2GDXA

Solution structure of the b. brevis tycc3-pcp in h-state
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
b'MGVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrocidine synthetase III
publication title Conformational switches modulate protein interactions in peptide antibiotic synthetases
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase/transport protein
total genus 15
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2gdxA00
2K2QA 1L0HA 2MVUA 1VKUA 2KGAA 1NQ4A 2N6ZA 2XZ1C 2KW2A 4H2YC 2FADA 2N98A 1F80D 2MR7A 2KGEA 2CQ8A 3GZMA 2MVVA 2LL8A 2FQ1A 2FQ2A 2KWLA 4IZ6A 5HV8A 5KP8B 1T8KA 2XZ0D 2KG6A 5KP6B 2K94A 2QNWA 5EJDA 1HQBA 2GDXA 2KG9A 2KOOA 2GDWA 2MD9A 2AF8A 2N6YA 4BPHA 2FVAA 2N50A 2L9FA 4DG9A 4CA3A 2JQ4A 4H2WC 2GDYA 4MRTC 2LIUA 3CE7A 2FHSC 2K92A 2CGQA 2LOLA 2CG5B 2FQ0A 3LMOA 2M5RA 3EJEA 2LKIA 2K0XA 1X3OA 2FVEA 2JU1A 2ROQA 2EHTA 4H2XC 2KR5A 2FACA 1AF8A 2DNWA 2LPKA 2KOQA 1HY8A 2X2BA 1OR5A 2KGCA 2AFDA 2L22A 3NY7B 2KOSA 1KLPA 2VSQA 4PWVB 2KORA 2AVAA 2EHSA 2MY5A 5KP7B 1DNYA 2FVFA 2LTEA 2MF4A 2KG8A 2L4BA 3GZLA 5HVCA 4HKGA 2K93A 2MR8A 2PNGA 2JU2A 2N5IA 2JGPA 2LIWA 4R0MA 1DV5A 4BPGA 2CNRA 2N5HA 3RG2A 2K0YA 2KOPA 2KGDA 4NEOA 2LMLA 1ACPA 2AFEA 4PXHB 1L0IA 5CZDB 2L0QA 4BPFA 3EJBA 3EJDA 2FAEA
chains in the Genus database with same CATH superfamily
2CWOA 1YJ9P 4H2YC 2N98A 3CCVP 1F80D 2KGEA 1IMQA 1VQ7P 2JYGA 1AUMA 1T8KA 2VLPA 2KG6A 1ZNVA 2K94A 5KP6B 5EJDA 2KG9A 3DS1A 4COPA 1YHQP 2GZIA 1YJNP 4BPHA 1M6NA 1Q7YQ 1E0HA 2DGYA 2XV6A 3DPHA 2VLOA 1YI2P 4H2WC 2GDYA 4XROA 4M0IA 2M8NA 1VQLP 2LOLA 3CCMP 1BAJA 1VQMP 2FVEA 5HGLA 3MGEA 2ROQA 2PENA 1AF8A 2P9XA 1M1KQ 2KOQA 4COCA 2ERHA 4U0FA 1OR5A 2PEJA 3M1MA 4QKOA 2AFDA 2KOSA 1KLPA 1YIJP 2GZFA 1K9MQ 1VQNP 1FR2A 2AVAA 3H47A 2EHSA 5KP7B 2FVFA 3G1GA 2MF4A 2KG8A 2L4BA 1VQ9P 3GZLA 3G6EP 4HKGA 3G4SP 3U43A 3HYBA 1RNIA 1DV5A 2CNRA 3LRYA 2K0YA 1VQ6P 2KGDA 4U0DA 3H0DA 2JAZA 1L0HA 2KGAA 2OTJP 2KW2A 3DS5A 5HGNA 2CQ8A 2LL8A 2VLNA 2KWLA 5HGMA 5DCKA 2LF4A 3G28A 2GDWA 2MD9A 3CC4P 2AF8A 2N6YA 2EG5A 2FVAA 3I55P 1S72P 5F2OA 