2GDXA

Solution structure of the b. brevis tycc3-pcp in h-state
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
MGVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/transport protein
molecule keywords Tyrocidine synthetase III
publication title Conformational switches modulate protein interactions in peptide antibiotic synthetases
pubmed doi rcsb
source organism Brevibacillus parabrevis
total genus 15
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2gdxA00
2GDWA 2K94A 2LOLA 2KOOA 5KP6B 2N50A 2ROQA 2KGCA 2AFDA 2N5HA 2K92A 2M5RA 2XZ1C 4IZ6A 2FAEA 2CQ8A 1VKUA 3NY7B 2GDYA 4PXHB 2MY5A 2FVFA 2CNRA 1DNYA 4BPFA 4H2YC 2JU1A 1L0IA 4HKGA 2KR5A 2CG5B 2N98A 4DG9A 1HY8A 2JGPA 2MVVA 2GDXA 2KOSA 2L22A 3EJBA 1ACPA 5KP7B 4BPHA 3LMOA 5HV8A 2QNWA 1KLPA 2FADA 3RG2A 2KG8A 2L0QA 2MR7A 3CE7A 2KGDA 1OR5A 4MRTC 2K2QA 2KGEA 2PNGA 2LL8A 1AF8A 2KWLA 4R0MA 4PWVB 2FQ0A 5KP8B 2LTEA 2FQ2A 1F80D 2EHTA 1X3OA 2MF4A 2FVEA 3EJEA 2LIUA 2KOPA 2MD9A 2MVUA 4H2WC 2AFEA 1NQ4A 4NEOA 5HVCA 2K93A 1T8KA 2K0XA 2KGAA 2N5IA 3GZLA 2VSQA 2KG6A 2N6ZA 2FHSC 2LIWA 1L0HA 4CA3A 1DV5A 1HQBA 2JQ4A 5CZDB 2N6YA 2FVAA 2KORA 2X2BA 2FQ1A 3EJDA 2L9FA 2L4BA 2XZ0D 2CGQA 2KOQA 2LKIA 2AVAA 2KW2A 2LPKA 2KG9A 2AF8A 2FACA 2K0YA 5EJDA 4H2XC 3GZMA 2JU2A 2LMLA 2DNWA 2MR8A 2EHSA 4BPGA
chains in the Genus database with same CATH superfamily
2GZFA 2KOOA 3CMAP 2ROQA 5HGOA 2K92A 2XZ1C 1FR2A 1GPJA 4PXHB 2XV6A 1DNYA 3B5IA 5DCKA 2VLNA 2JU1A 2JYLA 2CG5B 2GZEA 3DS1A 1MZ8A 4U0BA 1QRJA 2LF4A 3CCEP 2GYKA 3P05A 3EJBA 1Q7YQ 5F2NA 5KP7B 4XROA 1VQMP 2EFJA 1QVGO 3E2DA 3RG2A 2QEXP 2KG8A 4XFYA 2KGDA 3G21A 1Q81Q 2JYGA 1M90Q 4PWVB 3MGEA 2FQ0A 2MF4A 3G26A 2MD9A 1QVFO 1ZNVA 1NQ4A 4NEOA 1YITP 1ZMBA 5HVCA 3CCRP 1D1DA 1VQLP 2N5IA 3CCUP 2BUOA 2KG6A 1M74A 3Q20A 4U0CA 2LIWA 1AUMA 1EIAA 2N6YA 2FQ1A 3CXCO 3EJDA 4U0DA 2KW2A 2AF8A 3M1MA 1BXIA 5EJDA 4H2XC 3G71P 2JU2A 2LMLA 2MR8A 4BPGA 4U0AA 3GJNA 2K0DX 1M6NA 2JO0A 2AFDA 4QNBA 2OARA 2M5RA 2FAEA 5EW5E 2MY5A 2FVFA 3I56P 4PH1A 2XT1A 1YJWP 2VLQA 3CCJP 3CC7P 4H2YC 2VLPA 4HKGA 3CC2P 3G6EP 3RG6C 1HY8A 