3G1GA

Crystal structure of the c-terminal domain from the rous sarcoma virus capsid protein: high ph
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
GPWADIMQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 24
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g1gA00
3DS1A 3DS4A 3G0VA 3H4EA 1EOQA 4U0CA 5HGLA 3G28A 4COPA 3DS5A 3DS3A 4XROA 1BAJA 5JPAA 1EIAA 4WYMA 3DS2A 2XT1A 4PH1A 2EIAA 3LRYA 4U0AA 3G1GA 2ONTA 3DTJA 2LF4A 2M8PA 4M0IA 3G1IA 1D1DA 1A8OA 4XFZA 5HGMA 2BUOA 4U0DA 3P05A 3MGEA 2JYGA 4XFXA 2M8LA 2JO0A 2KODA 4U0BA 3G29A 1A43A 5HGNA 2L6EA 2M8NA 1QRJA 4U0FA 3G26A 2XV6A 5DCKA 2JYLA 3DPHA 2XXMA 3H47A 5I4TG 4QNBA 4PH0A 4IPYA 3VRLC 3G21A 1E6JP 4XFYA 3NTEA 4U0EA 4XRQA 1AUMA 3DS0A 5HGOA 4COCA
chains in the Genus database with same CATH superfamily
2KOPA 3DS1A 1K73Q 4U0CA 1VQ5P 2CWOA 1ZMBA 1JJ2O 2FADA 3CCEP 2CGQA 1Q86Q 2VLQA 2GZGA 3EJBA 3M1MA 4PWVB 2JGPA 3NY7B 1AUMA 2LTEA 2CG5B 2FHSC 2KORA 1M6EX 2KW2A 1CEIA 2GZJA 2MVVA 3MGEA 2EFJA 2OARA 1VQ7P 2L6EA 1KC8Q 1OR5A 2XV6A 2JBGA 3VRLC 2PNGA 2MF4A 1GXHA 3G0VA 3H4EA 1NJIQ 1YJNP 1NQ4A 2X2BA 2N6YA 1VQNP 1ACPA 3CCMP 7CEIA 1QRJA 3CCVP 2LKIA 4IPYA 3CPWO 4U0EA 3I56P 2QNWA 3DS2A 2VSQA 2MR8A 5BS1A 1KLPA 1ZNVA 2GZIA 4XFXA 1Q82Q 2CNRA 2KODA 4U0BA 1KQSO 2KG8A 3H47A 4PH0A 1S72P 1VQKP 3DS4A 1M90Q 2KGCA 4COPA 1T8KA 1X3OA 3CE7A 5HVCA 2EIAA 3LRYA 3DTJA 2LF4A 2M8PA 2KOSA 3G1IA 1A8OA 5CZDB 2KWLA 1UJZA 1Z6MA 2MY5A 2JO0A 2FAEA 3GKLC 1BXIA 5DCKA 2JYLA 2JU2A 3G21A 2PEOA 5HV8A 1VQ6P 1EOQA 2BHVA 2L9FA 4BPFA 3CC7P 2P9XA 4U0AA 2GZEA 1VHNA 2AFEA 2LPKA 1VQ8P 1K9MQ 3E2DA 4H2XC 2KGEA 4BPHA 3OW2O 3CXCO 3GZLA 1AF8A 2K5XA 4F37A 3H0DA 3DS5A 1EIAA 2FACA 1GPJA 4NEOA 1AYIA 1M74A 1A43A 5HGNA 3CC4P 1DV5A 4MRTC 2PEKA 1YITP 1RO0A 2EHTA 2PEJA 2JB0A 2K93A 3NTEA 2N50A 2FVFA 3G28A 1BAJA 2FQ2A 3CCSP 1YJWP 2XZ1C 4IZ6A 4U0DA 3P05A 2GZFA 2GYKA 2LIUA 3CCJP 2XZ0D 2L22A 1IMPA 2LMLA 2K2QA 2LL8A 4XROA 2GDWA 1VQ4P 4PXHB 1EMVA 2Z46A 1VQMP 2N5IA 4HKGA 4H2YC 2K0DX 2N5HA 4XFYA 3CC2P 2FVEA 3DS0A 2E1MA 2LIWA 1N8RQ 