2GDXA

Solution structure of the b. brevis tycc3-pcp in h-state
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
MGVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational switches modulate protein interactions in peptide antibiotic synthetases
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase/transport protein
molecule keywords Tyrocidine synthetase III
total genus 15
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2gdxA00
4PXHB 2L22A 2KWLA 2K93A 1T8KA 2CGQA 2K92A 2MD9A 2LTEA 2AF8A 2FADA 2CG5B 2MR7A 2FAEA 2LOLA 2K94A 2GDYA 2KG8A 2N5HA 2DNWA 1L0IA 1HY8A 2KOSA 2M5RA 2L4BA 1DNYA 4NEOA 2KGCA 4MRTC 2KG6A 4H2WC 5CZDB 2N5IA 3RG2A 1F80D 2K0XA 1NQ4A 2KGAA 2K0YA 4IZ6A 5KP7B 2XZ0D 3CE7A 2KR5A 5HVCA 3EJBA 2CQ8A 2FVFA 2EHSA 2L9FA 4CA3A 2GDWA 2LKIA 3LMOA 2FQ1A 2MR8A 2QNWA 2KOQA 2KGEA 2LPKA 2VSQA 1DV5A 2MY5A 2JU1A 2AVAA 2MF4A 3EJDA 2JU2A 2N6ZA 4R0MA 2PNGA 2FVAA 2LIUA 1X3OA 2KGDA 2JQ4A 2FACA 4BPGA 1HQBA 4DG9A 2N6YA 4BPFA 1ACPA 2FHSC 2X2BA 2EHTA 2KW2A 2JGPA 2MVVA 1KLPA 2KG9A 5KP6B 2XZ1C 1AF8A 2ROQA 3GZMA 1OR5A 4PWVB 2GDXA 2CNRA 5KP8B 2N98A 1L0HA 4H2YC 2FQ2A 3GZLA 2LMLA 2LIWA 5EJDA 2MVUA 2KOOA 2FQ0A 1VKUA 2LL8A 2AFEA 2K2QA 3EJEA 2N50A 3NY7B 2AFDA 5HV8A 2L0QA 4HKGA 4BPHA 2FVEA 4H2XC 2KOPA 2KORA
chains in the Genus database with same CATH superfamily
1VQ5P 4PXHB 2K93A 2CGQA 2MD9A 2M8PA 4XRQA 2FADA 3CXCO 4GR2A 3Q20A 2GDYA 3DTJA 5BS2A 3G71P 2KOSA 2L4BA 3I55P 3HYBA 2KGCA 4UHPB 2KG6A 3G29A 2VLPA 3CPWO 5BS1A 3CE7A 2BUOA 3G4SP 1AUMA 3CCVP 2CQ8A 1YJWP 1A43A 3CC4P 2L9FA 3U43A 2LKIA 3LMOA 1YITP 2FQ1A 4XFXA 1RNIA 1S72P 2Z46A 2QEXP 1VQNP 4QNBA 4U0DA 3H47A 3P05A 2JU2A 1QVGO 1QVFO 3VRLC 1Z6MA 3RG6C 1IUQA 1X3OA 2KGDA 1K73Q 2EG5A 5HGOA 1M6EX 2N6YA 1NJIQ 2E1MA 2JGPA 1KLPA 3G21A 5KP6B 1K9MQ 1Q7YQ 1Q82Q 1N8RQ 2VLNA 2PEKA 1RO0A 1M74A 2GDXA 3DS5A 5JPAA 1VQ8P 2GZJA 3E2DA 1VHNA 3H4EA 4COCA 2LIWA 5EJDA 4QKOA 2GZIA 3G26A 4HKGA 1E6JP 2PEMA 2K92A 3CCUP 2CWOA 1K30A 5I4TG 3OW2O 2NO8A 3LRYA 2JAZA 1GXHA 1KC8Q 2P9XA 3H0DA 2BHVA 1IMPA 3CCRP 1VQ6P 4MRTC 5CZDB 2N5IA 2JYLA 4IZ6A 