4CA3A 1CEIA 2BHVA 4PH0A 2LIUA 2CG5B 2M5RA 1GXGA 3EJEA 2LKIA 1VQPP 2K0XA 5EW5E 2K0DX 1VQOP 2QEXP 3RG6C 2GZJA 1QVFO 1KQSO 1N8RQ 4U0EA 2JBGA 4GR6A 1VHNA 2JYLA 2L22A 3CMAP 2Z44A 4F37A 3Q20A 3DS2A 2NO8A 2GZEA 1Z6MA 4PWVB 1NJIQ 1RO0A 2GZGA 2JU2A 2LIWA 4R0MA 3CC7P 1W2BO 4XFZA 1M74A 4PXHB 3CMEP 4IPYA 2PEOA 3EJDA 3CCJP 2MVUA 1NQ4A 2N6ZA 2MR7A 4U0CA 2M8PA 3GZMA 2MVVA 2FQ2A 2XZ0D 2XXMA 3GKLC 1HQBA 2GDXA 2KOOA 2BUOA 3VRLC 2N50A 3DS3A 3OW2O 5BS1A 5F2KA 2JQ4A 4U0AA 3CE7A 2FHSC 2K92A 3LMOA 1VQ5P 1A8OA 1M6EX 3CCRP 2E1MA 1QRJA 2EHTA 4H2XC 2KR5A 2FACA 1Q82Q 2DNWA 1Q86Q 3G29A 2ONTA 1E6JP 3G21A 4GR2A 1JJ2O 3DS0A 4XRQA 1A43A 1VQ8P 3DTJA 3HZQA 3G0VA 1VQ4P 1AYIA 2MY5A 1DNYA 4XFYA 1EIAA 4UHPB 5HVCA 3CD6P 3B4QA 1RO2A 2L6EA 2PNGA 3B5IA 1M90Q 1UNKA 2N5HA 3GJNA 1BXIA 1KC8Q 1ACPA 2AFEA 4BPFA 4DG9A 2K2QA 3H4EA 1VKUA 2XZ1C 2FADA 5I4TG 1Q81Q 3G71P 4XFXA 2FQ1A 5HV8A 4IZ6A 5KP8B 1EOQA 3CXCO 2QNWA 1YJWP 3P05A 4U0BA 3DS4A 2JO0A 2K5XA 2Z46A 3CPWO 1K73Q 2L9FA 2QA4P 2PEIA 1UJZA 3CCQP 3G26A 3CCLP 4MRTC 1D1DA 3CCUP 2PEQA 5F2NA 2OTLP 3I56P 2CGQA 2FQ0A 3G1IA 1GXHA 2M8LA 1X3OA 2JU1A 4WYMA 5JPAA 2LPKA 2WPTA 1MZ8A 2PY8A 1K30A 1HY8A 2X2BA 2Z45A 2KGCA 2VLQA 1ZMBA 3NY7B 1K8AQ 5BS2A 4PH1A 1IMPA 2EFJA 2VSQA 2EIAA 2XT1A 3E2DA 2KORA 2PEMA 2KODA 2GYKA 2LTEA 3WBHA 4QNBA 1EMVA 1VQKP 3CCEP 2K93A 1GPJA 2MR8A 2N5IA 1KD1Q 2OARA 2PEKA 2JB0A 2JGPA 1YITP 4BPGA 3RG2A 2KOPA 4NEOA 3CCSP 3CC2P 2LMLA 7CEIA 1L0IA 5CZDB 1IUQA 2L0QA 5HGOA 3NTEA 3EJBA 1QVGO 2FAEA
chains in the Genus database with same CATH topology
2K2QA 1L0HA 2MVUA 1VKUA 2KGAA 1NQ4A 2N6ZA 2XZ1C 2KW2A 4H2YC 2FADA 2N98A 1F80D 2MR7A 2KGEA 2CQ8A 3GZMA 2MVVA 2LL8A 2FQ1A 2FQ2A 2KWLA 4IZ6A 5HV8A 5KP8B 1T8KA 2XZ0D 2KG6A 5KP6B 2K94A 2QNWA 5EJDA 1HQBA 2GDXA 2KG9A 2KOOA 2GDWA 2MD9A 2AF8A 2N6YA 4BPHA 2FVAA 2N50A 2L9FA 4DG9A 4CA3A 2JQ4A 4H2WC 2GDYA 4MRTC 2LIUA 3CE7A 2FHSC 2K92A 2CGQA 2LOLA 2CG5B 2FQ0A 3LMOA 2M5RA 3EJEA 2LKIA 2K0XA 1X3OA 2FVEA 2JU1A 2ROQA 2EHTA 4H2XC 2KR5A 2FACA 1AF8A 2DNWA 2LPKA 2KOQA 1HY8A 2X2BA 1OR5A 2KGCA 2AFDA 2L22A 3NY7B 2KOSA 1KLPA 2VSQA 