3GZMA

Crystal structure of holo pfacp reduced monomer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
78
structure length
78
Chain Sequence
SLKSTFDDIKKIISKQLSVEEDKIQMNSNFTKDLGADSLDLVELIMALEEKFNVTISDQDALKINTVQDAIDYIEKNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Acyl carrier protein
publication title Plasmodium falciparum acyl carrier protein crystal structures in disulfide-linked and reduced states and their prevalence during blood stage growth.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 29
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3gzmA00
3LMOA 2ROQA 2KGEA 2KOOA 4DG9A 2LMLA 2CNRA 2AVAA 4IZ6A 2L0QA 2FQ2A 2GDYA 4MRTC 3CE7A 3GZMA 2FHSC 2FVEA 2KOPA 4PXHB 4CA3A 2K94A 4BPFA 3RG2A 4H2XC 1HY8A 5KP6B 2FADA 2FAEA 2LIWA 2K92A 1HQBA 2LPKA 2VSQA 2KOSA 2AF8A 2N50A 2CG5B 2JGPA 2FQ0A 2KORA 2MF4A 2KWLA 2KG8A 3EJEA 2JU1A 2K2QA 2KG6A 2GDWA 1DV5A 1OR5A 2FVAA 2CGQA 1X3OA 2K0XA 2XZ0D 2MD9A 4NEOA 1ACPA 1T8KA 5EJDA 1L0HA 2KR5A 2KOQA 1KLPA 2L4BA 2X2BA 1DNYA 2L9FA 2FACA 5KP7B 2FVFA 2N6YA 4BPHA 3GZLA 1AF8A 2DNWA 1F80D 2AFEA 2LIUA 5HVCA 2JQ4A 2MR7A 3EJDA 2KGCA 2L22A 4H2YC 4H2WC 4BPGA 2MR8A 2LTEA 2MVUA 2KGAA 2K0YA 2KG9A 2LL8A 2FQ1A 3EJBA 5KP8B 2N6ZA 2QNWA 2MY5A 2EHTA 2N98A 2XZ1C 5HV8A 2EHSA 1L0IA 2N5IA 4R0MA 2PNGA 2AFDA 1NQ4A 1VKUA 4PWVB 2LKIA 2LOLA 2N5HA 2JU2A 2K93A 2KW2A 2CQ8A 2M5RA 2MVVA 2GDXA 2KGDA 3NY7B 4HKGA 5CZDB
chains in the Genus database with same CATH superfamily
1VQ7P 4COPA 1VQNP 1Z6MA 4F37A 2VLPA 4U0DA 2E1MA 2XT1A 4IZ6A 2XXMA 3I55P 2QA4P 3CCEP 2FVEA 1YI2P 2ERHA 3RG2A 4H2XC 1HY8A 5KP6B 3H0DA 2FADA 1JJ2O 2LIWA 3P05A 2VSQA 1VQ5P 2KOSA 1BXIA 2JO0A 2KORA 2MF4A 5EW5E 3EJEA 2GYKA 1OR5A 2FVAA 4UHPB 3CCMP 5DCKA 2VLOA 2XZ0D 4U0EA 1ACPA 1T8KA 4XFYA 1L0HA 1Q7YQ 1E0HA 2PENA 1DNYA 4XFZA 1UNKA 1ZNVA 2FVFA 2N6YA 2K5XA 1KD1Q 3G1IA 3G4SP 2EG5A 2MR7A 3EJDA 4BPGA 4H2WC 1QVGO 2PEIA 1NJIQ 2FQ1A 1D1DA 3EJBA 5KP8B 3I56P 5I4TG 4WYMA 1VQKP 2PEOA 5HV8A 2EHSA 7CEIA 1GXGA 1YIJP 1E6JP 2GZEA 4IPYA 3DS5A 3CD6P 2AFDA 5HGMA 2EFJA 4PWVB 1UJZA 2JU2A 2N5HA 3G26A 3DS3A 3G1GA 3CPWO 4HKGA 