2XZ0D 3GJNA 2GZFA 1AYIA 3HZQA 1EOQA 2EHSA 2KODA 2JYGA 2EIAA 4GR6A 2KOQA 2LPKA 2VSQA 3M1MA 5F2NA 2MY5A 2OARA 1K8AQ 2LIUA 4XFYA 1M1KQ 1MZ8A 4BPGA 1HQBA 4DG9A 3CC7P 2X2BA 3DS2A 2MVVA 2KG9A 1AF8A 3GZMA 4XFZA 5F2OA 1EIAA 4PWVB 5KP8B 2N98A 1L0HA 5F2KA 2PEQA 3B5IA 3GZLA 1Q81Q 2QA4P 1D1DA 2LMLA 2VLOA 5HGMA 2FQ0A 3DS0A 2GYKA 1VKUA 1YHQP 7CEIA 2LL8A 1YI2P 2JBGA 3B4QA 2KOPA 3CCSP 2KORA 1M6NA 2L22A 2KWLA 1W2BO 1T8KA 1QRJA 2EFJA 2LTEA 2AF8A 1M90Q 4U0AA 1BXIA 2MR7A 2FAEA 2LOLA 2K94A 2KG8A 2K5XA 2XXMA 3G1GA 1VQ4P 1L0IA 1HY8A 4U0BA 4U0EA 2M5RA 4F37A 3G1IA 1F80D 2K0XA 1VQPP 2VLQA 2K0YA 2DGYA 3G28A 2L6EA 4PH0A 5HVCA 3EJBA 2FVFA 1BAJA 2GDWA 1VQLP 2PEJA 3G6EP 1DV5A 3CMAP 2PEIA 2AVAA 2MF4A 4U0CA 1YJ9P 3EJDA 2FVAA 2WPTA 2JQ4A 2JO0A 1JJ2O 3CCMP 1ACPA 2FHSC 2M8LA 1VQMP 3CCJP 2XZ1C 3G0VA 2ONTA 1OR5A 3DS3A 3I56P 1YIJP 2OTLP 2JB0A 3MGEA 1RO2A 2GZEA 2FQ2A 2Z45A 4PH1A 1E0HA 2M8NA 1ZNVA 2MVUA 2KOOA 2AFEA 4M0IA 2N50A 3NY7B 2AFDA 3NTEA 5HV8A 2K0DX 2L0QA 4BPHA 1A8OA 2XV6A 1VQOP 3DS4A 3WBHA 2CG5B 3CMEP 4IPYA 2N5HA 1GXGA 2DNWA 2PY8A 1VQ9P 1UNKA 4WYMA 3GKLC 3CCLP 1DNYA 4NEOA 4H2WC 3RG2A 2KGAA 1NQ4A 2XT1A 3CD6P 1KQSO 1ZMBA 5KP7B 2ERHA 2KR5A 1FR2A 2PENA 1EMVA 4CA3A 3DS1A 2MR8A 2QNWA 5EW5E 2KGEA 5HGNA 2GZGA 1VQ7P 1VQKP 2JU1A 2N6ZA 4R0MA 2PNGA 2OTJP 4COPA 2FACA 4BPFA 2EHTA 2KW2A 2ROQA 2PEOA 1Q86Q 2CNRA 4H2YC 1IMQA 4XROA 1GPJA 2Z44A 3CC2P 5HGLA 1KD1Q 3CCQP 5DCKA 4U0FA 1YJNP 3EJEA 1UJZA 2K2QA 3CCEP 1CEIA 3DPHA 2LF4A 2FVEA 4H2XC
chains in the Genus database with same CATH topology
4PXHB 2L22A 2KWLA 2K93A 1T8KA 2CGQA 2K92A 2MD9A 2LTEA 2AF8A 2FADA 2CG5B 2MR7A 2FAEA 2LOLA 2K94A 2GDYA 2KG8A 2N5HA 2DNWA 1L0IA 1HY8A 2KOSA 2M5RA 2L4BA 1DNYA 4NEOA 2KGCA 4MRTC 2KG6A 4H2WC 5CZDB 2N5IA 3RG2A 1F80D 2K0XA 1NQ4A 2KGAA 2K0YA 4IZ6A 5KP7B 2XZ0D 3CE7A 2KR5A 5HVCA 3EJBA 2CQ8A 2FVFA 2EHSA 2L9FA 4CA3A 2GDWA 2LKIA 3LMOA 2FQ1A 2MR8A 2QNWA 2KOQA 2KGEA 2LPKA 2VSQA 1DV5A 2MY5A 2JU1A 2AVAA 2MF4A 3EJDA 2JU2A 2N6ZA 4R0MA 2PNGA 2FVAA 2LIUA 1X3OA 2KGDA 2JQ4A 2FACA 4BPGA 1HQBA 4DG9A 2N6YA 4BPFA 1ACPA 2FHSC 2X2BA 2EHTA 