3GZMA

Crystal structure of holo pfacp reduced monomer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
78
structure length
78
Chain Sequence
SLKSTFDDIKKIISKQLSVEEDKIQMNSNFTKDLGADSLDLVELIMALEEKFNVTISDQDALKINTVQDAIDYIEKNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Plasmodium falciparum acyl carrier protein crystal structures in disulfide-linked and reduced states and their prevalence during blood stage growth.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Biosynthetic protein
total genus 29
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3gzmA00
2K93A 2M5RA 2FHSC 2AF8A 4BPFA 4HKGA 2KOPA 2MVVA 4PXHB 2MD9A 4DG9A 2N6ZA 2K94A 2KG9A 5KP8B 3EJDA 5HVCA 2FACA 2LL8A 1X3OA 2KOQA 2PNGA 1HQBA 1KLPA 4PWVB 2K92A 3GZMA 2LOLA 1ACPA 4NEOA 2K2QA 2L0QA 2KG6A 1F80D 5HV8A 4MRTC 2CGQA 1DNYA 3CE7A 2LIWA 4BPGA 3RG2A 1L0HA 2KORA 2JQ4A 2FAEA 2KGDA 2AVAA 2AFEA 3EJBA 2AFDA 2KOOA 2LKIA 2KGCA 4H2XC 3GZLA 2MVUA 2X2BA 2EHSA 2MR8A 4BPHA 2K0XA 1DV5A 2CQ8A 5CZDB 2N5HA 2XZ0D 3LMOA 4H2YC 2FVAA 2K0YA 2GDWA 2QNWA 2KGAA 2CG5B 2KW2A 1L0IA 1VKUA 2FVFA 2L22A 2KG8A 2LMLA 1OR5A 1T8KA 2MF4A 5KP6B 2N50A 5KP7B 1NQ4A 4CA3A 2L4BA 2L9FA 2GDYA 3EJEA 1HY8A 2MY5A 3NY7B 2ROQA 2KR5A 4H2WC 2VSQA 2LPKA 2N6YA 2XZ1C 2EHTA 2FQ0A 2KGEA 4R0MA 2CNRA 2FQ1A 5EJDA 2JU2A 1AF8A 2N5IA 2MR7A 2KOSA 2KWLA 4IZ6A 2LIUA 2JGPA 2FADA 2N98A 2LTEA 2FVEA 2JU1A 2DNWA 2GDXA 2FQ2A
chains in the Genus database with same CATH superfamily
1YJ9P 1YJNP 1GXGA 4HKGA 2KOPA 4PXHB 2MD9A 2N6ZA 2K94A 3CXCO 5HVCA 1CEIA 2FACA 4IPYA 2LL8A 3CCUP 3CD6P 2ONTA 2L0QA 5HV8A 4M0IA 4MRTC 2PENA 3G28A 1BXIA 3I55P 3CCVP 3H0DA 1AYIA 5F2OA 3CCJP 3G1IA 1VQ9P 1D1DA 1AUMA 1L0HA 2JAZA 1K73Q 2EIAA 4XROA 2XXMA 2XT1A 1M90Q 3G6EP 3GZLA 3G4SP 3CPWO 1K30A 4U0FA 4BPHA 2GYKA 5BS2A 4F37A 2XV6A 2Z46A 2QA4P 3LRYA 2JO0A 3LMOA 2FVAA 2K0YA 1VQNP 2PEMA 1YI2P 5F2KA 2L22A 1T8KA 2K5XA 2MF4A 1KC8Q 3DPHA 4CA3A 2VLNA 1HY8A 2GZJA 2VSQA 2GZGA 2XZ1C 3CMEP 2KGEA 2CNRA 2FQ1A 1K8AQ 1M74A 3DS4A 3DS5A 2MR7A 1E0HA 3G0VA 1W2BO 1QVFO 1VQPP 3RG6C 2LTEA 2JU1A 2M8LA 2FQ2A 1FR2A 2PY8A 4PH0A 1BAJA 