3G1GA

Crystal structure of the c-terminal domain from the rous sarcoma virus capsid protein: high ph
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
GPWADIMQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Gag polyprotein
publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
total genus 24
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g1gA00
3DPHA 3DS0A 4PH1A 4WYMA 5DCKA 1D1DA 1BAJA 2M8LA 4U0AA 4XRQA 2JO0A 4IPYA 4QNBA 3G29A 1EIAA 4U0FA 4COPA 2L6EA 3DTJA 4PH0A 5JPAA 1A8OA 1AUMA 2EIAA 2XXMA 3G0VA 3NTEA 2LF4A 2JYGA 3VRLC 2KODA 3H47A 3MGEA 4U0DA 5HGMA 2XT1A 4COCA 3G1IA 3DS5A 3G26A 1EOQA 3G21A 2M8PA 3DS4A 5HGLA 4XFZA 5HGOA 1E6JP 2ONTA 3G1GA 3G28A 3DS3A 2M8NA 1QRJA 4M0IA 4U0BA 4XFXA 5HGNA 4XROA 5I4TG 1A43A 3DS1A 3LRYA 4XFYA 3P05A 3H4EA 2BUOA 2JYLA 3DS2A 2XV6A 4U0CA 4U0EA
chains in the Genus database with same CATH superfamily
3DPHA 1W2BO 2FVFA 2FQ1A 5KP6B 1VQ4P 1VQNP 1VQOP 3CE7A 3GKLC 1QRJA 2MVUA 3CC4P 3CPWO 3Q20A 2M5RA 5EJDA 1IUQA 2ERHA 3NTEA 3CCQP 1VQ5P 2K93A 3MGEA 2XT1A 4IZ6A 3CD6P 2L9FA 5HGNA 2LMLA 2K5XA 3LRYA 2FVAA 2P9XA 2ROQA 2PEMA 2MY5A 2PNGA 3H0DA 3U43A 1YITP 3RG2A 1HY8A 3CCEP 1AYIA 2KGAA 1VQ9P 2PEKA 1YJNP 4XFXA 4XROA 5F2KA 3EJDA 2LIWA 4BPHA 2MVVA 3CXCO 4GR6A 5F2NA 4COPA 1K8AQ 1A8OA 1YI2P 1ZMBA 4U0DA 2JGPA 5HGLA 2L4BA 5F2OA 2JYLA 1VQLP 2JU2A 3G6EP 2MF4A 1YIJP 1MZ8A 2JO0A 4BPGA 4BPFA 1KQSO 2JU1A 1L0HA 2CG5B 2LOLA 1ACPA 2XXMA 1T8KA 2KODA 3H47A 2Z45A 3CCUP 2PEOA 2JB0A 2M8PA 2GZFA 1OR5A 2GDWA 3G28A 2GZJA 4M0IA 3CCJP 1K73Q 2GZGA 1YJWP 2XV6A 2K0XA 4U0EA 5DCKA 3CCSP 1GXHA 2EG5A 4U0FA 2CQ8A 2N6YA 3LMOA 2MR7A 2ONTA 4H2WC 2KG6A 3DS3A 2M8NA 4U0BA 3CMAP 4H2YC 4U0CA 1ZNVA 2KORA 1S72P 4QNBA 3G29A 1VQMP 3NY7B 1CEIA 1NQ4A 2NO8A 3VRLC 2KR5A 3DS4A 4GR2A 5HGOA 2L0QA 1M90Q 2FADA 2X2BA 1L0IA 3CCVP 1Q7YQ 4QKOA 3EJBA 1KC8Q 2LKIA 1X3OA 2FVEA 1BAJA 2AFEA 2WPTA 2KW2A 4F37A 2LTEA 2GDXA 2K0DX 2JYGA 2VLNA 2OARA 1M6EX 4MRTC 1IMQA 3P05A 1UJZA 3GJNA 2FACA 3DS0A 4WYMA 2KOQA 4NEOA 5EW5E 1K30A 2L6EA 2OTJP 3DTJA 2KG8A 5JPAA 2JAZA 2KGDA 