2GDXA

Solution structure of the b. brevis tycc3-pcp in h-state
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
MGVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrocidine synthetase III
publication title Conformational switches modulate protein interactions in peptide antibiotic synthetases
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase/transport protein
total genus 15
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2gdxA00
2LIUA 2AVAA 2AFDA 2N5IA 2K0XA 2KG8A 2L4BA 2XZ0D 2X2BA 3EJEA 4PXHB 5CZDB 2L22A 3GZLA 2JGPA 2DNWA 1KLPA 2KOSA 2FHSC 2KOQA 1AF8A 1VKUA 2K0YA 2LL8A 2KGCA 2GDXA 2LPKA 2N6ZA 2K93A 2KG9A 1HY8A 2EHTA 5EJDA 2PNGA 2VSQA 2LTEA 2ROQA 2KR5A 2N5HA 2N98A 4R0MA 2M5RA 1OR5A 3GZMA 4MRTC 3EJBA 2K2QA 1X3OA 2MR7A 2L0QA 4PWVB 1DV5A 2N50A 1L0IA 2FVAA 2LMLA 1T8KA 2L9FA 4IZ6A 2FAEA 2FQ2A 3CE7A 2LIWA 2KOPA 2LKIA 2FQ0A 3NY7B 5KP7B 1DNYA 5KP8B 2KW2A 2KG6A 2CNRA 2FADA 2KGDA 1F80D 2AFEA 3LMOA 2MVVA 2JU2A 2FACA 4CA3A 2KOOA 2AF8A 2K92A 4H2WC 2MVUA 3RG2A 4HKGA 1L0HA 2XZ1C 1ACPA 2KGEA 5KP6B 4H2YC 2FQ1A 2CGQA 2JQ4A 2KWLA 2MF4A 2K94A 4H2XC 2JU1A 4DG9A 5HV8A 2GDYA 2FVEA 3EJDA 2KGAA 4BPFA 1NQ4A 2MD9A 2CG5B 2MR8A 2FVFA 5HVCA 4BPGA 2QNWA 2KORA 4NEOA 2N6YA 2EHSA 2GDWA 2LOLA 4BPHA 1HQBA 2CQ8A 2MY5A
chains in the Genus database with same CATH superfamily
1YITP 2N5IA 2L4BA 4PXHB 3EJEA 5CZDB 4IPYA 1KLPA 1KD1Q 1AF8A 3G0VA 7CEIA 4UHPB 2LPKA 2OTLP 2N6ZA 2K93A 5JPAA 1D1DA 2GZJA 3CPWO 3DS3A 4GR2A 2ROQA 1AYIA 2KR5A 4R0MA 4U0DA 3EJBA 2K2QA 2L0QA 4PWVB 1DV5A 1L0IA 2LMLA 1T8KA 2BHVA 2L9FA 3CCMP 1QVGO 1KQSO 3DPHA 3CMEP 1GPJA 3NTEA 2FQ0A 3NY7B 1DNYA 2AFEA 1VQ8P 2MVVA 1VQMP 1VQNP 1M6NA 2FACA 5DCKA 3VRLC 2M8NA 4H2WC 2MVUA 1VQ5P 1AUMA 4H2YC 1IUQA 2JQ4A 4U0FA 2E1MA 2K94A 3G21A 2ONTA 2EG5A 1EOQA 2XV6A 3B5IA 1YHQP 1RO2A 2FVEA 1EMVA 4XRQA 4BPFA 3CCLP 2MD9A 2MR8A 2N6YA 1M90Q 3DS1A 2EHSA 1UNKA 2CQ8A 2AVAA 1BXIA 1K73Q 2GZEA 2X2BA 1RNIA 3GZLA 2Z44A 1FR2A 1VQ7P 3CCUP 2GZGA 3H0DA 3I56P 2LL8A 2L6EA 2GDXA 3DTJA 1HY8A 2EHTA 5EJDA 2EFJA 2K5XA 2PNGA 2LTEA 2N5HA 2N98A 1YIJP 1OR5A 4MRTC 1Z6MA 1YI2P 1S72P 2PEIA 2CWOA 2JO0A 2FVAA 3H4EA 2LKIA 3H47A 3E2DA 1QRJA 2WPTA 5KP8B 5F2KA 2FADA 1F80D 1RO0A 2GZFA 