1QRJA 2MVVA 4DG9A 2BHVA 4PWVB 2LOLA 2PEJA 5BS1A 1EIAA 2PEIA 1KQSO 2CGQA 1QVGO 1RNIA 1VQ4P 3DTJA 2KGDA 7CEIA 2AVAA 2AFEA 2VLQA 1VQOP 2GZIA 2KGCA 4H2XC 3G1GA 2OTJP 2MVUA 1Q81Q 2JB0A 4XFXA 2K0DX 2K0XA 1DV5A 3G71P 1Z6MA 2XZ0D 2GZEA 2E1MA 5HGOA 4U0BA 2DGYA 3DS1A 4UHPB 1VQ7P 1VQ5P 2CG5B 1L0IA 1EMVA 1RO2A 2Z44A 1OR5A 5KP6B 5KP7B 1M6NA 1NQ4A 2L4BA 3CC4P 3EJEA 2LF4A 2ROQA 2LPKA 2N6YA 2EHTA 1YHQP 2FQ0A 3M1MA 5EJDA 1S72P 1K9MQ 2KOSA 1IUQA 2OARA 2OTLP 5JPAA 1KD1Q 2JBGA 1A43A 2M5RA 1GPJA 2KG9A 1YIJP 3Q20A 1KLPA 2JYLA 1A8OA 3G21A 1VHNA 2K92A 3GZMA 2QEXP 2KG6A 1UNKA 1N8RQ 1IMPA 3CE7A 2VLPA 3DS2A 3CC2P 3B4QA 1VQMP 2LIWA 2BUOA 4U0AA 2AFDA 3HYBA 5DCKA 2X2BA 3NTEA 1ZMBA 4U0EA 1VQ8P 2CWOA 1JJ2O 3VRLC 1M6EX 1VQLP 4QNBA 4H2YC 1E6JP 2QNWA 2KGAA 3P05A 1VKUA 2GZFA 2FVFA 3CC7P 3CCLP 4PH1A 4XFYA 2GDYA 2KODA 3OW2O 1EOQA 2MY5A 2ERHA 3CCMP 3NY7B 1YITP 4H2WC 1MZ8A 4R0MA 1Q82Q 2JU2A 3GJNA 3DS3A 4QKOA 2KWLA 2LIUA 3E2DA 1Q7YQ 1UJZA 2M8NA 2FVEA 3G29A 3CCSP 2K93A 4COCA 1IMQA 1M1KQ 2FHSC 2AF8A 4BPFA 1VQKP 2Z45A 3CCEP 5KP8B 3EJDA 5HGLA 2EFJA 2EG5A 3HZQA 1X3OA 2KOQA 2PNGA 1HQBA 1GXHA 5EW5E 1ACPA 4NEOA 2K2QA 2JYGA 1F80D 5HGNA 4U0DA 4COPA 3B5IA 2PEQA 2VLOA 1DNYA 2P9XA 1VQ6P 4WYMA 4GR6A 4BPGA 3RG2A 1Q86Q 2KORA 2JQ4A 1RO0A 3G26A 2FAEA 2WPTA 3CCRP 3EJBA 3CMAP 2KOOA 2LKIA 1NJIQ 3U43A 3H4EA 2L6EA 3I56P 3CCQP 2NO8A 2EHSA 2MR8A 4XRQA 2CQ8A 5CZDB 4GR2A 2GDXA 2N5HA 5HGMA 2GDWA 5F2NA 3H47A 2M8PA 2KW2A 2PEOA 2KG8A 2LMLA 2N50A 4U0CA 3WBHA 2L9FA 5I4TG 2KR5A 3GKLC 1AF8A 2N5IA 1ZNVA 4IZ6A 2PEKA 2JGPA 3DS0A 2FADA 4XFZA 2N98A 1YJWP 2DNWA 3MGEA
chains in the Genus database with same CATH topology
2K93A 2M5RA 2FHSC 2AF8A 4BPFA 4HKGA 2KOPA 2MVVA 4PXHB 2MD9A 4DG9A 2N6ZA 2K94A 2KG9A 5KP8B 3EJDA 5HVCA 2FACA 2LL8A 1X3OA 2KOQA 2PNGA 1HQBA 1KLPA 4PWVB 2K92A 3GZMA 2LOLA 1ACPA 4NEOA 2K2QA 2L0QA 2KG6A 1F80D 5HV8A 4MRTC 2CGQA 1DNYA 3CE7A 2LIWA 4BPGA 3RG2A 1L0HA 2KORA 2JQ4A 2FAEA 2KGDA 2AVAA 2AFEA 3EJBA 2AFDA 2KOOA 2LKIA 2KGCA 4H2XC 3GZLA 2MVUA 2X2BA 2EHSA 2MR8A 4BPHA 2K0XA 1DV5A 2CQ8A 5CZDB 2N5HA 2XZ0D 3LMOA 4H2YC 2FVAA 2K0YA 2GDWA 2QNWA 2KGAA 