4PWVB 2KORA 2AVAA 2EHSA 2MY5A 5KP7B 1DNYA 2FVFA 2LTEA 2MF4A 2KG8A 2L4BA 3GZLA 5HVCA 4HKGA 2K93A 2MR8A 2PNGA 2JU2A 2N5IA 2JGPA 2LIWA 4R0MA 1DV5A 4BPGA 2CNRA 2N5HA 3RG2A 2K0YA 2KOPA 2KGDA 4NEOA 2LMLA 1ACPA 2AFEA 4PXHB 1L0IA 5CZDB 2L0QA 4BPFA 3EJBA 3EJDA 2FAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2Q A;  1L0H A;  2MVU A;  1VKU A;  2KGA A;  1NQ4 A;  2N6Z A;  2XZ1 C;  2KW2 A;  4H2Y C;  2FAD A;  2N98 A;  1F80 D;  2MR7 A;  2KGE A;  2CQ8 A;  3GZM A;  2MVV A;  2LL8 A;  2FQ1 A;  2FQ2 A;  2KWL A;  4IZ6 A;  5HV8 A;  5KP8 B;  1T8K A;  2XZ0 D;  2KG6 A;  5KP6 B;  2K94 A;  2QNW A;  5EJD A;  1HQB A;  2GDX A;  2KG9 A;  2KOO A;  2GDW A;  2MD9 A;  2AF8 A;  2N6Y A;  4BPH A;  2FVA A;  2N50 A;  2L9F A;  4DG9 A;  4CA3 A;  2JQ4 A;  4H2W C;  2GDY A;  4MRT C;  2LIU A;  3CE7 A;  2FHS C;  2K92 A;  2CGQ A;  2LOL A;  2CG5 B;  2FQ0 A;  3LMO A;  2M5R A;  3EJE A;  2LKI A;  2K0X A;  1X3O A;  2FVE A;  2JU1 A;  2ROQ A;  2EHT A;  4H2X C;  2KR5 A;  2FAC A;  1AF8 A;  2DNW A;  2LPK A;  2KOQ A;  1HY8 A;  2X2B A;  1OR5 A;  2KGC A;  2AFD A;  2L22 A;  3NY7 B;  2KOS A;  1KLP A;  2VSQ A;  4PWV B;  2KOR A;  2AVA A;  2EHS A;  2MY5 A;  5KP7 B;  1DNY A;  2FVF A;  2LTE A;  2MF4 A;  2KG8 A;  2L4B A;  3GZL A;  5HVC A;  4HKG A;  2K93 A;  2MR8 A;  2PNG A;  2JU2 A;  2N5I A;  2JGP A;  2LIW A;  4R0M A;  1DV5 A;  4BPG A;  2CNR A;  2N5H A;  3RG2 A;  2K0Y A;  2KOP A;  2KGD A;  4NEO A;  2LML A;  1ACP A;  2AFE A;  4PXH B;  1L0I A;  5CZD B;  2L0Q A;  4BPF A;  3EJB A;  3EJD A;  2FAE A; 
#chains in the Genus database with same CATH topology
 2CWO A;  1YJ9 P;  4H2Y C;  2N98 A;  3CCV P;  1F80 D;  2KGE A;  1IMQ A;  1VQ7 P;  2JYG A;  1AUM A;  1T8K A;  2VLP A;  2KG6 A;  1ZNV A;  2K94 A;  5KP6 B;  5EJD A;  2KG9 A;  3DS1 A;  4COP A;  1YHQ P;  2GZI A;  1YJN P;  4BPH A;  1M6N A;  1Q7Y Q;  1E0H A;  2DGY A;  2XV6 A;  3DPH A;  2VLO A;  1YI2 P;  4H2W C;  2GDY A;  4XRO A;  4M0I A;  2M8N A;  1VQL P;  2LOL A;  3CCM P;  1BAJ A;  1VQM P;  2FVE A;  5HGL A;  3MGE A;  2ROQ A;  2PEN A;  1AF8 A;  2P9X A;  1M1K Q;  2KOQ A;  