2KW2A 2JGPA 2MVVA 1KLPA 2KG9A 5KP6B 2XZ1C 1AF8A 2ROQA 3GZMA 1OR5A 4PWVB 2GDXA 2CNRA 5KP8B 2N98A 1L0HA 4H2YC 2FQ2A 3GZLA 2LMLA 2LIWA 5EJDA 2MVUA 2KOOA 2FQ0A 1VKUA 2LL8A 2AFEA 2K2QA 3EJEA 2N50A 3NY7B 2AFDA 5HV8A 2L0QA 4HKGA 4BPHA 2FVEA 4H2XC 2KOPA 2KORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PXH B;  2L22 A;  2KWL A;  2K93 A;  1T8K A;  2CGQ A;  2K92 A;  2MD9 A;  2LTE A;  2AF8 A;  2FAD A;  2CG5 B;  2MR7 A;  2FAE A;  2LOL A;  2K94 A;  2GDY A;  2KG8 A;  2N5H A;  2DNW A;  1L0I A;  1HY8 A;  2KOS A;  2M5R A;  2L4B A;  1DNY A;  4NEO A;  2KGC A;  4MRT C;  2KG6 A;  4H2W C;  5CZD B;  2N5I A;  3RG2 A;  1F80 D;  2K0X A;  1NQ4 A;  2KGA A;  2K0Y A;  4IZ6 A;  5KP7 B;  2XZ0 D;  3CE7 A;  2KR5 A;  5HVC A;  3EJB A;  2CQ8 A;  2FVF A;  2EHS A;  2L9F A;  4CA3 A;  2GDW A;  2LKI A;  3LMO A;  2FQ1 A;  2MR8 A;  2QNW A;  2KOQ A;  2KGE A;  2LPK A;  2VSQ A;  1DV5 A;  2MY5 A;  2JU1 A;  2AVA A;  2MF4 A;  3EJD A;  2JU2 A;  2N6Z A;  4R0M A;  2PNG A;  2FVA A;  2LIU A;  1X3O A;  2KGD A;  2JQ4 A;  2FAC A;  4BPG A;  1HQB A;  4DG9 A;  2N6Y A;  4BPF A;  1ACP A;  2FHS C;  2X2B A;  2EHT A;  2KW2 A;  2JGP A;  2MVV A;  1KLP A;  2KG9 A;  5KP6 B;  2XZ1 C;  1AF8 A;  2ROQ A;  3GZM A;  1OR5 A;  4PWV B;  2GDX A;  2CNR A;  5KP8 B;  2N98 A;  1L0H A;  4H2Y C;  2FQ2 A;  3GZL A;  2LML A;  2LIW A;  5EJD A;  2MVU A;  2KOO A;  2FQ0 A;  1VKU A;  2LL8 A;  2AFE A;  2K2Q A;  3EJE A;  2N50 A;  3NY7 B;  2AFD A;  5HV8 A;  2L0Q A;  4HKG A;  4BPH A;  2FVE A;  4H2X C;  2KOP A;  2KOR A; 
#chains in the Genus database with same CATH topology
 1VQ5 P;  4PXH B;  2K93 A;  2CGQ A;  2MD9 A;  2M8P A;  4XRQ A;  2FAD A;  3CXC O;  4GR2 A;  3Q20 A;  2GDY A;  3DTJ A;  5BS2 A;  3G71 P;  2KOS A;  2L4B A;  3I55 P;  3HYB A;  2KGC A;  4UHP B;  2KG6 A;  3G29 A;  2VLP A;  3CPW O;  5BS1 A;  3CE7 A;  2BUO A;  3G4S P;  1AUM A;  3CCV P;  2CQ8 A;  1YJW P;  1A43 A;  3CC4 P;  2L9F A;  3U43 A;  2LKI A;  3LMO A;  1YIT P;  2FQ1 A;  4XFX A;  1RNI A;  1S72 P;  2Z46 A;  2QEX P;  1VQN P;  4QNB A;  4U0D A;  3H47 A;  3P05 A;  2JU2 A;  1QVG