3G0VA 1RNIA 1Z6MA 4UHPB 2AF8A 1EOQA 1RO2A 3HYBA 3B4QA 1DNYA 2LIUA 5BS1A 1FR2A 2AFDA 5HVCA 3I55P 2KOPA 3CC7P 1YJ9P 2PEIA 3M1MA 2K0YA 4XFZA 1EMVA 2JBGA 3CMEP 2GZEA 2FQ2A 1UNKA 1YHQP 2VLPA 1HQBA 2BHVA 1Q81Q 2M8LA 1GXGA 4PH0A 3G71P 2N50A 2GZIA 3I56P 2Z44A 3DS5A 2K92A 1VHNA 2Z46A 5BS2A 3G1GA 2KOOA 2VLQA 2VSQA 3G4SP 1E0HA 2DNWA 3H4EA 1KD1Q 5KP8B 2XZ0D 1VQPP 2QEXP 1N8RQ 1QVFO 3RG6C 3G1IA 2KG9A 2N98A 1E6JP 4PWVB 2AVAA 4XFYA 3EJEA 1M6NA 1D1DA 4CA3A 4PH1A 1RO0A 1QVGO 4R0MA 2KWLA 1VQ8P 1VQKP 3CCRP 3WBHA 1F80D 2VLOA 5HGMA 2CNRA 3G26A 2PEQA 2K2QA 3HZQA 5HV8A 1GPJA 1KLPA 3DS1A 2GDYA 1NJIQ 2FAEA 1Q82Q 2EIAA 2OTLP 2LF4A 1M1KQ 2PY8A 3CCMP 2GYKA 3GZLA 2PEJA 2EHTA 2JQ4A 2MD9A 2EFJA 1VKUA 2MR8A 5KP7B 4U0AA 3CC2P 1M74A 3GZMA 1AF8A 1JJ2O 1VQ7P 2KOSA 1IMPA 3E2DA 2KGCA 2FQ0A 2DGYA 2LPKA 2FHSC 3G21A 2CGQA 4HKGA 1VQ6P 1BXIA 2N5IA 1K9MQ 3OW2O 5I4TG 1A43A 2LL8A 2N6ZA 2BUOA 7CEIA 2L22A 2EHSA 1DV5A 4XRQA 4H2XC 5CZDB 2QA4P 4IPYA 1EIAA 3B5IA 1AUMA 2XZ1C 4PXHB 4COCA 2QNWA 1Q86Q 2E1MA 2KGEA 2PENA 2K94A 2CWOA 2N5HA 4DG9A 3CCLP 3DS2A
chains in the Genus database with same CATH topology
3DPHA 3DS0A 4PH1A 1RO0A 4WYMA 3G6EP 1W2BO 1QVGO 1YIJP 2JO0A 1KQSO 1VQKP 1VQ8P 1K30A 2L6EA 1VQ4P 3CCRP 3DTJA 2OTJP 5JPAA 1VQNP 3WBHA 2XXMA 3G0VA 1VQOP 1RNIA 2KODA 3H47A 2Z45A 5HGMA 3CCUP 2PEOA 3G26A 2PEQA 1EOQA 2M8PA 1RO2A 3HZQA 3G28A 3HYBA 4M0IA 1QRJA 3CCJP 1K73Q 3DS1A 1YJWP 5BS1A 3CC4P 2XV6A 3CPWO 4U0EA 5DCKA 3CCSP 3Q20A 2EG5A 1NJIQ 1IUQA 3I55P 1Q82Q 4U0FA 3CC7P 2EIAA 2PEIA 1YJ9P 2OTLP 3NTEA 3CCQP 2LF4A 1VQ5P 1M1KQ 3M1MA 3MGEA 2XT1A 2PY8A 3CCMP 3CD6P 4XFZA 2PEJA 2ONTA 3CMEP 3DS3A 3CMAP 2EFJA 2M8NA 4U0BA 5HGNA 1YHQP 3LRYA 2P9XA 2PEMA 4U0CA 2BHVA 1Q81Q 2M8LA 4U0AA 1S72P 3CC2P 3H0DA 1M74A 4QNBA 3G29A 1VQMP 1YITP 4PH0A 3G71P 1JJ2O 1VQ7P 3I56P 3VRLC 3CCEP 2Z44A 3E2DA 2DGYA 3DS5A 1VQ9P 3G21A 3DS4A 2Z46A 2PEKA 4GR2A 5HGOA 1VQ6P 1YJNP 1M90Q 5BS2A 3G1GA 4XFXA 1K9MQ 3CCVP 4XROA 5I4TG 1A43A 3OW2O 1Q7YQ 5F2KA 3G4SP 3H4EA 1KD1Q 2BUOA 1KC8Q 1BAJA 3CXCO 4XRQA 1VQPP 4GR6A 2QEXP 5F2NA 2QA4P 