4COC A;  2ERH A;  4U0F A;  1OR5 A;  2PEJ A;  3M1M A;  4QKO A;  2AFD A;  2KOS A;  1KLP A;  1YIJ P;  2GZF A;  1K9M Q;  1VQN P;  1FR2 A;  2AVA A;  3H47 A;  2EHS A;  5KP7 B;  2FVF A;  3G1G A;  2MF4 A;  2KG8 A;  2L4B A;  1VQ9 P;  3GZL A;  3G6E P;  4HKG A;  3G4S P;  3U43 A;  3HYB A;  1RNI A;  1DV5 A;  2CNR A;  3LRY A;  2K0Y A;  1VQ6 P;  2KGD A;  4U0D A;  3H0D A;  2JAZ A;  1L0H A;  2KGA A;  2OTJ P;  2KW2 A;  3DS5 A;  5HGN A;  2CQ8 A;  2LL8 A;  2VLN A;  2KWL A;  5HGM A;  5DCK A;  2LF4 A;  3G28 A;  2GDW A;  2MD9 A;  3CC4 P;  2AF8 A;  2N6Y A;  2EG5 A;  2FVA A;  3I55 P;  1S72 P;  5F2O A;  4CA3 A;  1CEI A;  2BHV A;  4PH0 A;  2LIU A;  2CG5 B;  2M5R A;  1GXG A;  3EJE A;  2LKI A;  1VQP P;  2K0X A;  5EW5 E;  2K0D X;  1VQO P;  2QEX P;  3RG6 C;  2GZJ A;  1QVF O;  1KQS O;  1N8R Q;  4U0E A;  2JBG A;  4GR6 A;  1VHN A;  2JYL A;  2L22 A;  3CMA P;  2Z44 A;  4F37 A;  3Q20 A;  3DS2 A;  2NO8 A;  2GZE A;  1Z6M A;  4PWV B;  1NJI Q;  1RO0 A;  2GZG A;  2JU2 A;  2LIW A;  4R0M A;  3CC7 P;  1W2B O;  4XFZ A;  1M74 A;  4PXH B;  3CME P;  4IPY A;  2PEO A;  3EJD A;  3CCJ P;  2MVU A;  1NQ4 A;  2N6Z A;  2MR7 A;  4U0C A;  2M8P A;  3GZM A;  2MVV A;  2FQ2 A;  2XZ0 D;  2XXM A;  3GKL C;  1HQB A;  2GDX A;  2KOO A;  2BUO A;  3VRL C;  2N50 A;  3DS3 A;  3OW2 O;  5BS1 A;  5F2K A;  2JQ4 A;  4U0A A;  3CE7 A;  2FHS C;  2K92 A;  3LMO A;  1VQ5 P;  1A8O A;  1M6E X;  3CCR P;  2E1M A;  1QRJ A;  2EHT A;  4H2X C;  2KR5 A;  2FAC A;  1Q82 Q;  2DNW A;  1Q86 Q;  3G29 A;  2ONT A;  1E6J P;  3G21 A;  4GR2 A;  1JJ2 O;  3DS0 A;  4XRQ A;  1A43 A;  1VQ8 P;  3DTJ A;  3HZQ A;  3G0V A;  1VQ4 P;  1AYI A;  2MY5 A;  1DNY A;  4XFY A;  1EIA A;  4UHP B;  5HVC A;  3CD6 P;  3B4Q A;  1RO2 A;  2L6E A;  2PNG A;  3B5I A;  1M90 Q;  1UNK A;  2N5H A;  3GJN A;  1BXI A;  1KC8 Q;  1ACP A;  2AFE A;  4BPF A;  4DG9 A;  2K2Q A;  3H4E A;  1VKU A;  2XZ1 C;  2FAD A;  5I4T G;  1Q81 Q;  3G71 P;  4XFX A;  2FQ1 A;  5HV8 A;  4IZ6 A;  5KP8 B;  1EOQ A;  3CXC O;  2QNW A;  1YJW P;  3P05 A;  4U0B A;  3DS4 A;  2JO0 A;  2K5X A;  2Z46 A;  3CPW O;  1K73 Q;  2L9F