1Q82Q 3DTJA 1VQKP 2GDXA 3CCSP 2L22A 2OTLP 1YHQP 4BPHA 2JB0A 1VQ4P 5HV8A 3CD6P 3H4EA 1KLPA 3CC4P 2Z44A 2MR7A 2K2QA 2KGEA 3HYBA 4R0MA 3G0VA 4GR6A 1F80D 2OTJP 1X3OA 3OW2O 3EJEA 3WBHA 1JJ2O 1S72P 2KOPA 2P9XA 4GR2A 2MVUA 2K5XA 2AFEA 1CEIA 1K30A 2L6EA 1T8KA 1VQ6P 2KODA 3GZLA 2NO8A 3G1IA 3I55P 2FHSC 2VLOA 3CPWO 1L0HA 1NJIQ 3H0DA 1HQBA 2JQ4A 5CZDB 3HZQA 1RO2A 2KORA 2X2BA 1IUQA 4IPYA 2XZ0D 2KOQA 1VQ8P 1VQ5P 2K0YA 1UNKA 4UHPB 2GDWA 2K94A 3B4QA 2LOLA 2JAZA 5KP6B 2KGCA 2N5HA 2PEMA 4IZ6A 1K73Q 2CQ8A 3NY7B 2CNRA 1A43A 5F2OA 5HGNA 3CCMP 4BPFA 1YJ9P 1L0IA 1M6EX 2KR5A 1N8RQ 2PY8A 4DG9A 2M8PA 1A8OA 2MVVA 5JPAA 1KC8Q 2BHVA 3LMOA 4M0IA 2FADA 1VQNP 1KQSO 3CE7A 1AF8A 2KWLA 2PEQA 5BS2A 1Q86Q 3DS2A 7CEIA 5KP8B 2FQ2A 1K8AQ 1IMQA 2WPTA 3DPHA 1VQ7P 2GZIA 1VQOP 4H2WC 1EMVA 2KGAA 3GKLC 1YJNP 3CCVP 1AYIA 3NTEA 2QA4P 2VSQA 1E0HA 5I4TG 3G4SP 4CA3A 3CCQP 4XRQA 1DV5A 2DGYA 2FVAA 1UJZA 1RNIA 2L9FA 4XFZA 1Z6MA 2CGQA 2LKIA 3DS3A 2E1MA 2LPKA 1YIJP 2Z45A 1E6JP 3GZMA 1KD1Q 2DNWA 2EHSA 4WYMA 5F2KA 2N50A 1VQPP 1BAJA 1VKUA 5HGMA 2GDYA 4F37A 4XFXA 2CWOA 3U43A 1GXGA 3DS5A 2N98A 3LRYA 2JGPA 2PENA 4COPA 2KOSA 1ACPA 2GZJA 3DS4A 1M1KQ 2QNWA 1W2BO 2L0QA 1YI2P 4PH0A 1OR5A 4MRTC 2PNGA 2M8NA 2LL8A 2PEJA 1IMPA 3H47A 2LTEA 2EHTA 4QKOA 2FVEA 1RO0A 5BS1A 2LIUA 1VQ9P 2ONTA 2ERHA 2EG5A 2JBGA 3G29A 4COCA 2PEKA 2K93A 2K0XA 2GZGA 2Z46A 2PEOA 2N6ZA 3VRLC 5HGLA 4U0FA 2PEIA 1VHNA 4U0EA 2XXMA 2L4BA 2AVAA 2KG9A 2FACA 3CMEP 1EOQA 3G28A 2EIAA 3DS0A 1K9MQ 3G1GA 1GXHA 3CCLP 2M8LA
chains in the Genus database with same CATH topology
2GDWA 2K94A 2LOLA 2KOOA 5KP6B 2N50A 2ROQA 2KGCA 2AFDA 2N5HA 2K92A 2M5RA 2XZ1C 4IZ6A 2FAEA 2CQ8A 1VKUA 3NY7B 2GDYA 4PXHB 2MY5A 2FVFA 2CNRA 1DNYA 4BPFA 4H2YC 2JU1A 1L0IA 4HKGA 2KR5A 2CG5B 2N98A 4DG9A 1HY8A 2JGPA 2MVVA 2GDXA 2KOSA 2L22A 3EJBA 1ACPA 5KP7B 4BPHA 3LMOA 5HV8A 2QNWA 1KLPA 2FADA 3RG2A 2KG8A 2L0QA 2MR7A 3CE7A 2KGDA 1OR5A 4MRTC 2K2QA 2KGEA 2PNGA 2LL8A 1AF8A 2KWLA 4R0MA 4PWVB 2FQ0A 5KP8B 2LTEA 2FQ2A 1F80D 2EHTA 1X3OA 2MF4A 2FVEA 3EJEA 2LIUA 2KOPA 2MD9A 2MVUA 4H2WC 2AFEA 1NQ4A 4NEOA 5HVCA 