2CG5B 2KW2A 1L0IA 1VKUA 2FVFA 2L22A 2KG8A 2LMLA 1OR5A 1T8KA 2MF4A 5KP6B 2N50A 5KP7B 1NQ4A 4CA3A 2L4BA 2L9FA 2GDYA 3EJEA 1HY8A 2MY5A 3NY7B 2ROQA 2KR5A 4H2WC 2VSQA 2LPKA 2N6YA 2XZ1C 2EHTA 2FQ0A 2KGEA 4R0MA 2CNRA 2FQ1A 5EJDA 2JU2A 1AF8A 2N5IA 2MR7A 2KOSA 2KWLA 4IZ6A 2LIUA 2JGPA 2FADA 2N98A 2LTEA 2FVEA 2JU1A 2DNWA 2GDXA 2FQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K93 A;  2M5R A;  2FHS C;  2AF8 A;  4BPF A;  4HKG A;  2KOP A;  2MVV A;  4PXH B;  2MD9 A;  4DG9 A;  2N6Z A;  2K94 A;  2KG9 A;  5KP8 B;  3EJD A;  5HVC A;  2FAC A;  2LL8 A;  1X3O A;  2KOQ A;  2PNG A;  1HQB A;  1KLP A;  4PWV B;  2K92 A;  3GZM A;  2LOL A;  1ACP A;  4NEO A;  2K2Q A;  2L0Q A;  2KG6 A;  1F80 D;  5HV8 A;  4MRT C;  2CGQ A;  1DNY A;  3CE7 A;  2LIW A;  4BPG A;  3RG2 A;  1L0H A;  2KOR A;  2JQ4 A;  2FAE A;  2KGD A;  2AVA A;  2AFE A;  3EJB A;  2AFD A;  2KOO A;  2LKI A;  2KGC A;  4H2X C;  3GZL A;  2MVU A;  2X2B A;  2EHS A;  2MR8 A;  4BPH A;  2K0X A;  1DV5 A;  2CQ8 A;  5CZD B;  2N5H A;  2XZ0 D;  3LMO A;  4H2Y C;  2FVA A;  2K0Y A;  2GDW A;  2QNW A;  2KGA A;  2CG5 B;  2KW2 A;  1L0I A;  1VKU A;  2FVF A;  2L22 A;  2KG8 A;  2LML A;  1OR5 A;  1T8K A;  2MF4 A;  5KP6 B;  2N50 A;  5KP7 B;  1NQ4 A;  4CA3 A;  2L4B A;  2L9F A;  2GDY A;  3EJE A;  1HY8 A;  2MY5 A;  3NY7 B;  2ROQ A;  2KR5 A;  4H2W C;  2VSQ A;  2LPK A;  2N6Y A;  2XZ1 C;  2EHT A;  2FQ0 A;  2KGE A;  4R0M A;  2CNR A;  2FQ1 A;  5EJD A;  2JU2 A;  1AF8 A;  2N5I A;  2MR7 A;  2KOS A;  2KWL A;  4IZ6 A;  2LIU A;  2JGP A;  2FAD A;  2N98 A;  2LTE A;  2FVE A;  2JU1 A;  2DNW A;  2GDX A;  2FQ2 A; 
#chains in the Genus database with same CATH topology
 1YJ9 P;  1YJN P;  1GXG A;  4HKG A;  2KOP A;  4PXH B;  2MD9 A;  2N6Z A;  2K94 A;  3CXC O;  5HVC A;  1CEI A;  2FAC A;  4IPY A;  2LL8 A;  3CCU P;  3CD6 P;  2ONT A;  2L0Q A;  5HV8 A;  4M0I A;  4MRT C;  2PEN A;  3G28 A;  1BXI A;  3I55 P;  3CCV P;  3H0D A;  1AYI A;  5F2O A;  3CCJ P;  3G1I A;  1VQ9 P;  1D1D A;  1AUM A;  1L0H A;  2JAZ A;  1K73 Q;  2EIA A;  4XRO A;  2XXM A;  2XT1 A;  1M90 Q;  3G6E P;  3GZL A;  3G4S P;  3CPW O;  