3G1GA

Crystal structure of the c-terminal domain from the rous sarcoma virus capsid protein: high ph
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
b'GPWADIMQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gag polyprotein
publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
total genus 24
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g1gA00
2XT1A 2XV6A 2BUOA 3DS1A 3G0VA 3G21A 2M8LA 4COPA 1AUMA 4PH0A 3DS5A 4U0EA 2ONTA 1A43A 1BAJA 5DCKA 5HGLA 3DS0A 4XROA 1EIAA 3DS2A 4QNBA 3H47A 4XRQA 4WYMA 3G29A 2LF4A 5HGMA 4PH1A 5JPAA 1EOQA 2M8NA 2KODA 2L6EA 3DS3A 3MGEA 3H4EA 2EIAA 2JYGA 3P05A 3NTEA 4U0DA 3G1IA 4XFZA 5HGNA 4U0AA 4U0BA 3DTJA 4U0CA 3LRYA 3G1GA 3VRLC 3G26A 2JYLA 2XXMA 3G28A 5I4TG 1QRJA 4M0IA 3DPHA 3DS4A 1D1DA 2M8PA 4U0FA 4COCA 4XFYA 4XFXA 4IPYA 2JO0A 5HGOA 1A8OA 1E6JP
chains in the Genus database with same CATH superfamily
2PEKA 1HY8A 2JAZA 2MR8A 4PH0A 2VLPA 1BAJA 2MVUA 2PY8A 4XRQA 4MRTC 2Z45A 1IUQA 2MVVA 1YI2P 1YJ9P 2FHSC 3G1IA 2KOQA 1YHQP 1L0HA 1W2BO 3CCRP 4UHPB 2LKIA 1NQ4A 2BUOA 2VLQA 1UJZA 1Q7YQ 2K2QA 2MD9A 2CGQA 2M8NA 3HZQA 2FVAA 3DS3A 3NTEA 2KGDA 1Q82Q 5KP8B 2GZIA 1YIJP 4NEOA 7CEIA 4BPHA 2NO8A 2K0XA 2N6ZA 3DS2A 1VQ6P 1YITP 3GKLC 2EFJA 2GDWA 2PEIA 3LMOA 2JGPA 2N98A 2MY5A 2WPTA 1DNYA 4H2WC 1M6NA 5BS2A 1M1KQ 1Z6MA 2KOSA 3DS0A 5EW5E 2K0DX 4BPFA 5HV8A 1BXIA 1Q81Q 3CE7A 1F80D 3E2DA 4XFZA 5F2OA 1S72P 4PWVB 4XFXA 1K8AQ 4IZ6A 2DGYA 2LIUA 2KGAA 2GZGA 2FVEA 3H47A 1VQMP 5KP6B 5JPAA 1L0IA 5F2KA 1UNKA 2QEXP 5HGOA 3MGEA 1EMVA 3OW2O 1E0HA 1ZNVA 3I56P 1KC8Q 3H0DA 2FAEA 2JQ4A 2GDXA 2GZEA 4U0BA 1FR2A 4XFYA 2KOOA 3EJDA 2FVFA 4QKOA 1X3OA 3DS1A 3G0VA 4COPA 2KWLA 4CA3A 3CCUP 5DCKA 2M5RA 5HVCA 3CC4P 2OTLP 2QNWA 2AF8A 2PEOA 3VRLC 2LIWA 1JJ2O 3G6EP 1VQ9P 1AF8A 2N6YA 4H2XC 2Z46A 1YJWP 1ZMBA 2MR7A 1K73Q 5HGLA 4WYMA 4PH1A 1K9MQ 3RG6C 2L9FA 2CG5B 2N5IA 3NY7B 3CCQP 2FACA 2KG8A 1GPJA 2KOPA 4COCA 2JB0A 2AFEA 5KP7B 2OTJP 3GZLA 1K30A 2E1MA 2X2BA 2VLOA 1N8RQ 1VHNA 3G71P 2LPKA 3CD6P 1KQSO 3GJNA 3B5IA 3G26A 4M0IA 2XZ0D 2DNWA 4BPGA 