5CZDB 4GR6A 2CNRA 2L0QA 2FQ2A 3DTJA 3GZMA 2GZJA 4U0CA 1IMPA 3DPHA 3DS4A 4PXHB 4BPFA 1MZ8A 1HQBA 2L6EA 1YHQP 2CG5B 3G29A 1IUQA 3CMAP 2KWLA 1YITP 4U0BA 2P9XA 1EIAA 2QEXP 1VQ6P 1X3OA 2JB0A 1K73Q 3MGEA 2KR5A 1YJ9P 3CC2P 1BAJA 1KLPA 2L4BA 2L9FA 1K9MQ 1GPJA 5KP7B 2JYLA 3GZLA 1VQ4P 2K0DX 3GKLC 3CMEP 3WBHA 2LIUA 2JQ4A 2PY8A 4H2YC 4QNBA 3LRYA 2KGAA 4XRQA 1VQ9P 1M1KQ 2GZIA 2QNWA 1KC8Q 1VQPP 3OW2O 1VQOP 1IMQA 2M8PA 2Z44A 3H4EA 2VLNA 1M6NA 2OARA 3CC4P 2GZGA 2M8LA 5BS1A 1NQ4A 1VKUA 2LKIA 3G0VA 2ONTA 2M5RA 2KGDA 4PH0A 1VQMP 4PH1A 3CC7P 3U43A 2KOOA 4XFXA 2LMLA 3DS2A 3DS1A 5JPAA 4GR2A 4MRTC 1KQSO 3CE7A 1S72P 1M6EX 3CCRP 4U0AA 1GXHA 1FR2A 2K92A 3CCVP 2LPKA 3HYBA 2XV6A 5HGNA 2AF8A 1YJNP 2CWOA 2JGPA 5F2OA 1ZMBA 2KG6A 2GDWA 2OTLP 5BS2A 2PEQA 1VHNA 2K0XA 1AYIA 4NEOA 1Q81Q 5HGLA 4XROA 2KOQA 2X2BA 1K30A 2PEJA 3HZQA 1QRJA 1F80D 2AFEA 1RO0A 4M0IA 2L22A 3M1MA 3H47A 2PEKA 2KG9A 2LL8A 3B5IA 3G21A 2MY5A 2EHTA 2JAZA 3CXCO 1L0IA 4R0MA 1M74A 3CCSP 1A8OA 2LOLA 2KW2A 2BUOA 2MVVA 2GDXA 3NY7B 3B4QA 3LMOA 2NO8A 4COCA 2ROQA 2KGEA 5HGOA 4DG9A 3G71P 1VQLP 3GJNA 2AVAA 2KODA 1QVFO 1CEIA 2Z46A 2GDYA 4QKOA 3VRLC 1Q86Q 2FHSC 2KOPA 4CA3A 2K94A 3G28A 2WPTA 2FAEA 1A43A 1RO2A 2N50A 1W2BO 3NTEA 2GZFA 2FQ0A 3DS0A 2KG8A 2JU1A 2K2QA 3RG6C 1DV5A 2CGQA 3CCJP 3CCLP 2MD9A 3CCUP 1AUMA 1M90Q 5EJDA 5F2KA 1VQ8P 2M8NA 3Q20A 2OTJP 2PEMA 2JYGA 2FACA 1K8AQ 3E2DA 2JBGA 4BPHA 1AF8A 2DNWA 1RNIA 2Z45A 5HVCA 3G6EP 3CCQP 2KGCA 2MR8A 2LTEA 2MVUA 1EOQA 1N8RQ 2K0YA 1Q82Q 2N6ZA 2N98A 2XZ1C 5F2NA 1EMVA 2N5IA 2EIAA 2LF4A 4U0FA 2PNGA 2BHVA 1YJWP 2K93A 2VLQA 2DGYA 2CQ8A
chains in the Genus database with same CATH topology
3LMOA 2ROQA 2KGEA 2KOOA 4DG9A 2LMLA 2CNRA 2AVAA 4IZ6A 2L0QA 2FQ2A 2GDYA 4MRTC 3CE7A 3GZMA 2FHSC 2FVEA 2KOPA 4PXHB 4CA3A 2K94A 4BPFA 3RG2A 4H2XC 1HY8A 5KP6B 2FADA 2FAEA 2LIWA 2K92A 1HQBA 2LPKA 2VSQA 2KOSA 2AF8A 2N50A 2CG5B 2JGPA 2FQ0A 2KORA 2MF4A 2KWLA 2KG8A 3EJEA 2JU1A 2K2QA 2KG6A 2GDWA 1DV5A 1OR5A 2FVAA 2CGQA 1X3OA 2K0XA 2XZ0D 2MD9A 4NEOA 1ACPA 1T8KA 5EJDA 1L0HA 2KR5A 2KOQA 1KLPA 2L4BA 2X2BA 1DNYA 2L9FA 2FACA 5KP7B 2FVFA 2N6YA 4BPHA 