1K30 A;  4U0F A;  4BPH A;  2GYK A;  5BS2 A;  4F37 A;  2XV6 A;  2Z46 A;  2QA4 P;  3LRY A;  2JO0 A;  3LMO A;  2FVA A;  2K0Y A;  1VQN P;  2PEM A;  1YI2 P;  5F2K A;  2L22 A;  1T8K A;  2K5X A;  2MF4 A;  1KC8 Q;  3DPH A;  4CA3 A;  2VLN A;  1HY8 A;  2GZJ A;  2VSQ A;  2GZG A;  2XZ1 C;  3CME P;  2KGE A;  2CNR A;  2FQ1 A;  1K8A Q;  1M74 A;  3DS4 A;  3DS5 A;  2MR7 A;  1E0H A;  3G0V A;  1W2B O;  1QVF O;  1VQP P;  3RG6 C;  2LTE A;  2JU1 A;  2M8L A;  2FQ2 A;  1FR2 A;  2PY8 A;  4PH0 A;  1BAJ A;  1QRJ A;  2MVV A;  4DG9 A;  2BHV A;  4PWV B;  2LOL A;  2PEJ A;  5BS1 A;  1EIA A;  2PEI A;  1KQS O;  2CGQ A;  1QVG O;  1RNI A;  1VQ4 P;  3DTJ A;  2KGD A;  7CEI A;  2AVA A;  2AFE A;  2VLQ A;  1VQO P;  2GZI A;  2KGC A;  4H2X C;  3G1G A;  2OTJ P;  2MVU A;  1Q81 Q;  2JB0 A;  4XFX A;  2K0D X;  2K0X A;  1DV5 A;  3G71 P;  1Z6M A;  2XZ0 D;  2GZE A;  2E1M A;  5HGO A;  4U0B A;  2DGY A;  3DS1 A;  4UHP B;  1VQ7 P;  1VQ5 P;  2CG5 B;  1L0I A;  1EMV A;  1RO2 A;  2Z44 A;  1OR5 A;  5KP6 B;  5KP7 B;  1M6N A;  1NQ4 A;  2L4B A;  3CC4 P;  3EJE A;  2LF4 A;  2ROQ A;  2LPK A;  2N6Y A;  2EHT A;  1YHQ P;  2FQ0 A;  3M1M A;  5EJD A;  1S72 P;  1K9M Q;  2KOS A;  1IUQ A;  2OAR A;  2OTL P;  5JPA A;  1KD1 Q;  2JBG A;  1A43 A;  2M5R A;  1GPJ A;  2KG9 A;  1YIJ P;  3Q20 A;  1KLP A;  2JYL A;  1A8O A;  3G21 A;  1VHN A;  2K92 A;  3GZM A;  2QEX P;  2KG6 A;  1UNK A;  1N8R Q;  1IMP A;  3CE7 A;  2VLP A;  3DS2 A;  3CC2 P;  3B4Q A;  1VQM P;  2LIW A;  2BUO A;  4U0A A;  2AFD A;  3HYB A;  5DCK A;  2X2B A;  3NTE A;  1ZMB A;  4U0E A;  1VQ8 P;  2CWO A;  1JJ2 O;  3VRL C;  1M6E X;  1VQL P;  4QNB A;  4H2Y C;  1E6J P;  2QNW A;  2KGA A;  3P05 A;  1VKU A;  2GZF A;  2FVF A;  3CC7 P;  3CCL P;  4PH1 A;  4XFY A;  2GDY A;  2KOD A;  3OW2 O;  1EOQ A;  2MY5 A;  2ERH A;  3CCM P;  3NY7 B;  1YIT P;  4H2W C;  1MZ8 A;  4R0M A;  1Q82 Q;  2JU2 A;  3GJN A;  3DS3 A;  4QKO A;  2KWL A;  2LIU A;  3E2D A;  1Q7Y Q;  1UJZ A;  2M8N A;  2FVE A;  3G29 A;  3CCS P;  2K93 A;  4COC A;  1IMQ A;  1M1K Q;  2FHS C;  2AF8 A;  4BPF A;  1VQK P;  2Z45 A;  3CCE P;  5KP8 B;  3EJD A;  5HGL A;  