4R0MA 2M8LA 4U0EA 2JBGA 2K5XA 2JU1A 2PEJA 4QNBA 2LL8A 2Z44A 2EHSA 3P05A 5HGNA 5EJDA 2QA4P 2OARA 2GZJA 3Q20A 3G28A 5I4TG 2PEMA 2KW2A 2ROQA 2XT1A 2XV6A 1MZ8A 2MF4A 3CCVP 4HKGA 2LF4A 5HGMA 2K93A 1QVFO 2AFDA 3CMEP 2L22A 3CPWO 2KR5A 1DV5A 4U0FA 2K94A 2PNGA 1VQKP 2L4BA 2PEQA 1KD1Q 2KG9A 1RO0A 2KORA 2GDYA 3CCEP 3CXCO 2L6EA 1GXGA 1M6EX 4U0DA 2ERHA 3M1MA 1IMQA 3G1GA 2CNRA 2XXMA 4DG9A 2M8PA 2FQ1A 2KGEA 3EJEA 2JU2A 2BHVA 1EIAA 1HQBA 2N50A 3EJBA 1T8KA 1EOQA 3HYBA 1VQ7P 1VKUA 4F37A 4H2YC 3CCLP 2L0QA 2K92A 1A8OA 1E6JP 1Q86Q 2LMLA 2LTEA 1YJNP 2K0YA 2N5HA 5F2NA 3G4SP 1M90Q 2LOLA 3H4EA 1VQOP 2GZFA 1RNIA 3LRYA 1VQLP 1QRJA 1D1DA 2EHTA 2JO0A 1OR5A 1IMPA 1AYIA 3G21A 2CWOA 1VQPP 1AUMA 4GR2A 3DS5A 1QVGO 2ONTA 5BS1A 3CC7P 1VQ4P 3G29A 1VQNP 3CCSP 1NJIQ 2KG6A 2FADA 2EIAA 1KLPA 2AVAA 3DTJA 1RO2A 1VQ8P 2FQ0A 2CQ8A 3DPHA 5CZDB 4GR6A 4IPYA 3B4QA 3WBHA 4PXHB 2KGCA 2PENA 1GXHA 3RG2A 2EG5A 3CC2P 2FQ2A 2VLNA 3GZMA 1VQ5P 1A43A 1CEIA 3U43A 4XROA 3CCMP 2P9XA 2XZ1C 1ACPA 2KODA 1M74A 2VSQA 2JYGA 4U0AA 4U0CA 2GYKA 2JYLA 3DS4A 3I55P 3CMAP 3CCJP
chains in the Genus database with same CATH topology
2PEKA 2OTJP 2DGYA 1K30A 2E1MA 4PH0A 1BAJA 2BHVA 1EIAA 2PY8A 3H47A 4XRQA 1VQMP 5JPAA 1N8RQ 1EOQA 3HYBA 2Z45A 1IUQA 5F2KA 3G71P 1YI2P 1VQ7P 1YJ9P 3CD6P 3G1IA 1KQSO 3B5IA 3G26A 2QEXP 4M0IA 3CCLP 1YHQP 1W2BO 5HGOA 3CCRP 3MGEA 1A8OA 1E6JP 2BUOA 1Q86Q 2M8LA 3OW2O 4U0EA 1YJNP 3I56P 1KC8Q 5F2NA 2PEJA 3H0DA 4QNBA 3G4SP 1M90Q 2Z44A 1Q7YQ 2M8NA 3HZQA 3DS3A 3H4EA 1VQOP 3P05A 3NTEA 5HGNA 2QA4P 2OARA 4U0BA 1RNIA 1Q82Q 3LRYA 1VQLP 3Q20A 3G28A 5I4TG 1QRJA 2PEMA 1D1DA 4XFYA 1YIJP 2JO0A 2XT1A 2CWOA 2XV6A 3DS1A 3G0VA 3G21A 4COPA 1VQPP 1AUMA 4GR2A 3CCUP 3DS5A 1QVGO 2ONTA 5DCKA 5BS1A 3CC7P 1VQ4P 3CCVP 3DS2A 1VQ6P 3G29A 3CC4P 2OTLP 2LF4A 5HGMA 1YITP 1VQNP 3CCSP 1NJIQ 2EFJA 2EIAA 2PEIA 2PEOA 1QVFO 3DTJA 1RO2A 1VQ8P 3VRLC 3CMEP 3CPWO 1JJ2O 3DPHA 3G6EP 4U0FA 1VQ9P 4GR6A 4IPYA 1M6NA 3WBHA 2Z46A 5BS2A 1YJWP 1M1KQ 1ZMBA 2PENA 2EG5A 3CC2P 1VQKP 1K73Q 2PEQA 1KD1Q 1A43A 5HGLA 1VQ5P 3DS0A 4XROA 3CCMP 