4H2WC 1VQPP 2L4BA 2Z45A 2Z44A 1M6NA 1FR2A 2MD9A 2FQ0A 2ROQA 2PY8A 4UHPB 1YHQP 2ERHA 5I4TG 4CA3A 3WBHA 5HGOA 2N6ZA 1Q81Q 1YI2P 1KD1Q 2GDYA 4PH1A 3LMOA 2AFDA 3CCQP 3HYBA 4M0IA 5HGMA 2K94A 2KGAA 3EJDA 1VKUA 1HY8A 3G29A 1L0IA 2M8NA 4U0FA 3CCUP 4R0MA 1Q7YQ 5BS2A 5HGLA 5KP8B 2KOOA 3G4SP 1RNIA 2GDXA 4BPGA 2WPTA 2ONTA 2KG9A 4XFZA 3HZQA 5EW5E 2CQ8A 1DNYA 3EJEA 2JAZA 2KR5A 5F2KA 2AF8A 3G26A 4COCA 1QVGO 3DS3A 2EHSA 1HQBA 2L0QA 4WYMA 2LOLA 2XT1A 2VLNA 2NO8A 3RG6C 2BUOA 1GXGA 2MVUA 1M1KQ 2EG5A 1VQLP 2DNWA 1L0HA 3CMAP 2DGYA 1IUQA 5F2OA 2KGDA 1QVFO 3GZMA 1E6JP 3CMEP 3G1GA 4GR2A 2PEQA 1K8AQ 4GR6A 3CCLP 2OTJP 2K0YA 3B5IA 1YIJP 1K30A 1E0HA 3I55P 2AVAA 1YJ9P 1MZ8A 3U43A 2XXMA 4QNBA 2FVAA 2VLPA 1VQ9P 2K92A 5KP7B 2QA4P 2OTLP 2MR7A 1W2BO 5EJDA 1RO2A 3B4QA 2JYGA 2JU1A 3G6EP 3RG2A 2PEIA 1UNKA 2QEXP 4XRQA 1IMQA 5JPAA 2PEMA 2VLOA 1D1DA 3GJNA 5F2NA 4DG9A 3G71P 2JQ4A 2M8LA 2KOQA 4QKOA 3CCRP 2M5RA 2N98A 3DPHA 3Q20A 2PENA 1F80D 2FQ1A 2K0XA 5KP6B 3CD6P 1VQOP 2KG6A
chains in the Genus database with same CATH topology
3DS1A 3DS4A 1QVGO 4U0CA 1K73Q 1M90Q 4COPA 3DS3A 4XROA 1VQ5P 4WYMA 2XT1A 2EIAA 3LRYA 2CWOA 1VQ4P 3DTJA 2LF4A 2M8PA 3G1IA 1ZMBA 1A8OA 3RG6C 2BUOA 1M1KQ 2EG5A 1VQLP 2Z46A 1JJ2O 3CMAP 2JO0A 3CCEP 1VQMP 1Q86Q 2DGYA 5DCKA 1IUQA 2JYLA 3M1MA 5F2OA 1QVFO 3G21A 2PEOA 1E6JP 3CMEP 4XFYA 3CC2P 1AUMA 3G1GA 3DS0A 4GR2A 1VQ6P 2PEQA 2E1MA 1EOQA 2BHVA 1N8RQ 3CC7P 1K8AQ 4GR6A 2P9XA 1VQPP 1M6EX 4U0AA 3CCLP 2Z45A 2OTJP 3B5IA 2Z44A 3MGEA 1M6NA 2EFJA 1YIJP 1K30A 2OARA 1VQ7P 1VQ8P 3I55P 2L6EA 1K9MQ 1KC8Q 2PY8A 1YJ9P 2XV6A 1YHQP 2XXMA 3E2DA 5I4TG 4QNBA 3WBHA 3VRLC 3OW2O 1VQ9P 3CXCO 5HGOA 2QA4P 3G0VA 3H4EA 3H0DA 1Q81Q 3DS5A 1YI2P 2OTLP 1KD1Q 1EIAA 4PH1A 1W2BO 1NJIQ 1YJNP 1RO2A 3CCQP 3HYBA 4M0IA 1VQNP 5HGMA 3CCMP 2JYGA 3G29A 1M74A 1A43A 5HGNA 3CC4P 2M8NA 1QRJA 4U0FA 3G6EP 3CCUP 2PEIA 3CCVP 2PEKA 4IPYA 3CPWO 1YITP 1RO0A 2PEJA 3NTEA 4U0EA 3I56P 4XRQA 2QEXP 1Q7YQ 5BS2A 5HGLA 3G4SP 3G28A 1RNIA 1BAJA 5JPAA 3CCSP 2PEMA 3DS2A 1YJWP 2ONTA 1D1DA 4XFZA 5BS1A 