4IPYA 4COPA 1N8RQ 1EIAA 1K8AQ 3B5IA 1QVFO 3RG6C 1A8OA 1AUMA 1YI2P 2JYGA 1ZMBA 4U0DA 4COCA 3G1IA 1Q86Q 2OARA 5HGLA 2E1MA 1E6JP 1M6EX 5F2OA 2PENA 2CWOA 4XFYA 1M6NA 3P05A 3CCLP 1D1DA 2JYLA 3DS2A 1VQLP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPH A;  3DS0 A;  4PH1 A;  4WYM A;  5DCK A;  1D1D A;  1BAJ A;  2M8L A;  4U0A A;  4XRQ A;  2JO0 A;  4IPY A;  4QNB A;  3G29 A;  1EIA A;  4U0F A;  4COP A;  2L6E A;  3DTJ A;  4PH0 A;  5JPA A;  1A8O A;  1AUM A;  2EIA A;  2XXM A;  3G0V A;  3NTE A;  2LF4 A;  2JYG A;  3VRL C;  2KOD A;  3H47 A;  3MGE A;  4U0D A;  5HGM A;  2XT1 A;  4COC A;  3G1I A;  3DS5 A;  3G26 A;  1EOQ A;  3G21 A;  2M8P A;  3DS4 A;  5HGL A;  4XFZ A;  5HGO A;  1E6J P;  2ONT A;  3G1G A;  3G28 A;  3DS3 A;  2M8N A;  1QRJ A;  4M0I A;  4U0B A;  4XFX A;  5HGN A;  4XRO A;  5I4T G;  1A43 A;  3DS1 A;  3LRY A;  4XFY A;  3P05 A;  3H4E A;  2BUO A;  2JYL A;  3DS2 A;  2XV6 A;  4U0C A;  4U0E A; 
#chains in the Genus database with same CATH topology
 3DPH A;  1W2B O;  2FVF A;  2FQ1 A;  5KP6 B;  1VQ4 P;  1VQN P;  1VQO P;  3CE7 A;  3GKL C;  1QRJ A;  2MVU A;  3CC4 P;  3CPW O;  3Q20 A;  2M5R A;  5EJD A;  1IUQ A;  2ERH A;  3NTE A;  3CCQ P;  1VQ5 P;  2K93 A;  3MGE A;  2XT1 A;  4IZ6 A;  3CD6 P;  2L9F A;  5HGN A;  2LML A;  2K5X A;  3LRY A;  2FVA A;  2P9X A;  2ROQ A;  2PEM A;  2MY5 A;  2PNG A;  3H0D A;  3U43 A;  1YIT P;  3RG2 A;  1HY8 A;  3CCE P;  1AYI A;  2KGA A;  1VQ9 P;  2PEK A;  1YJN P;  4XFX A;  4XRO A;  5F2K A;  3EJD A;  2LIW A;  4BPH A;  2MVV A;  3CXC O;  4GR6 A;  5F2N A;  4COP A;  1K8A Q;  1A8O A;  1YI2 P;  1ZMB A;  4U0D A;  2JGP A;  5HGL A;  2L4B A;  5F2O A;  2JYL A;  1VQL P;  2JU2 A;  3G6E P;  2MF4 A;  1YIJ P;  1MZ8 A;  2JO0 A;  4BPG A;  4BPF A;  1KQS O;  2JU1 A;  1L0H A;  2CG5 B;  2LOL A;  1ACP A;  2XXM A;  1T8K A;  2KOD A;  3H47 A;  2Z45 A;  3CCU P;  2PEO A;  2JB0 A;  2M8P A;  2GZF A;  1OR5 A;  2GDW A;  3G28 A;  2GZJ A;  4M0I A;  3CCJ P;  1K73 Q;  2GZG A;  1YJW P;  2XV6 A;  2K0X A;  4U0E A;  5DCK A;  3CCS P;  1GXH A;  2EG5 A;  4U0F