1RO0A 2P9XA 4WYMA 4PH1A 1Q81Q 3CCEP 1K9MQ 3CXCO 3RG6C 2KODA 1M74A 2L6EA 2JYGA 1M6EX 3E2DA 4U0DA 4XFZA 3M1MA 4U0AA 4U0CA 3G1GA 5F2OA 2JYLA 2XXMA 3CCQP 1S72P 3DS4A 2M8PA 4COCA 3I55P 4XFXA 1K8AQ 3CMAP 3CCJP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XT1 A;  2XV6 A;  2BUO A;  3DS1 A;  3G0V A;  3G21 A;  2M8L A;  4COP A;  1AUM A;  4PH0 A;  3DS5 A;  4U0E A;  2ONT A;  1A43 A;  1BAJ A;  5DCK A;  5HGL A;  3DS0 A;  4XRO A;  1EIA A;  3DS2 A;  4QNB A;  3H47 A;  4XRQ A;  4WYM A;  3G29 A;  2LF4 A;  5HGM A;  4PH1 A;  5JPA A;  1EOQ A;  2M8N A;  2KOD A;  2L6E A;  3DS3 A;  3MGE A;  3H4E A;  2EIA A;  2JYG A;  3P05 A;  3NTE A;  4U0D A;  3G1I A;  4XFZ A;  5HGN A;  4U0A A;  4U0B A;  3DTJ A;  4U0C A;  3LRY A;  3G1G A;  3VRL C;  3G26 A;  2JYL A;  2XXM A;  3G28 A;  5I4T G;  1QRJ A;  4M0I A;  3DPH A;  3DS4 A;  1D1D A;  2M8P A;  4U0F A;  4COC A;  4XFY A;  4XFX A;  4IPY A;  2JO0 A;  5HGO A;  1A8O A;  1E6J P; 
#chains in the Genus database with same CATH topology
 2PEK A;  1HY8 A;  2JAZ A;  2MR8 A;  4PH0 A;  2VLP A;  1BAJ A;  2MVU A;  2PY8 A;  4XRQ A;  4MRT C;  2Z45 A;  1IUQ A;  2MVV A;  1YI2 P;  1YJ9 P;  2FHS C;  3G1I A;  2KOQ A;  1YHQ P;  1L0H A;  1W2B O;  3CCR P;  4UHP B;  2LKI A;  1NQ4 A;  2BUO A;  2VLQ A;  1UJZ A;  1Q7Y Q;  2K2Q A;  2MD9 A;  2CGQ A;  2M8N A;  3HZQ A;  2FVA A;  3DS3 A;  3NTE A;  2KGD A;  1Q82 Q;  5KP8 B;  2GZI A;  1YIJ P;  4NEO A;  7CEI A;  4BPH A;  2NO8 A;  2K0X A;  2N6Z A;  3DS2 A;  1VQ6 P;  1YIT P;  3GKL C;  2EFJ A;  2GDW A;  2PEI A;  3LMO A;  2JGP A;  2N98 A;  2MY5 A;  2WPT A;  1DNY A;  4H2W C;  1M6N A;  5BS2 A;  1M1K Q;  1Z6M A;  2KOS A;  3DS0 A;  5EW5 E;  2K0D X;  4BPF A;  5HV8 A;  1BXI A;  1Q81 Q;  3CE7 A;  1F80 D;  3E2D A;  4XFZ A;  5F2O A;  1S72 P;  4PWV B;  4XFX A;  1K8A Q;  4IZ6 A;  2DGY A;  2LIU A;  2KGA A;  2GZG A;  2FVE A;  3H47 A;  1VQM P;  5KP6 B;  5JPA A;  1L0I A;  5F2K A;  1UNK A;  2QEX P;  5HGO A;  3MGE A;  1EMV A;  3OW2 O;  1E0H A;  1ZNV A;  3I56 P;  1KC8 Q;  3H0D A;  2FAE A;  2JQ4 A;  2GDX A;  2GZE A;  