;  5I4T G;  4U0D A;  4COC A;  4M0I A;  4U0F A;  3G21 A;  4U0A A;  3DPH A;  5HGO A;  1E6J P;  1A43 A;  2JYL A;  3DTJ A;  3VRL C;  2XXM A;  4U0C A;  2JO0 A;  3DS2 A;  4XRQ A;  3MGE A;  1A8O A;  3G28 A;  3G1I A; 
#chains in the Genus database with same CATH topology
 2JU2 A;  3EJB A;  5CZD B;  1RO2 A;  1VQK P;  2KOP A;  2GDY A;  2X2B A;  1K73 Q;  5HVC A;  1VQP P;  3H0D A;  1YIT P;  2JGP A;  1N8R Q;  2KOD A;  2KOS A;  1GPJ A;  3NTE A;  4H2Y C;  1UNK A;  1ZNV A;  1E6J P;  3CCL P;  1GXH A;  1A8O A;  1EOQ A;  1NQ4 A;  1M6N A;  2M8P A;  1VQ6 P;  1VQ8 P;  1AF8 A;  1OR5 A;  2L4B A;  2LIU A;  1KC8 Q;  3DS5 A;  2CGQ A;  4HKG A;  2AF8 A;  2N5I A;  3DPH A;  2E1M A;  2EG5 A;  2N5H A;  3DTJ A;  3E2D A;  4R0M A;  1EIA A;  2KG8 A;  3EJD A;  2GZE A;  1CEI A;  5F2N A;  2LF4 A;  3RG6 C;  2VLQ A;  2N6Z A;  4IPY A;  1M74 A;  1K8A Q;  1ZMB A;  1YJW P;  2OTJ P;  2K0X A;  3GZM A;  2L9F A;  3B5I A;  3B4Q A;  3I56 P;  1UJZ A;  2QEX P;  4NEO A;  1FR2 A;  4XFY A;  1KQS O;  2ERH A;  3I55 P;  2MD9 A;  2Z46 A;  5DCK A;  1W2B O;  2GZJ A;  2GYK A;  4PXH B;  4U0B A;  4CA3 A;  4XRO A;  2P9X A;  2GDX A;  2CNR A;  4BPG A;  1BXI A;  1YI2 P;  2N50 A;  1VQ5 P;  2FQ2 A;  2K93 A;  2XT1 A;  2XZ1 C;  2GZG A;  2LOL A;  2KGE A;  1YHQ P;  1VQ4 P;  4F37 A;  1YIJ P;  1DV5 A;  1BAJ A;  5EJD A;  5KP8 B;  2OTL P;  2MVV A;  1Q82 Q;  2XV6 A;  2LL8 A;  3H4E A;  3G4S P;  1IUQ A;  3EJE A;  1VQO P;  4DG9 A;  3LMO A;  5BS2 A;  2LKI A;  4U0C A;  3CCS P;  3CCR P;  2PEM A;  4MRT C;  1M6E X;  2PNG A;  1MZ8 A;  5JPA A;  3GKL C;  2EIA A;  1QVF O;  2GZI A;  2M5R A;  1A43 A;  3U43 A;  3CPW O;  3MGE A;  3DS4 A;  1VQ7 P;  1HQB A;  3DS3 A;  1AYI A;  1S72 P;  4COP A;  4WYM A;  2NO8 A;  4GR2 A;  2JB0 A;  1QVG O;  5F2K A;  2PEO A;  2KG6 A;  4H2X C;  3CCQ P;  2DNW A;  1IMP A;  1L0I A;  2N98 A;  2FVE A;  2WPT A;  3CCE P;  2PEK A;  5BS1 A;  3CCM P;  1NJI Q;  1KLP A;  1Q7Y Q;  2MVU A;  2K0Y A;  3CC2 P;  1VKU A;  3DS0 A;  3G29 A;  1Q81 Q;  1M1K Q;  1E0H A;  3G1G A;  2L22 A;  5KP7 B;  2FHS C;  3GJN A;  2EHT A;  1AUM A;  5I4T G;  2BUO A;  2Z44 A;  2KGA A;  4XRQ A;  3GZL A;  3Q20 A;  2K94 A;  1K9M Q;  2DGY A;  1D1D A;  3HYB A;  2PEJ A;  5F2O A;  2PY8 A;  2BHV A;  3G26 A;  2VLO A;  2JQ4 A;  4PH1 A;  1T8K A;  2ROQ A;  2KOO A;  1VQM P;  3G28 A;  2LPK A;  5KP6 B;  2FQ1 A;  3LRY A;  5HGN A;  3G71 P;  4XFX A;  1RO0 A;  4H2W C;  2M8L A;  2K2Q A;  3HZQ A;  2JU1 A;  2KGD A;  5HGM A;  2KOQ A;  2VLP A;  3G0V A;  1X3O A;  4M0I A;  2CWO A;  1IMQ A;  1ACP A;  1VHN A;  7CEI A;  3CC4 P;  1KD1 Q;  3G1I A;  3CC7 P;  2L6E A;  4U0E A;  2FQ0 A;  3OW2 O;  2FVF A;  2AFD A;  2ONT A;  3CXC O;  2LML A;  2M8N A;  1EMV A;  2KG9 A;  1VQN P;  2K92 A;  