O;  1QVF O;  3VRL C;  1Z6M A;  3RG6 C;  1IUQ A;  1X3O A;  2KGD A;  1K73 Q;  2EG5 A;  5HGO A;  1M6E X;  2N6Y A;  1NJI Q;  2E1M A;  2JGP A;  1KLP A;  3G21 A;  5KP6 B;  1K9M Q;  1Q7Y Q;  1Q82 Q;  1N8R Q;  2VLN A;  2PEK A;  1RO0 A;  1M74 A;  2GDX A;  3DS5 A;  5JPA A;  1VQ8 P;  2GZJ A;  3E2D A;  1VHN A;  3H4E A;  4COC A;  2LIW A;  5EJD A;  4QKO A;  2GZI A;  3G26 A;  4HKG A;  1E6J P;  2PEM A;  2K92 A;  3CCU P;  2CWO A;  1K30 A;  5I4T G;  3OW2 O;  2NO8 A;  3LRY A;  2JAZ A;  1GXH A;  1KC8 Q;  2P9X A;  3H0D A;  2BHV A;  1IMP A;  3CCR P;  1VQ6 P;  4MRT C;  5CZD B;  2N5I A;  2JYL A;  4IZ6 A;  2XZ0 D;  3GJN A;  2GZF A;  1AYI A;  3HZQ A;  1EOQ A;  2EHS A;  2KOD A;  2JYG A;  2EIA A;  4GR6 A;  2KOQ A;  2LPK A;  2VSQ A;  3M1M A;  5F2N A;  2MY5 A;  2OAR A;  1K8A Q;  2LIU A;  4XFY A;  1M1K Q;  1MZ8 A;  4BPG A;  1HQB A;  4DG9 A;  3CC7 P;  2X2B A;  3DS2 A;  2MVV A;  2KG9 A;  1AF8 A;  3GZM A;  4XFZ A;  5F2O A;  1EIA A;  4PWV B;  5KP8 B;  2N98 A;  1L0H A;  5F2K A;  2PEQ A;  3B5I A;  3GZL A;  1Q81 Q;  2QA4 P;  1D1D A;  2LML A;  2VLO A;  5HGM A;  2FQ0 A;  3DS0 A;  2GYK A;  1VKU A;  1YHQ P;  7CEI A;  2LL8 A;  1YI2 P;  2JBG A;  3B4Q A;  2KOP A;  3CCS P;  2KOR A;  1M6N A;  2L22 A;  2KWL A;  1W2B O;  1T8K A;  1QRJ A;  2EFJ A;  2LTE A;  2AF8 A;  1M90 Q;  4U0A A;  1BXI A;  2MR7 A;  2FAE A;  2LOL A;  2K94 A;  2KG8 A;  2K5X A;  2XXM A;  3G1G A;  1VQ4 P;  1L0I A;  1HY8 A;  4U0B A;  4U0E A;  2M5R A;  4F37 A;  3G1I A;  1F80 D;  2K0X A;  1VQP P;  2VLQ A;  2K0Y A;  2DGY A;  3G28 A;  2L6E A;  4PH0 A;  5HVC A;  3EJB A;  2FVF A;  1BAJ A;  2GDW A;  1VQL P;  2PEJ A;  3G6E P;  1DV5 A;  3CMA P;  2PEI A;  2AVA A;  2MF4 A;  4U0C A;  1YJ9 P;  3EJD A;  2FVA A;  2WPT A;  2JQ4 A;  2JO0 A;  1JJ2 O;  3CCM P;  1ACP A;  2FHS C;  2M8L A;  1VQM P;  3CCJ P;  2XZ1 C;  3G0V A;  2ONT A;  1OR5 A;  3DS3 A;  3I56 P;  1YIJ P;  2OTL P;  2JB0 A;  3MGE A;  1RO2 A;  2GZE A;  2FQ2 A;  2Z45 A;  4PH1 A;  1E0H A;  2M8N A;  1ZNV A;  2MVU A;  2KOO A;  2AFE A;  4M0I A;  2N50 A;  3NY7 B;  2AFD A;  3NTE A;  5HV8 A;  2K0D