4U0B A;  1FR2 A;  4XFY A;  2KOO A;  3EJD A;  2FVF A;  4QKO A;  1X3O A;  3DS1 A;  3G0V A;  4COP A;  2KWL A;  4CA3 A;  3CCU P;  5DCK A;  2M5R A;  5HVC A;  3CC4 P;  2OTL P;  2QNW A;  2AF8 A;  2PEO A;  3VRL C;  2LIW A;  1JJ2 O;  3G6E P;  1VQ9 P;  1AF8 A;  2N6Y A;  4H2X C;  2Z46 A;  1YJW P;  1ZMB A;  2MR7 A;  1K73 Q;  5HGL A;  4WYM A;  4PH1 A;  1K9M Q;  3RG6 C;  2L9F A;  2CG5 B;  2N5I A;  3NY7 B;  3CCQ P;  2FAC A;  2KG8 A;  1GPJ A;  2KOP A;  4COC A;  2JB0 A;  2AFE A;  5KP7 B;  2OTJ P;  3GZL A;  1K30 A;  2E1M A;  2X2B A;  2VLO A;  1N8R Q;  1VHN A;  3G71 P;  2LPK A;  3CD6 P;  1KQS O;  3GJN A;  3B5I A;  3G26 A;  4M0I A;  2XZ0 D;  2DNW A;  4BPG A;  4R0M A;  2M8L A;  4U0E A;  2JBG A;  2K5X A;  2JU1 A;  2PEJ A;  4QNB A;  2LL8 A;  2Z44 A;  2EHS A;  3P05 A;  5HGN A;  5EJD A;  2QA4 P;  2OAR A;  2GZJ A;  3Q20 A;  3G28 A;  5I4T G;  2PEM A;  2KW2 A;  2ROQ A;  2XT1 A;  2XV6 A;  1MZ8 A;  2MF4 A;  3CCV P;  4HKG A;  2LF4 A;  5HGM A;  2K93 A;  1QVF O;  2AFD A;  3CME P;  2L22 A;  3CPW O;  2KR5 A;  1DV5 A;  4U0F A;  2K94 A;  2PNG A;  1VQK P;  2L4B A;  2PEQ A;  1KD1 Q;  2KG9 A;  1RO0 A;  2KOR A;  2GDY A;  3CCE P;  3CXC O;  2L6E A;  1GXG A;  1M6E X;  4U0D A;  2ERH A;  3M1M A;  1IMQ A;  3G1G A;  2CNR A;  2XXM A;  4DG9 A;  2M8P A;  2FQ1 A;  2KGE A;  3EJE A;  2JU2 A;  2BHV A;  1EIA A;  1HQB A;  2N50 A;  3EJB A;  1T8K A;  1EOQ A;  3HYB A;  1VQ7 P;  1VKU A;  4F37 A;  4H2Y C;  3CCL P;  2L0Q A;  2K92 A;  1A8O A;  1E6J P;  1Q86 Q;  2LML A;  2LTE A;  1YJN P;  2K0Y A;  2N5H A;  5F2N A;  3G4S P;  1M90 Q;  2LOL A;  3H4E A;  1VQO P;  2GZF A;  1RNI A;  3LRY A;  1VQL P;  1QRJ A;  1D1D A;  2EHT A;  2JO0 A;  1OR5 A;  1IMP A;  1AYI A;  3G21 A;  2CWO A;  1VQP P;  1AUM A;  4GR2 A;  3DS5 A;  1QVG O;  2ONT A;  5BS1 A;  3CC7 P;  1VQ4 P;  3G29 A;  1VQN P;  3CCS P;  1NJI Q;  2KG6 A;  2FAD A;  2EIA A;  1KLP A;  2AVA A;  3DTJ A;  1RO2 A;  1VQ8 P;  2FQ0 A;  2CQ8 A;  3DPH A;  5CZD B;  4GR6 A;  4IPY A;  3B4Q A;  3WBH A;  4PXH B;  2KGC A;  2PEN A;  1GXH A;  3RG2 A;  2EG5 A;  3CC2 P;  2FQ2 A;  2VLN A;  3GZM A;  1VQ5 P;  1A43 A;  1CEI A;  3U43 A;  4XRO A;  3CCM P;  2P9X A;  2XZ1 C;  1ACP A;  2KOD A;  1M74 A;  2VSQ A;  2JYG A;  4U0A A;  4U0C A;  2GYK A;  2JYL A;  3DS4 A;  3I55 P;  3CMA P;  3CCJ P; 