2FAC A;  4U0F A;  2CG5 B;  1K30 A;  2JBG A;  3CD6 P;  4QNB A;  1VQ9 P;  4BPH A;  2FVA A;  5EW5 E;  1Q86 Q;  1DNY A;  2QNW A;  3CME P;  1F80 D;  3CE7 A;  2EFJ A;  4PH0 A;  3RG2 A;  2Z45 A;  1HY8 A;  4U0D A;  4COC A;  1YJN P;  4U0A A;  2JYL A;  3VRL C;  1M90 Q;  3CMA P;  2JAZ A;  1GXG A;  2MR8 A;  1YJ9 P;  3H47 A;  2KOR A;  2JYG A;  2AFE A;  2PEI A;  4GR6 A;  4PWV B;  2L0Q A;  2EHS A;  2MF4 A;  2GDW A;  2GZF A;  2MR7 A;  2K5X A;  2OAR A;  2CQ8 A;  2QA4 P;  3NY7 B;  2KWL A;  2FAD A;  2LIW A;  4XFZ A;  5HGL A;  2PEN A;  2VSQ A;  1VQL P;  1QRJ A;  2MY5 A;  2XZ0 D;  5HV8 A;  2K0D X;  3M1M A;  2N6Y A;  3P05 A;  3G6E P;  5HGO A;  4QKO A;  2XXM A;  2VLN A;  3CCV P;  2KGC A;  4IZ6 A;  1L0H A;  2KR5 A;  3WBH A;  3CCU P;  4UHP B;  2AVA A;  1Z6M A;  2LTE A;  1JJ2 O;  4BPF A;  3DS1 A;  1RNI A;  2PEQ A;  3CCJ P;  3G21 A;  2FAE A;  2JO0 A;  3DS2 A;  2KW2 A; 
#chains in the Genus database with same CATH homology
 2XT1 A;  3DS0 A;  3G29 A;  1YHQ P;  1Q81 Q;  1VQ4 P;  3CD6 P;  1RO2 A;  1VQK P;  1M1K Q;  4QNB A;  1VQ9 P;  3G1G A;  1YIJ P;  1K73 Q;  1VQP P;  3H0D A;  1BAJ A;  1YIT P;  1Q86 Q;  2OTL P;  3CME P;  1N8R Q;  4PH0 A;  2EFJ A;  2KOD A;  1Q82 Q;  3NTE A;  1AUM A;  2XV6 A;  2Z45 A;  3H4E A;  5I4T G;  3G4S P;  2BUO A;  4U0D A;  1IUQ A;  4COC A;  1YJN P;  4U0A A;  2Z44 A;  1VQO P;  1E6J P;  2JYL A;  3VRL C;  5BS2 A;  1M90 Q;  3CCL P;  4U0C A;  4XRQ A;  3CMA P;  3CCS P;  1A8O A;  3Q20 A;  3CCR P;  1K9M Q;  2PEM A;  1EOQ A;  1YJ9 P;  2DGY A;  3H47 A;  1M6E X;  1D1D A;  1M6N A;  2M8P A;  3HYB A;  2JYG A;  1VQ6 P;  2PEJ A;  5JPA A;  1VQ8 P;  5F2O A;  2PY8 A;  2EIA A;  2BHV A;  3G26 A;  1QVF O;  2PEI A;  4GR6 A;  1KC8 Q;  3DS5 A;  4PH1 A;  3DPH A;  3E2D A;  2E1M A;  1A43 A;  2EG5 A;  3DTJ A;  3CPW O;  3MGE A;  1VQM P;  3G28 A;  3DS4 A;  1EIA A;  2OAR A;  1VQ7 P;  3LRY A;  2QA4 P;  5HGN A;  3DS3 A;  3G71 P;  4XFX A;  5F2N A;  1S72 P;  1RO0 A;  4XFZ A;  2PEN A;  5HGL A;  2M8L A;  4COP A;  3HZQ A;  4WYM A;  2LF4 A;  4GR2 A;  1VQL P;  3RG6 C;  1QRJ A;  5HGM A;  4IPY A;  1M74 A;  3M1M A;  3G0V A;  3P05 A;  1K8A Q;  1ZMB A;  3G6E P;  1YJW P;  5HGO A;  4M0I A;  2OTJ P;  2CWO A;  3B5I A;  1QVG O;  2XXM A;  3CCV P;  3CC4 P;  5F2K A;  3G1I A;  3I56 P;  1KD1 Q;  3CC7 P;  2PEO A;  2QEX P;  2L6E A;  4U0E A;  4XFY A;  3CCQ P;  1KQS O;  3I55 P;  3OW2 O;  3WBH A;  2Z46 A;  5DCK A;  2ONT A;  3CXC O;  3CCU P;  2M8N A;  1W2B O;  1VQN P;  4U0B A;  4XRO A;  3CCE P;  2PEK A;  2P9X A;  1JJ2 O;  5BS1 A;  3CCM P;  1NJI Q;  3DS1 A;  1RNI A;  2PEQ A;  3CCJ P;  1Q7Y Q;  4U0F A;  3G21 A;  1YI2 P;  1K30 A;  2JO0 A;  3DS2 A;  1VQ5 P;  3CC2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...