2K93A 1T8KA 2K0XA 2KGAA 2N5IA 3GZLA 2VSQA 2KG6A 2N6ZA 2FHSC 2LIWA 1L0HA 4CA3A 1DV5A 1HQBA 2JQ4A 5CZDB 2N6YA 2FVAA 2KORA 2X2BA 2FQ1A 3EJDA 2L9FA 2L4BA 2XZ0D 2CGQA 2KOQA 2LKIA 2AVAA 2KW2A 2LPKA 2KG9A 2AF8A 2FACA 2K0YA 5EJDA 4H2XC 3GZMA 2JU2A 2LMLA 2DNWA 2MR8A 2EHSA 4BPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDW A;  2K94 A;  2LOL A;  2KOO A;  5KP6 B;  2N50 A;  2ROQ A;  2KGC A;  2AFD A;  2N5H A;  2K92 A;  2M5R A;  2XZ1 C;  4IZ6 A;  2FAE A;  2CQ8 A;  1VKU A;  3NY7 B;  2GDY A;  4PXH B;  2MY5 A;  2FVF A;  2CNR A;  1DNY A;  4BPF A;  4H2Y C;  2JU1 A;  1L0I A;  4HKG A;  2KR5 A;  2CG5 B;  2N98 A;  4DG9 A;  1HY8 A;  2JGP A;  2MVV A;  2GDX A;  2KOS A;  2L22 A;  3EJB A;  1ACP A;  5KP7 B;  4BPH A;  3LMO A;  5HV8 A;  2QNW A;  1KLP A;  2FAD A;  3RG2 A;  2KG8 A;  2L0Q A;  2MR7 A;  3CE7 A;  2KGD A;  1OR5 A;  4MRT C;  2K2Q A;  2KGE A;  2PNG A;  2LL8 A;  1AF8 A;  2KWL A;  4R0M A;  4PWV B;  2FQ0 A;  5KP8 B;  2LTE A;  2FQ2 A;  1F80 D;  2EHT A;  1X3O A;  2MF4 A;  2FVE A;  3EJE A;  2LIU A;  2KOP A;  2MD9 A;  2MVU A;  4H2W C;  2AFE A;  1NQ4 A;  4NEO A;  5HVC A;  2K93 A;  1T8K A;  2K0X A;  2KGA A;  2N5I A;  3GZL A;  2VSQ A;  2KG6 A;  2N6Z A;  2FHS C;  2LIW A;  1L0H A;  4CA3 A;  1DV5 A;  1HQB A;  2JQ4 A;  5CZD B;  2N6Y A;  2FVA A;  2KOR A;  2X2B A;  2FQ1 A;  3EJD A;  2L9F A;  2L4B A;  2XZ0 D;  2CGQ A;  2KOQ A;  2LKI A;  2AVA A;  2KW2 A;  2LPK A;  2KG9 A;  2AF8 A;  2FAC A;  2K0Y A;  5EJD A;  4H2X C;  3GZM A;  2JU2 A;  2LML A;  2DNW A;  2MR8 A;  2EHS A;  4BPG A; 
#chains in the Genus database with same CATH topology
 2GZF A;  2KOO A;  3CMA P;  2ROQ A;  5HGO A;  2K92 A;  2XZ1 C;  1FR2 A;  1GPJ A;  4PXH B;  2XV6 A;  1DNY A;  3B5I A;  5DCK A;  2VLN A;  2JU1 A;  2JYL A;  2CG5 B;  2GZE A;  3DS1 A;  1MZ8 A;  4U0B A;  1QRJ A;  2LF4 A;  3CCE P;  2GYK A;  3P05 A;  3EJB A;  1Q7Y Q;  5F2N A;  5KP7 B;  4XRO A;  1VQM P;  2EFJ A;  1QVG O;  3E2D A;  3RG2 A;  2QEX P;  2KG8 A;  4XFY A;  2KGD A;  3G21 A;  1Q81 Q;  2JYG A;  1M90 Q;  4PWV B;  3MGE A;  2FQ0 A;  2MF4 A;  3G26 A;  2MD9 A;  1QVF