#chains in the Genus database with same CATH homology
 2PEK A;  2OTJ P;  2DGY A;  1K30 A;  2E1M A;  4PH0 A;  1BAJ A;  2BHV A;  1EIA A;  2PY8 A;  3H47 A;  4XRQ A;  1VQM P;  5JPA A;  1N8R Q;  1EOQ A;  3HYB A;  2Z45 A;  1IUQ A;  5F2K A;  3G71 P;  1YI2 P;  1VQ7 P;  1YJ9 P;  3CD6 P;  3G1I A;  1KQS O;  3B5I A;  3G26 A;  2QEX P;  4M0I A;  3CCL P;  1YHQ P;  1W2B O;  5HGO A;  3CCR P;  3MGE A;  1A8O A;  1E6J P;  2BUO A;  1Q86 Q;  2M8L A;  3OW2 O;  4U0E A;  1YJN P;  3I56 P;  1KC8 Q;  5F2N A;  2PEJ A;  3H0D A;  4QNB A;  3G4S P;  1M90 Q;  2Z44 A;  1Q7Y Q;  2M8N A;  3HZQ A;  3DS3 A;  3H4E A;  1VQO P;  3P05 A;  3NTE A;  5HGN A;  2QA4 P;  2OAR A;  4U0B A;  1RNI A;  1Q82 Q;  3LRY A;  1VQL P;  3Q20 A;  3G28 A;  5I4T G;  1QRJ A;  2PEM A;  1D1D A;  4XFY A;  1YIJ P;  2JO0 A;  2XT1 A;  2CWO A;  2XV6 A;  3DS1 A;  3G0V A;  3G21 A;  4COP A;  1VQP P;  1AUM A;  4GR2 A;  3CCU P;  3DS5 A;  1QVG O;  2ONT A;  5DCK A;  5BS1 A;  3CC7 P;  1VQ4 P;  3CCV P;  3DS2 A;  1VQ6 P;  3G29 A;  3CC4 P;  2OTL P;  2LF4 A;  5HGM A;  1YIT P;  1VQN P;  3CCS P;  1NJI Q;  2EFJ A;  2EIA A;  2PEI A;  2PEO A;  1QVF O;  3DTJ A;  1RO2 A;  1VQ8 P;  3VRL C;  3CME P;  3CPW O;  1JJ2 O;  3DPH A;  3G6E P;  4U0F A;  1VQ9 P;  4GR6 A;  4IPY A;  1M6N A;  3WBH A;  2Z46 A;  5BS2 A;  1YJW P;  1M1K Q;  1ZMB A;  2PEN A;  2EG5 A;  3CC2 P;  1VQK P;  1K73 Q;  2PEQ A;  1KD1 Q;  1A43 A;  5HGL A;  1VQ5 P;  3DS0 A;  4XRO A;  3CCM P;  1RO0 A;  2P9X A;  4WYM A;  4PH1 A;  1Q81 Q;  3CCE P;  1K9M Q;  3CXC O;  3RG6 C;  2KOD A;  1M74 A;  2L6E A;  2JYG A;  1M6E X;  3E2D A;  4U0D A;  4XFZ A;  3M1M A;  4U0A A;  4U0C A;  3G1G A;  5F2O A;  2JYL A;  2XXM A;  3CCQ P;  1S72 P;  3DS4 A;  2M8P A;  4COC A;  3I55 P;  4XFX A;  1K8A Q;  3CMA P;  3CCJ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...