3GZLA 1AF8A 2DNWA 1F80D 2AFEA 2LIUA 5HVCA 2JQ4A 2MR7A 3EJDA 2KGCA 2L22A 4H2YC 4H2WC 4BPGA 2MR8A 2LTEA 2MVUA 2KGAA 2K0YA 2KG9A 2LL8A 2FQ1A 3EJBA 5KP8B 2N6ZA 2QNWA 2MY5A 2EHTA 2N98A 2XZ1C 5HV8A 2EHSA 1L0IA 2N5IA 4R0MA 2PNGA 2AFDA 1NQ4A 1VKUA 4PWVB 2LKIA 2LOLA 2N5HA 2JU2A 2K93A 2KW2A 2CQ8A 2M5RA 2MVVA 2GDXA 2KGDA 3NY7B 4HKGA 5CZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LMO A;  2ROQ A;  2KGE A;  2KOO A;  4DG9 A;  2LML A;  2CNR A;  2AVA A;  4IZ6 A;  2L0Q A;  2FQ2 A;  2GDY A;  4MRT C;  3CE7 A;  3GZM A;  2FHS C;  2FVE A;  2KOP A;  4PXH B;  4CA3 A;  2K94 A;  4BPF A;  3RG2 A;  4H2X C;  1HY8 A;  5KP6 B;  2FAD A;  2FAE A;  2LIW A;  2K92 A;  1HQB A;  2LPK A;  2VSQ A;  2KOS A;  2AF8 A;  2N50 A;  2CG5 B;  2JGP A;  2FQ0 A;  2KOR A;  2MF4 A;  2KWL A;  2KG8 A;  3EJE A;  2JU1 A;  2K2Q A;  2KG6 A;  2GDW A;  1DV5 A;  1OR5 A;  2FVA A;  2CGQ A;  1X3O A;  2K0X A;  2XZ0 D;  2MD9 A;  4NEO A;  1ACP A;  1T8K A;  5EJD A;  1L0H A;  2KR5 A;  2KOQ A;  1KLP A;  2L4B A;  2X2B A;  1DNY A;  2L9F A;  2FAC A;  5KP7 B;  2FVF A;  2N6Y A;  4BPH A;  3GZL A;  1AF8 A;  2DNW A;  1F80 D;  2AFE A;  2LIU A;  5HVC A;  2JQ4 A;  2MR7 A;  3EJD A;  2KGC A;  2L22 A;  4H2Y C;  4H2W C;  4BPG A;  2MR8 A;  2LTE A;  2MVU A;  2KGA A;  2K0Y A;  2KG9 A;  2LL8 A;  2FQ1 A;  3EJB A;  5KP8 B;  2N6Z A;  2QNW A;  2MY5 A;  2EHT A;  2N98 A;  2XZ1 C;  5HV8 A;  2EHS A;  1L0I A;  2N5I A;  4R0M A;  2PNG A;  2AFD A;  1NQ4 A;  1VKU A;  4PWV B;  2LKI A;  2LOL A;  2N5H A;  2JU2 A;  2K93 A;  2KW2 A;  2CQ8 A;  2M5R A;  2MVV A;  2GDX A;  2KGD A;  3NY7 B;  4HKG A;  5CZD B; 
#chains in the Genus database with same CATH topology
 1VQ7 P;  4COP A;  1VQN P;  1Z6M A;  4F37 A;  2VLP A;  4U0D A;  2E1M A;  2XT1 A;  4IZ6 A;  2XXM A;  3I55 P;  2QA4 P;  3CCE P;  2FVE A;  1YI2 P;  2ERH A;  3RG2 A;  4H2X C;  1HY8 A;  5KP6 B;  3H0D A;  2FAD A;  1JJ2 O;  2LIW A;  3P05 A;  2VSQ A;  1VQ5 P;  2KOS A;  1BXI A;  2JO0 A;  2KOR A;  2MF4 A;  5EW5 E;  3EJE A;  2GYK A;  1OR5 A;  2FVA A;  4UHP B;  3CCM P;  5DCK A;  2VLO A;  2XZ0 D;  4U0E A;  1ACP A;  1T8K A;  4XFY