2EFJ A;  2EG5 A;  3HZQ A;  1X3O A;  2KOQ A;  2PNG A;  1HQB A;  1GXH A;  5EW5 E;  1ACP A;  4NEO A;  2K2Q A;  2JYG A;  1F80 D;  5HGN A;  4U0D A;  4COP A;  3B5I A;  2PEQ A;  2VLO A;  1DNY A;  2P9X A;  1VQ6 P;  4WYM A;  4GR6 A;  4BPG A;  3RG2 A;  1Q86 Q;  2KOR A;  2JQ4 A;  1RO0 A;  3G26 A;  2FAE A;  2WPT A;  3CCR P;  3EJB A;  3CMA P;  2KOO A;  2LKI A;  1NJI Q;  3U43 A;  3H4E A;  2L6E A;  3I56 P;  3CCQ P;  2NO8 A;  2EHS A;  2MR8 A;  4XRQ A;  2CQ8 A;  5CZD B;  4GR2 A;  2GDX A;  2N5H A;  5HGM A;  2GDW A;  5F2N A;  3H47 A;  2M8P A;  2KW2 A;  2PEO A;  2KG8 A;  2LML A;  2N50 A;  4U0C A;  3WBH A;  2L9F A;  5I4T G;  2KR5 A;  3GKL C;  1AF8 A;  2N5I A;  1ZNV A;  4IZ6 A;  2PEK A;  2JGP A;  3DS0 A;  2FAD A;  4XFZ A;  2N98 A;  1YJW P;  2DNW A;  3MGE A; 
#chains in the Genus database with same CATH homology
 2K93 A;  2M5R A;  2FHS C;  2AF8 A;  4BPF A;  4HKG A;  2KOP A;  2MVV A;  4PXH B;  2MD9 A;  4DG9 A;  2N6Z A;  2K94 A;  2KG9 A;  5KP8 B;  3EJD A;  5HVC A;  2FAC A;  2LL8 A;  1X3O A;  2KOQ A;  2PNG A;  1HQB A;  1KLP A;  4PWV B;  2K92 A;  3GZM A;  2LOL A;  1ACP A;  4NEO A;  2K2Q A;  2L0Q A;  2KG6 A;  1F80 D;  5HV8 A;  4MRT C;  2CGQ A;  1DNY A;  3CE7 A;  2LIW A;  4BPG A;  3RG2 A;  1L0H A;  2KOR A;  2JQ4 A;  2FAE A;  2KGD A;  2AVA A;  2AFE A;  3EJB A;  2AFD A;  2KOO A;  2LKI A;  2KGC A;  4H2X C;  3GZL A;  2MVU A;  2X2B A;  2EHS A;  2MR8 A;  4BPH A;  2K0X A;  1DV5 A;  2CQ8 A;  5CZD B;  2N5H A;  2XZ0 D;  3LMO A;  4H2Y C;  2FVA A;  2K0Y A;  2GDW A;  2QNW A;  2KGA A;  2CG5 B;  2KW2 A;  1L0I A;  1VKU A;  2FVF A;  2L22 A;  2KG8 A;  2LML A;  1OR5 A;  1T8K A;  2MF4 A;  5KP6 B;  2N50 A;  5KP7 B;  1NQ4 A;  4CA3 A;  2L4B A;  2L9F A;  2GDY A;  3EJE A;  1HY8 A;  2MY5 A;  3NY7 B;  2ROQ A;  2KR5 A;  4H2W C;  2VSQ A;  2LPK A;  2N6Y A;  2XZ1 C;  2EHT A;  2FQ0 A;  2KGE A;  4R0M A;  2CNR A;  2FQ1 A;  5EJD A;  2JU2 A;  1AF8 A;  2N5I A;  2MR7 A;  2KOS A;  2KWL A;  4IZ6 A;  2LIU A;  2JGP A;  2FAD A;  2N98 A;  2LTE A;  2FVE A;  2JU1 A;  2DNW A;  2GDX A;  2FQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...