4U0DA 5F2NA 3P05A 3HZQA 3G71P 4XFXA 2M8LA 1Q82Q 2KODA 4U0BA 3CCRP 1KQSO 3DPHA 3H47A 3Q20A 4PH0A 3CCJP 2PENA 1S72P 3CD6P 5F2KA 1VQKP 1VQOP 3G26A 4COCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS1 A;  3DS4 A;  3G0V A;  3H4E A;  1EOQ A;  4U0C A;  5HGL A;  3G28 A;  4COP A;  3DS5 A;  3DS3 A;  4XRO A;  1BAJ A;  5JPA A;  1EIA A;  4WYM A;  3DS2 A;  2XT1 A;  4PH1 A;  2EIA A;  3LRY A;  4U0A A;  3G1G A;  2ONT A;  3DTJ A;  2LF4 A;  2M8P A;  4M0I A;  3G1I A;  1D1D A;  1A8O A;  4XFZ A;  5HGM A;  2BUO A;  4U0D A;  3P05 A;  3MGE A;  2JYG A;  4XFX A;  2M8L A;  2JO0 A;  2KOD A;  4U0B A;  3G29 A;  1A43 A;  5HGN A;  2L6E A;  2M8N A;  1QRJ A;  4U0F A;  3G26 A;  2XV6 A;  5DCK A;  2JYL A;  3DPH A;  2XXM A;  3H47 A;  5I4T G;  4QNB A;  4PH0 A;  4IPY A;  3VRL C;  3G21 A;  1E6J P;  4XFY A;  3NTE A;  4U0E A;  4XRQ A;  1AUM A;  3DS0 A;  5HGO A;  4COC A; 
#chains in the Genus database with same CATH topology
 2KOP A;  3DS1 A;  1K73 Q;  4U0C A;  1VQ5 P;  2CWO A;  1ZMB A;  1JJ2 O;  2FAD A;  3CCE P;  2CGQ A;  1Q86 Q;  2VLQ A;  2GZG A;  3EJB A;  3M1M A;  4PWV B;  2JGP A;  3NY7 B;  1AUM A;  2LTE A;  2CG5 B;  2FHS C;  2KOR A;  1M6E X;  2KW2 A;  1CEI A;  2GZJ A;  2MVV A;  3MGE A;  2EFJ A;  2OAR A;  1VQ7 P;  2L6E A;  1KC8 Q;  1OR5 A;  2XV6 A;  2JBG A;  3VRL C;  2PNG A;  2MF4 A;  1GXH A;  3G0V A;  3H4E A;  1NJI Q;  1YJN P;  1NQ4 A;  2X2B A;  2N6Y A;  1VQN P;  1ACP A;  3CCM P;  7CEI A;  1QRJ A;  3CCV P;  2LKI A;  4IPY A;  3CPW O;  4U0E A;  3I56 P;  2QNW A;  3DS2 A;  2VSQ A;  2MR8 A;  5BS1 A;  1KLP A;  1ZNV A;  2GZI A;  4XFX A;  1Q82 Q;  2CNR A;  2KOD A;  4U0B A;  1KQS O;  2KG8 A;  3H47 A;  4PH0 A;  1S72 P;  1VQK P;  3DS4 A;  1M90 Q;  2KGC A;  4COP A;  1T8K A;  1X3O A;  3CE7 A;  5HVC A;  2EIA A;  3LRY A;  3DTJ A;  2LF4 A;  2M8P A;  2KOS A;  3G1I A;  1A8O A;  5CZD B;  2KWL A;  1UJZ A;  1Z6M A;  2MY5 A;  2JO0 A;  2FAE A;  3GKL C;  1BXI A;  5DCK A;  2JYL A;  2JU2 A;  3G21 A;  2PEO A;  5HV8 A;  1VQ6 P;  1EOQ A;  2BHV A;  2L9F A;  4BPF A;  