A;  2CQ8 A;  2N6Y A;  3LMO A;  2MR7 A;  2ONT A;  4H2W C;  2KG6 A;  3DS3 A;  2M8N A;  4U0B A;  3CMA P;  4H2Y C;  4U0C A;  1ZNV A;  2KOR A;  1S72 P;  4QNB A;  3G29 A;  1VQM P;  3NY7 B;  1CEI A;  1NQ4 A;  2NO8 A;  3VRL C;  2KR5 A;  3DS4 A;  4GR2 A;  5HGO A;  2L0Q A;  1M90 Q;  2FAD A;  2X2B A;  1L0I A;  3CCV P;  1Q7Y Q;  4QKO A;  3EJB A;  1KC8 Q;  2LKI A;  1X3O A;  2FVE A;  1BAJ A;  2AFE A;  2WPT A;  2KW2 A;  4F37 A;  2LTE A;  2GDX A;  2K0D X;  2JYG A;  2VLN A;  2OAR A;  1M6E X;  4MRT C;  1IMQ A;  3P05 A;  1UJZ A;  3GJN A;  2FAC A;  3DS0 A;  4WYM A;  2KOQ A;  4NEO A;  5EW5 E;  1K30 A;  2L6E A;  2OTJ P;  3DTJ A;  2KG8 A;  5JPA A;  2JAZ A;  2KGD A;  3G0V A;  1RNI A;  1Z6M A;  4UHP B;  2AF8 A;  1EOQ A;  1RO2 A;  3HYB A;  3B4Q A;  1DNY A;  2LIU A;  5BS1 A;  1FR2 A;  2AFD A;  5HVC A;  3I55 P;  2KOP A;  3CC7 P;  1YJ9 P;  2PEI A;  3M1M A;  2K0Y A;  4XFZ A;  1EMV A;  2JBG A;  3CME P;  2GZE A;  2FQ2 A;  1UNK A;  1YHQ P;  2VLP A;  1HQB A;  2BHV A;  1Q81 Q;  2M8L A;  1GXG A;  4PH0 A;  3G71 P;  2N50 A;  2GZI A;  3I56 P;  2Z44 A;  3DS5 A;  2K92 A;  1VHN A;  2Z46 A;  5BS2 A;  3G1G A;  2KOO A;  2VLQ A;  2VSQ A;  3G4S P;  1E0H A;  2DNW A;  3H4E A;  1KD1 Q;  5KP8 B;  2XZ0 D;  1VQP P;  2QEX P;  1N8R Q;  1QVF O;  3RG6 C;  3G1I A;  2KG9 A;  2N98 A;  1E6J P;  4PWV B;  2AVA A;  4XFY A;  3EJE A;  1M6N A;  1D1D A;  4CA3 A;  4PH1 A;  1RO0 A;  1QVG O;  4R0M A;  2KWL A;  1VQ8 P;  1VQK P;  3CCR P;  3WBH A;  1F80 D;  2VLO A;  5HGM A;  2CNR A;  3G26 A;  2PEQ A;  2K2Q A;  3HZQ A;  5HV8 A;  1GPJ A;  1KLP A;  3DS1 A;  2GDY A;  1NJI Q;  2FAE A;  1Q82 Q;  2EIA A;  2OTL P;  2LF4 A;  1M1K Q;  2PY8 A;  3CCM P;  2GYK A;  3GZL A;  2PEJ A;  2EHT A;  2JQ4 A;  2MD9 A;  2EFJ A;  1VKU A;  2MR8 A;  5KP7 B;  4U0A A;  3CC2 P;  1M74 A;  3GZM A;  1AF8 A;  1JJ2 O;  1VQ7 P;  2KOS A;  1IMP A;  3E2D A;  2KGC A;  2FQ0 A;  2DGY A;  2LPK A;  2FHS C;  3G21 A;  2CGQ A;  4HKG A;  1VQ6 P;  1BXI A;  2N5I A;  1K9M Q;  3OW2 O;  5I4T G;  1A43 A;  2LL8 A;  2N6Z A;  2BUO A;  7CEI A;  2L22 A;  2EHS A;  1DV5 A;  4XRQ A;  4H2X C;  5CZD B;  2QA4 P;  4IPY A;  1EIA A;  3B5I A;  1AUM A;  2XZ1 C;  4PXH B;  4COC A;  2QNW A;  1Q86 Q;  2E1M A;  2KGE A;  2PEN A;  2K94 A;  2CWO A;  2N5H A;  4DG9 A;  3CCL P;  3DS2 A; 