A;  1L0H A;  1Q7Y Q;  1E0H A;  2PEN A;  1DNY A;  4XFZ A;  1UNK A;  1ZNV A;  2FVF A;  2N6Y A;  2K5X A;  1KD1 Q;  3G1I A;  3G4S P;  2EG5 A;  2MR7 A;  3EJD A;  4BPG A;  4H2W C;  1QVG O;  2PEI A;  1NJI Q;  2FQ1 A;  1D1D A;  3EJB A;  5KP8 B;  3I56 P;  5I4T G;  4WYM A;  1VQK P;  2PEO A;  5HV8 A;  2EHS A;  7CEI A;  1GXG A;  1YIJ P;  1E6J P;  2GZE A;  4IPY A;  3DS5 A;  3CD6 P;  2AFD A;  5HGM A;  2EFJ A;  4PWV B;  1UJZ A;  2JU2 A;  2N5H A;  3G26 A;  3DS3 A;  3G1G A;  3CPW O;  4HKG A;  5CZD B;  4GR6 A;  2CNR A;  2L0Q A;  2FQ2 A;  3DTJ A;  3GZM A;  2GZJ A;  4U0C A;  1IMP A;  3DPH A;  3DS4 A;  4PXH B;  4BPF A;  1MZ8 A;  1HQB A;  2L6E A;  1YHQ P;  2CG5 B;  3G29 A;  1IUQ A;  3CMA P;  2KWL A;  1YIT P;  4U0B A;  2P9X A;  1EIA A;  2QEX P;  1VQ6 P;  1X3O A;  2JB0 A;  1K73 Q;  3MGE A;  2KR5 A;  1YJ9 P;  3CC2 P;  1BAJ A;  1KLP A;  2L4B A;  2L9F A;  1K9M Q;  1GPJ A;  5KP7 B;  2JYL A;  3GZL A;  1VQ4 P;  2K0D X;  3GKL C;  3CME P;  3WBH A;  2LIU A;  2JQ4 A;  2PY8 A;  4H2Y C;  4QNB A;  3LRY A;  2KGA A;  4XRQ A;  1VQ9 P;  1M1K Q;  2GZI A;  2QNW A;  1KC8 Q;  1VQP P;  3OW2 O;  1VQO P;  1IMQ A;  2M8P A;  2Z44 A;  3H4E A;  2VLN A;  1M6N A;  2OAR A;  3CC4 P;  2GZG A;  2M8L A;  5BS1 A;  1NQ4 A;  1VKU A;  2LKI A;  3G0V A;  2ONT A;  2M5R A;  2KGD A;  4PH0 A;  1VQM P;  4PH1 A;  3CC7 P;  3U43 A;  2KOO A;  4XFX A;  2LML A;  3DS2 A;  3DS1 A;  5JPA A;  4GR2 A;  4MRT C;  1KQS O;  3CE7 A;  1S72 P;  1M6E X;  3CCR P;  4U0A A;  1GXH A;  1FR2 A;  2K92 A;  3CCV P;  2LPK A;  3HYB A;  2XV6 A;  5HGN A;  2AF8 A;  1YJN P;  2CWO A;  2JGP A;  5F2O A;  1ZMB A;  2KG6 A;  2GDW A;  2OTL P;  5BS2 A;  2PEQ A;  1VHN A;  2K0X A;  1AYI A;  4NEO A;  1Q81 Q;  5HGL A;  4XRO A;  2KOQ A;  2X2B A;  1K30 A;  2PEJ A;  3HZQ A;  1QRJ A;  1F80 D;  2AFE A;  1RO0 A;  4M0I A;  2L22 A;  3M1M A;  3H47 A;  2PEK A;  2KG9 A;  2LL8 A;  3B5I A;  3G21 A;  2MY5 A;  2EHT A;  2JAZ A;  3CXC O;  1L0I A;  4R0M A;  1M74 A;  3CCS P;  1A8O A;  2LOL A;  2KW2 A;  2BUO A;  2MVV A;  2GDX A;  3NY7 B;  3B4Q A;  3LMO A;  2NO8 A;  4COC A;  2ROQ A;  2KGE A;  5HGO A;  4DG9 