3CC7 P;  2P9X A;  4U0A A;  2GZE A;  1VHN A;  2AFE A;  2LPK A;  1VQ8 P;  1K9M Q;  3E2D A;  4H2X C;  2KGE A;  4BPH A;  3OW2 O;  3CXC O;  3GZL A;  1AF8 A;  2K5X A;  4F37 A;  3H0D A;  3DS5 A;  1EIA A;  2FAC A;  1GPJ A;  4NEO A;  1AYI A;  1M74 A;  1A43 A;  5HGN A;  3CC4 P;  1DV5 A;  4MRT C;  2PEK A;  1YIT P;  1RO0 A;  2EHT A;  2PEJ A;  2JB0 A;  2K93 A;  3NTE A;  2N50 A;  2FVF A;  3G28 A;  1BAJ A;  2FQ2 A;  3CCS P;  1YJW P;  2XZ1 C;  4IZ6 A;  4U0D A;  3P05 A;  2GZF A;  2GYK A;  2LIU A;  3CCJ P;  2XZ0 D;  2L22 A;  1IMP A;  2LML A;  2K2Q A;  2LL8 A;  4XRO A;  2GDW A;  1VQ4 P;  4PXH B;  1EMV A;  2Z46 A;  1VQM P;  2N5I A;  4HKG A;  4H2Y C;  2K0D X;  2N5H A;  4XFY A;  3CC2 P;  2FVE A;  3DS0 A;  2E1M A;  2LIW A;  1N8R Q;  4H2W C;  1VQP P;  2L4B A;  2Z45 A;  2Z44 A;  1M6N A;  1FR2 A;  2MD9 A;  2FQ0 A;  2ROQ A;  2PY8 A;  4UHP B;  1YHQ P;  2ERH A;  5I4T G;  4CA3 A;  3WBH A;  5HGO A;  2N6Z A;  1Q81 Q;  1YI2 P;  1KD1 Q;  2GDY A;  4PH1 A;  3LMO A;  2AFD A;  3CCQ P;  3HYB A;  4M0I A;  5HGM A;  2K94 A;  2KGA A;  3EJD A;  1VKU A;  1HY8 A;  3G29 A;  1L0I A;  2M8N A;  4U0F A;  3CCU P;  4R0M A;  1Q7Y Q;  5BS2 A;  5HGL A;  5KP8 B;  2KOO A;  3G4S P;  1RNI A;  2GDX A;  4BPG A;  2WPT A;  2ONT A;  2KG9 A;  4XFZ A;  3HZQ A;  5EW5 E;  2CQ8 A;  1DNY A;  3EJE A;  2JAZ A;  2KR5 A;  5F2K A;  2AF8 A;  3G26 A;  4COC A;  1QVG O;  3DS3 A;  2EHS A;  1HQB A;  2L0Q A;  4WYM A;  2LOL A;  2XT1 A;  2VLN A;  2NO8 A;  3RG6 C;  2BUO A;  1GXG A;  2MVU A;  1M1K Q;  2EG5 A;  1VQL P;  2DNW A;  1L0H A;  3CMA P;  2DGY A;  1IUQ A;  5F2O A;  2KGD A;  1QVF O;  3GZM A;  1E6J P;  3CME P;  3G1G A;  4GR2 A;  2PEQ A;  1K8A Q;  4GR6 A;  3CCL P;  2OTJ P;  2K0Y A;  3B5I A;  1YIJ P;  1K30 A;  1E0H A;  3I55 P;  2AVA A;  1YJ9 P;  1MZ8 A;  3U43 A;  2XXM A;  4QNB A;  2FVA A;  2VLP A;  1VQ9 P;  2K92 A;  5KP7 B;  2QA4 P;  2OTL P;  2MR7 A;  1W2B O;  5EJD A;  1RO2 A;  3B4Q A;  2JYG A;  2JU1 A;  3G6E P;  3RG2 A;  2PEI A;  1UNK A;  2QEX P;  4XRQ A;  1IMQ A;  5JPA A;  2PEM A;  2VLO A;  1D1D A;  3GJN A;  5F2N A;  4DG9 A;  3G71 P;  2JQ4 A;  2M8L A;  2KOQ A;  4QKO A;  3CCR P;  2M5R A;  2N98 A;  3DPH A;  3Q20 A;  2PEN A;  1F80 D;  2FQ1 A;  2K0X A;  5KP6 B;  3CD6 P;  1VQO P;  2KG6 A; 