#chains in the Genus database with same CATH homology
 3DPH A;  3DS0 A;  4PH1 A;  1RO0 A;  4WYM A;  3G6E P;  1W2B O;  1QVG O;  1YIJ P;  2JO0 A;  1KQS O;  1VQK P;  1VQ8 P;  1K30 A;  2L6E A;  1VQ4 P;  3CCR P;  3DTJ A;  2OTJ P;  5JPA A;  1VQN P;  3WBH A;  2XXM A;  3G0V A;  1VQO P;  1RNI A;  2KOD A;  3H47 A;  2Z45 A;  5HGM A;  3CCU P;  2PEO A;  3G26 A;  2PEQ A;  1EOQ A;  2M8P A;  1RO2 A;  3HZQ A;  3G28 A;  3HYB A;  4M0I A;  1QRJ A;  3CCJ P;  1K73 Q;  3DS1 A;  1YJW P;  5BS1 A;  3CC4 P;  2XV6 A;  3CPW O;  4U0E A;  5DCK A;  3CCS P;  3Q20 A;  2EG5 A;  1NJI Q;  1IUQ A;  3I55 P;  1Q82 Q;  4U0F A;  3CC7 P;  2EIA A;  2PEI A;  1YJ9 P;  2OTL P;  3NTE A;  3CCQ P;  2LF4 A;  1VQ5 P;  1M1K Q;  3M1M A;  3MGE A;  2XT1 A;  2PY8 A;  3CCM P;  3CD6 P;  4XFZ A;  2PEJ A;  2ONT A;  3CME P;  3DS3 A;  3CMA P;  2EFJ A;  2M8N A;  4U0B A;  5HGN A;  1YHQ P;  3LRY A;  2P9X A;  2PEM A;  4U0C A;  2BHV A;  1Q81 Q;  2M8L A;  4U0A A;  1S72 P;  3CC2 P;  3H0D A;  1M74 A;  4QNB A;  3G29 A;  1VQM P;  1YIT P;  4PH0 A;  3G71 P;  1JJ2 O;  1VQ7 P;  3I56 P;  3VRL C;  3CCE P;  2Z44 A;  3E2D A;  2DGY A;  3DS5 A;  1VQ9 P;  3G21 A;  3DS4 A;  2Z46 A;  2PEK A;  4GR2 A;  5HGO A;  1VQ6 P;  1YJN P;  1M90 Q;  5BS2 A;  3G1G A;  4XFX A;  1K9M Q;  3CCV P;  4XRO A;  5I4T G;  1A43 A;  3OW2 O;  1Q7Y Q;  5F2K A;  3G4S P;  3H4E A;  1KD1 Q;  2BUO A;  1KC8 Q;  1BAJ A;  3CXC O;  4XRQ A;  1VQP P;  4GR6 A;  2QEX P;  5F2N A;  2QA4 P;  4IPY A;  4COP A;  1N8R Q;  1EIA A;  1K8A Q;  3B5I A;  1QVF O;  3RG6 C;  1A8O A;  1AUM A;  1YI2 P;  2JYG A;  1ZMB A;  4U0D A;  4COC A;  3G1I A;  1Q86 Q;  2OAR A;  5HGL A;  2E1M A;  1E6J P;  1M6E X;  5F2O A;  2PEN A;  2CWO A;  4XFY A;  1M6N A;  3P05 A;  3CCL P;  1D1D A;  2JYL A;  3DS2 A;  1VQL P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...