A;  3G71 P;  1VQL P;  3GJN A;  2AVA A;  2KOD A;  1QVF O;  1CEI A;  2Z46 A;  2GDY A;  4QKO A;  3VRL C;  1Q86 Q;  2FHS C;  2KOP A;  4CA3 A;  2K94 A;  3G28 A;  2WPT A;  2FAE A;  1A43 A;  1RO2 A;  2N50 A;  1W2B O;  3NTE A;  2GZF A;  2FQ0 A;  3DS0 A;  2KG8 A;  2JU1 A;  2K2Q A;  3RG6 C;  1DV5 A;  2CGQ A;  3CCJ P;  3CCL P;  2MD9 A;  3CCU P;  1AUM A;  1M90 Q;  5EJD A;  5F2K A;  1VQ8 P;  2M8N A;  3Q20 A;  2OTJ P;  2PEM A;  2JYG A;  2FAC A;  1K8A Q;  3E2D A;  2JBG A;  4BPH A;  1AF8 A;  2DNW A;  1RNI A;  2Z45 A;  5HVC A;  3G6E P;  3CCQ P;  2KGC A;  2MR8 A;  2LTE A;  2MVU A;  1EOQ A;  1N8R Q;  2K0Y A;  1Q82 Q;  2N6Z A;  2N98 A;  2XZ1 C;  5F2N A;  1EMV A;  2N5I A;  2EIA A;  2LF4 A;  4U0F A;  2PNG A;  2BHV A;  1YJW P;  2K93 A;  2VLQ A;  2DGY A;  2CQ8 A; 
#chains in the Genus database with same CATH homology
 3LMO A;  2ROQ A;  2KGE A;  2KOO A;  4DG9 A;  2LML A;  2CNR A;  2AVA A;  4IZ6 A;  2L0Q A;  2FQ2 A;  2GDY A;  4MRT C;  3CE7 A;  3GZM A;  2FHS C;  2FVE A;  2KOP A;  4PXH B;  4CA3 A;  2K94 A;  4BPF A;  3RG2 A;  4H2X C;  1HY8 A;  5KP6 B;  2FAD A;  2FAE A;  2LIW A;  2K92 A;  1HQB A;  2LPK A;  2VSQ A;  2KOS A;  2AF8 A;  2N50 A;  2CG5 B;  2JGP A;  2FQ0 A;  2KOR A;  2MF4 A;  2KWL A;  2KG8 A;  3EJE A;  2JU1 A;  2K2Q A;  2KG6 A;  2GDW A;  1DV5 A;  1OR5 A;  2FVA A;  2CGQ A;  1X3O A;  2K0X A;  2XZ0 D;  2MD9 A;  4NEO A;  1ACP A;  1T8K A;  5EJD A;  1L0H A;  2KR5 A;  2KOQ A;  1KLP A;  2L4B A;  2X2B A;  1DNY A;  2L9F A;  2FAC A;  5KP7 B;  2FVF A;  2N6Y A;  4BPH A;  3GZL A;  1AF8 A;  2DNW A;  1F80 D;  2AFE A;  2LIU A;  5HVC A;  2JQ4 A;  2MR7 A;  3EJD A;  2KGC A;  2L22 A;  4H2Y C;  4H2W C;  4BPG A;  2MR8 A;  2LTE A;  2MVU A;  2KGA A;  2K0Y A;  2KG9 A;  2LL8 A;  2FQ1 A;  3EJB A;  5KP8 B;  2N6Z A;  2QNW A;  2MY5 A;  2EHT A;  2N98 A;  2XZ1 C;  5HV8 A;  2EHS A;  1L0I A;  2N5I A;  4R0M A;  2PNG A;  2AFD A;  1NQ4 A;  1VKU A;  4PWV B;  2LKI A;  2LOL A;  2N5H A;  2JU2 A;  2K93 A;  2KW2 A;  2CQ8 A;  2M5R A;  2MVV A;  2GDX A;  2KGD A;  3NY7 B;  4HKG A;  5CZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...