O;  1ZNV A;  1NQ4 A;  4NEO A;  1YIT P;  1ZMB A;  5HVC A;  3CCR P;  1D1D A;  1VQL P;  2N5I A;  3CCU P;  2BUO A;  2KG6 A;  1M74 A;  3Q20 A;  4U0C A;  2LIW A;  1AUM A;  1EIA A;  2N6Y A;  2FQ1 A;  3CXC O;  3EJD A;  4U0D A;  2KW2 A;  2AF8 A;  3M1M A;  1BXI A;  5EJD A;  4H2X C;  3G71 P;  2JU2 A;  2LML A;  2MR8 A;  4BPG A;  4U0A A;  3GJN A;  2K0D X;  1M6N A;  2JO0 A;  2AFD A;  4QNB A;  2OAR A;  2M5R A;  2FAE A;  5EW5 E;  2MY5 A;  2FVF A;  3I56 P;  4PH1 A;  2XT1 A;  1YJW P;  2VLQ A;  3CCJ P;  3CC7 P;  4H2Y C;  2VLP A;  4HKG A;  3CC2 P;  3G6E P;  3RG6 C;  1HY8 A;  1Q82 Q;  3DTJ A;  1VQK P;  2GDX A;  3CCS P;  2L22 A;  2OTL P;  1YHQ P;  4BPH A;  2JB0 A;  1VQ4 P;  5HV8 A;  3CD6 P;  3H4E A;  1KLP A;  3CC4 P;  2Z44 A;  2MR7 A;  2K2Q A;  2KGE A;  3HYB A;  4R0M A;  3G0V A;  4GR6 A;  1F80 D;  2OTJ P;  1X3O A;  3OW2 O;  3EJE A;  3WBH A;  1JJ2 O;  1S72 P;  2KOP A;  2P9X A;  4GR2 A;  2MVU A;  2K5X A;  2AFE A;  1CEI A;  1K30 A;  2L6E A;  1T8K A;  1VQ6 P;  2KOD A;  3GZL A;  2NO8 A;  3G1I A;  3I55 P;  2FHS C;  2VLO A;  3CPW O;  1L0H A;  1NJI Q;  3H0D A;  1HQB A;  2JQ4 A;  5CZD B;  3HZQ A;  1RO2 A;  2KOR A;  2X2B A;  1IUQ A;  4IPY A;  2XZ0 D;  2KOQ A;  1VQ8 P;  1VQ5 P;  2K0Y A;  1UNK A;  4UHP B;  2GDW A;  2K94 A;  3B4Q A;  2LOL A;  2JAZ A;  5KP6 B;  2KGC A;  2N5H A;  2PEM A;  4IZ6 A;  1K73 Q;  2CQ8 A;  3NY7 B;  2CNR A;  1A43 A;  5F2O A;  5HGN A;  3CCM P;  4BPF A;  1YJ9 P;  1L0I A;  1M6E X;  2KR5 A;  1N8R Q;  2PY8 A;  4DG9 A;  2M8P A;  1A8O A;  2MVV A;  5JPA A;  1KC8 Q;  2BHV A;  3LMO A;  4M0I A;  2FAD A;  1VQN P;  1KQS O;  3CE7 A;  1AF8 A;  2KWL A;  2PEQ A;  5BS2 A;  1Q86 Q;  3DS2 A;  7CEI A;  5KP8 B;  2FQ2 A;  1K8A Q;  1IMQ A;  2WPT A;  3DPH A;  1VQ7 P;  2GZI A;  1VQO P;  4H2W C;  1EMV A;  2KGA A;  3GKL C;  1YJN P;  3CCV P;  1AYI A;  3NTE A;  2QA4 P;  2VSQ A;  1E0H A;  5I4T G;  3G4S P;  4CA3 A;  3CCQ P;  4XRQ A;  1DV5 A;  2DGY A;  2FVA A;  1UJZ A;  1RNI A;  2L9F A;  4XFZ A;  1Z6M A;  2CGQ A;  2LKI A;  3DS3 A;  2E1M A;  2LPK A;  1YIJ P;  2Z45 A;  1E6J P;  3GZM A;  1KD1 Q;  