X;  2L0Q A;  4BPH A;  1A8O A;  2XV6 A;  1VQO P;  3DS4 A;  3WBH A;  2CG5 B;  3CME P;  4IPY A;  2N5H A;  1GXG A;  2DNW A;  2PY8 A;  1VQ9 P;  1UNK A;  4WYM A;  3GKL C;  3CCL P;  1DNY A;  4NEO A;  4H2W C;  3RG2 A;  2KGA A;  1NQ4 A;  2XT1 A;  3CD6 P;  1KQS O;  1ZMB A;  5KP7 B;  2ERH A;  2KR5 A;  1FR2 A;  2PEN A;  1EMV A;  4CA3 A;  3DS1 A;  2MR8 A;  2QNW A;  5EW5 E;  2KGE A;  5HGN A;  2GZG A;  1VQ7 P;  1VQK P;  2JU1 A;  2N6Z A;  4R0M A;  2PNG A;  2OTJ P;  4COP A;  2FAC A;  4BPF A;  2EHT A;  2KW2 A;  2ROQ A;  2PEO A;  1Q86 Q;  2CNR A;  4H2Y C;  1IMQ A;  4XRO A;  1GPJ A;  2Z44 A;  3CC2 P;  5HGL A;  1KD1 Q;  3CCQ P;  5DCK A;  4U0F A;  1YJN P;  3EJE A;  1UJZ A;  2K2Q A;  3CCE P;  1CEI A;  3DPH A;  2LF4 A;  2FVE A;  4H2X C; 
#chains in the Genus database with same CATH homology
 4PXH B;  2L22 A;  2KWL A;  2K93 A;  1T8K A;  2CGQ A;  2K92 A;  2MD9 A;  2LTE A;  2AF8 A;  2FAD A;  2CG5 B;  2MR7 A;  2FAE A;  2LOL A;  2K94 A;  2GDY A;  2KG8 A;  2N5H A;  2DNW A;  1L0I A;  1HY8 A;  2KOS A;  2M5R A;  2L4B A;  1DNY A;  4NEO A;  2KGC A;  4MRT C;  2KG6 A;  4H2W C;  5CZD B;  2N5I A;  3RG2 A;  1F80 D;  2K0X A;  1NQ4 A;  2KGA A;  2K0Y A;  4IZ6 A;  5KP7 B;  2XZ0 D;  3CE7 A;  2KR5 A;  5HVC A;  3EJB A;  2CQ8 A;  2FVF A;  2EHS A;  2L9F A;  4CA3 A;  2GDW A;  2LKI A;  3LMO A;  2FQ1 A;  2MR8 A;  2QNW A;  2KOQ A;  2KGE A;  2LPK A;  2VSQ A;  1DV5 A;  2MY5 A;  2JU1 A;  2AVA A;  2MF4 A;  3EJD A;  2JU2 A;  2N6Z A;  4R0M A;  2PNG A;  2FVA A;  2LIU A;  1X3O A;  2KGD A;  2JQ4 A;  2FAC A;  4BPG A;  1HQB A;  4DG9 A;  2N6Y A;  4BPF A;  1ACP A;  2FHS C;  2X2B A;  2EHT A;  2KW2 A;  2JGP A;  2MVV A;  1KLP A;  2KG9 A;  5KP6 B;  2XZ1 C;  1AF8 A;  2ROQ A;  3GZM A;  1OR5 A;  4PWV B;  2GDX A;  2CNR A;  5KP8 B;  2N98 A;  1L0H A;  4H2Y C;  2FQ2 A;  3GZL A;  2LML A;  2LIW A;  5EJD A;  2MVU A;  2KOO A;  2FQ0 A;  1VKU A;  2LL8 A;  2AFE A;  2K2Q A;  3EJE A;  2N50 A;  3NY7 B;  2AFD A;  5HV8 A;  2L0Q A;  4HKG A;  4BPH A;  2FVE A;  4H2X C;  2KOP A;  2KOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...