A;  2QA4 P;  2PEI A;  1UJZ A;  3CCQ P;  3G26 A;  3CCL P;  4MRT C;  1D1D A;  3CCU P;  2PEQ A;  5F2N A;  2OTL P;  3I56 P;  2CGQ A;  2FQ0 A;  3G1I A;  1GXH A;  2M8L A;  1X3O A;  2JU1 A;  4WYM A;  5JPA A;  2LPK A;  2WPT A;  1MZ8 A;  2PY8 A;  1K30 A;  1HY8 A;  2X2B A;  2Z45 A;  2KGC A;  2VLQ A;  1ZMB A;  3NY7 B;  1K8A Q;  5BS2 A;  4PH1 A;  1IMP A;  2EFJ A;  2VSQ A;  2EIA A;  2XT1 A;  3E2D A;  2KOR A;  2PEM A;  2KOD A;  2GYK A;  2LTE A;  3WBH A;  4QNB A;  1EMV A;  1VQK P;  3CCE P;  2K93 A;  1GPJ A;  2MR8 A;  2N5I A;  1KD1 Q;  2OAR A;  2PEK A;  2JB0 A;  2JGP A;  1YIT P;  4BPG A;  3RG2 A;  2KOP A;  4NEO A;  3CCS P;  3CC2 P;  2LML A;  7CEI A;  1L0I A;  5CZD B;  1IUQ A;  2L0Q A;  5HGO A;  3NTE A;  3EJB A;  1QVG O;  2FAE A; 
#chains in the Genus database with same CATH homology
 2K2Q A;  1L0H A;  2MVU A;  1VKU A;  2KGA A;  1NQ4 A;  2N6Z A;  2XZ1 C;  2KW2 A;  4H2Y C;  2FAD A;  2N98 A;  1F80 D;  2MR7 A;  2KGE A;  2CQ8 A;  3GZM A;  2MVV A;  2LL8 A;  2FQ1 A;  2FQ2 A;  2KWL A;  4IZ6 A;  5HV8 A;  5KP8 B;  1T8K A;  2XZ0 D;  2KG6 A;  5KP6 B;  2K94 A;  2QNW A;  5EJD A;  1HQB A;  2GDX A;  2KG9 A;  2KOO A;  2GDW A;  2MD9 A;  2AF8 A;  2N6Y A;  4BPH A;  2FVA A;  2N50 A;  2L9F A;  4DG9 A;  4CA3 A;  2JQ4 A;  4H2W C;  2GDY A;  4MRT C;  2LIU A;  3CE7 A;  2FHS C;  2K92 A;  2CGQ A;  2LOL A;  2CG5 B;  2FQ0 A;  3LMO A;  2M5R A;  3EJE A;  2LKI A;  2K0X A;  1X3O A;  2FVE A;  2JU1 A;  2ROQ A;  2EHT A;  4H2X C;  2KR5 A;  2FAC A;  1AF8 A;  2DNW A;  2LPK A;  2KOQ A;  1HY8 A;  2X2B A;  1OR5 A;  2KGC A;  2AFD A;  2L22 A;  3NY7 B;  2KOS A;  1KLP A;  2VSQ A;  4PWV B;  2KOR A;  2AVA A;  2EHS A;  2MY5 A;  5KP7 B;  1DNY A;  2FVF A;  2LTE A;  2MF4 A;  2KG8 A;  2L4B A;  3GZL A;  5HVC A;  4HKG A;  2K93 A;  2MR8 A;  2PNG A;  2JU2 A;  2N5I A;  2JGP A;  2LIW A;  4R0M A;  1DV5 A;  4BPG A;  2CNR A;  2N5H A;  3RG2 A;  2K0Y A;  2KOP A;  2KGD A;  4NEO A;  2LML A;  1ACP A;  2AFE A;  4PXH B;  1L0I A;  5CZD B;  2L0Q A;  4BPF A;  3EJB A;  3EJD A;  2FAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...