2DNW A;  2EHS A;  4WYM A;  5F2K A;  2N50 A;  1VQP P;  1BAJ A;  1VKU A;  5HGM A;  2GDY A;  4F37 A;  4XFX A;  2CWO A;  3U43 A;  1GXG A;  3DS5 A;  2N98 A;  3LRY A;  2JGP A;  2PEN A;  4COP A;  2KOS A;  1ACP A;  2GZJ A;  3DS4 A;  1M1K Q;  2QNW A;  1W2B O;  2L0Q A;  1YI2 P;  4PH0 A;  1OR5 A;  4MRT C;  2PNG A;  2M8N A;  2LL8 A;  2PEJ A;  1IMP A;  3H47 A;  2LTE A;  2EHT A;  4QKO A;  2FVE A;  1RO0 A;  5BS1 A;  2LIU A;  1VQ9 P;  2ONT A;  2ERH A;  2EG5 A;  2JBG A;  3G29 A;  4COC A;  2PEK A;  2K93 A;  2K0X A;  2GZG A;  2Z46 A;  2PEO A;  2N6Z A;  3VRL C;  5HGL A;  4U0F A;  2PEI A;  1VHN A;  4U0E A;  2XXM A;  2L4B A;  2AVA A;  2KG9 A;  2FAC A;  3CME P;  1EOQ A;  3G28 A;  2EIA A;  3DS0 A;  1K9M Q;  3G1G A;  1GXH A;  3CCL P;  2M8L A; 
#chains in the Genus database with same CATH homology
 2GDW A;  2K94 A;  2LOL A;  2KOO A;  5KP6 B;  2N50 A;  2ROQ A;  2KGC A;  2AFD A;  2N5H A;  2K92 A;  2M5R A;  2XZ1 C;  4IZ6 A;  2FAE A;  2CQ8 A;  1VKU A;  3NY7 B;  2GDY A;  4PXH B;  2MY5 A;  2FVF A;  2CNR A;  1DNY A;  4BPF A;  4H2Y C;  2JU1 A;  1L0I A;  4HKG A;  2KR5 A;  2CG5 B;  2N98 A;  4DG9 A;  1HY8 A;  2JGP A;  2MVV A;  2GDX A;  2KOS A;  2L22 A;  3EJB A;  1ACP A;  5KP7 B;  4BPH A;  3LMO A;  5HV8 A;  2QNW A;  1KLP A;  2FAD A;  3RG2 A;  2KG8 A;  2L0Q A;  2MR7 A;  3CE7 A;  2KGD A;  1OR5 A;  4MRT C;  2K2Q A;  2KGE A;  2PNG A;  2LL8 A;  1AF8 A;  2KWL A;  4R0M A;  4PWV B;  2FQ0 A;  5KP8 B;  2LTE A;  2FQ2 A;  1F80 D;  2EHT A;  1X3O A;  2MF4 A;  2FVE A;  3EJE A;  2LIU A;  2KOP A;  2MD9 A;  2MVU A;  4H2W C;  2AFE A;  1NQ4 A;  4NEO A;  5HVC A;  2K93 A;  1T8K A;  2K0X A;  2KGA A;  2N5I A;  3GZL A;  2VSQ A;  2KG6 A;  2N6Z A;  2FHS C;  2LIW A;  1L0H A;  4CA3 A;  1DV5 A;  1HQB A;  2JQ4 A;  5CZD B;  2N6Y A;  2FVA A;  2KOR A;  2X2B A;  2FQ1 A;  3EJD A;  2L9F A;  2L4B A;  2XZ0 D;  2CGQ A;  2KOQ A;  2LKI A;  2AVA A;  2KW2 A;  2LPK A;  2KG9 A;  2AF8 A;  2FAC A;  2K0Y A;  5EJD A;  4H2X C;  3GZM A;  2JU2 A;  2LML A;  2DNW A;  2MR8 A;  2EHS A;  4BPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...