#chains in the Genus database with same CATH homology
 3DS1 A;  3DS4 A;  1QVG O;  4U0C A;  1K73 Q;  1M90 Q;  4COP A;  3DS3 A;  4XRO A;  1VQ5 P;  4WYM A;  2XT1 A;  2EIA A;  3LRY A;  2CWO A;  1VQ4 P;  3DTJ A;  2LF4 A;  2M8P A;  3G1I A;  1ZMB A;  1A8O A;  3RG6 C;  2BUO A;  1M1K Q;  2EG5 A;  1VQL P;  2Z46 A;  1JJ2 O;  3CMA P;  2JO0 A;  3CCE P;  1VQM P;  1Q86 Q;  2DGY A;  5DCK A;  1IUQ A;  2JYL A;  3M1M A;  5F2O A;  1QVF O;  3G21 A;  2PEO A;  1E6J P;  3CME P;  4XFY A;  3CC2 P;  1AUM A;  3G1G A;  3DS0 A;  4GR2 A;  1VQ6 P;  2PEQ A;  2E1M A;  1EOQ A;  2BHV A;  1N8R Q;  3CC7 P;  1K8A Q;  4GR6 A;  2P9X A;  1VQP P;  1M6E X;  4U0A A;  3CCL P;  2Z45 A;  2OTJ P;  3B5I A;  2Z44 A;  3MGE A;  1M6N A;  2EFJ A;  1YIJ P;  1K30 A;  2OAR A;  1VQ7 P;  1VQ8 P;  3I55 P;  2L6E A;  1K9M Q;  1KC8 Q;  2PY8 A;  1YJ9 P;  2XV6 A;  1YHQ P;  2XXM A;  3E2D A;  5I4T G;  4QNB A;  3WBH A;  3VRL C;  3OW2 O;  1VQ9 P;  3CXC O;  5HGO A;  2QA4 P;  3G0V A;  3H4E A;  3H0D A;  1Q81 Q;  3DS5 A;  1YI2 P;  2OTL P;  1KD1 Q;  1EIA A;  4PH1 A;  1W2B O;  1NJI Q;  1YJN P;  1RO2 A;  3CCQ P;  3HYB A;  4M0I A;  1VQN P;  5HGM A;  3CCM P;  2JYG A;  3G29 A;  1M74 A;  1A43 A;  5HGN A;  3CC4 P;  2M8N A;  1QRJ A;  4U0F A;  3G6E P;  3CCU P;  2PEI A;  3CCV P;  2PEK A;  4IPY A;  3CPW O;  1YIT P;  1RO0 A;  2PEJ A;  3NTE A;  4U0E A;  3I56 P;  4XRQ A;  2QEX P;  1Q7Y Q;  5BS2 A;  5HGL A;  3G4S P;  3G28 A;  1RNI A;  1BAJ A;  5JPA A;  3CCS P;  2PEM A;  3DS2 A;  1YJW P;  2ONT A;  1D1D A;  4XFZ A;  5BS1 A;  4U0D A;  5F2N A;  3P05 A;  3HZQ A;  3G71 P;  4XFX A;  2M8L A;  1Q82 Q;  2KOD A;  4U0B A;  3CCR P;  1KQS O;  3DPH A;  3H47 A;  3Q20 A;  4PH0 A;  3CCJ P;  2PEN A;  1S72 P;  3CD6 P;  5F2K A;  1VQK P;  1VQO P;  3G26 A;  4COC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...