2QA4P 3P05A 3CD6P 4M0IA 2K92A 3LRYA 3G26A 2VLNA 2EIAA 1GXGA 3MGEA 1VQPP 4QKOA 3G29A 3DS0A 2GZIA 2PEKA 1VHNA 5HV8A 4GR6A 2OARA 1KC8Q 2JB0A 5EW5E 3G1GA 1M6EX 2KGAA 1Q81Q 3WBHA 2FVFA 2QNWA 4COCA 2KORA 4WYMA 1K8AQ 2Z45A 1Q86Q 1M74A 5HGMA 2LIUA 1BAJA 2AFDA 2KG8A 2XZ0D 5HGOA 2L22A 2JGPA 2DNWA 5BS1A 2KOSA 1Q82Q 4XFXA 1K9MQ 2K0YA 3U43A 1Q7YQ 1W2BO 3Q20A 5HGLA 1YJNP 2VLQA 2VSQA 2VLPA 1X3OA 2MR7A 2N50A 2XT1A 2GYKA 2P9XA 4IZ6A 2FAEA 3CE7A 2LIWA 3HYBA 2JYLA 3DS4A 2KOPA 5KP7B 3GKLC 2KW2A 2CNRA 3CCJP 2KGDA 3LMOA 3CC4P 2DGYA 2OTJP 1VQKP 3G4SP 2KOOA 1ZNVA 3CC2P 2JYGA 2M8PA 4PH0A 3RG2A 4HKGA 1VQ9P 1L0HA 2XZ1C 2KGEA 2CGQA 2K0DX 2BUOA 3CXCO 4COPA 1VQLP 4H2XC 1VQOP 2JU1A 1NJIQ 2PEJA 2PENA 4U0AA 3DS5A 1CEIA 4BPGA 3G6EP 2GDWA 2LOLA 4BPHA 5I4TG 3CMAP 2K0XA 5HGNA 1YJ9P 3B4QA 4U0EA 1VQ6P 1UJZA 3M1MA 1IMPA 2FHSC 2KOQA 1A8OA 2KODA 2PEQA 2JBGA 1VKUA 2KGCA 1M1KQ 2KG9A 2NO8A 4PH1A 2PEMA 2ERHA 2M5RA 3GZMA 1ZMBA 3G71P 1YJWP 1VQ4P 2XXMA 2LF4A 2FQ2A 3CCRP 4U0BA 2PEOA 3CC7P 1N8RQ 1MZ8A 4U0CA 2KG6A 3OW2O 5F2NA 1GXHA 3G1IA 4XFYA 2JU2A 5F2OA 1QVFO 1IMQA 4QNBA 1K30A 4CA3A 1E0HA 1EIAA 2AF8A 3G28A 3CCEP 3CCSP 4XFZA 1ACPA 4XROA 3RG6C 5KP6B 2QEXP 1E6JP 2FQ1A 3DS2A 3I55P 2KWLA 2MF4A 1A43A 2JAZA 5BS2A 4DG9A 3GJNA 2M8LA 2Z46A 2GDYA 3EJDA 4F37A 2VLOA 1JJ2O 1NQ4A 2CG5B 3HZQA 5HVCA 2PY8A 3CCQP 4NEOA 1HQBA 2MY5A 3CCVP
chains in the Genus database with same CATH topology
2LIUA 2AVAA 2AFDA 2N5IA 2K0XA 2KG8A 2L4BA 2XZ0D 2X2BA 3EJEA 4PXHB 5CZDB 2L22A 3GZLA 2JGPA 2DNWA 1KLPA 2KOSA 2FHSC 2KOQA 1AF8A 1VKUA 2K0YA 2LL8A 2KGCA 2GDXA 2LPKA 2N6ZA 2K93A 2KG9A 1HY8A 2EHTA 5EJDA 2PNGA 2VSQA 2LTEA 2ROQA 2KR5A 2N5HA 2N98A 4R0MA 2M5RA 1OR5A 3GZMA 4MRTC 3EJBA 2K2QA 1X3OA 2MR7A 2L0QA 4PWVB 1DV5A 2N50A 1L0IA 2FVAA 2LMLA 1T8KA 2L9FA 4IZ6A 2FAEA 2FQ2A 3CE7A 2LIWA 2KOPA 2LKIA 2FQ0A 3NY7B 5KP7B 1DNYA 5KP8B 2KW2A 2KG6A 2CNRA 2FADA 2KGDA 1F80D 2AFEA 3LMOA 2MVVA 2JU2A 2FACA 4CA3A 2KOOA 2AF8A 2K92A 4H2WC 2MVUA 3RG2A 4HKGA 1L0HA 2XZ1C 1ACPA 2KGEA 5KP6B 4H2YC 2FQ1A 2CGQA 2JQ4A 2KWLA 2MF4A 2K94A 4H2XC 2JU1A 4DG9A 5HV8A 2GDYA 2FVEA 3EJDA 2KGAA 4BPFA 1NQ4A 2MD9A 2CG5B 2MR8A 2FVFA 5HVCA 4BPGA 2QNWA 2KORA 4NEOA 2N6YA 2EHSA 2GDWA 2LOLA 4BPHA 1HQBA 2CQ8A 2MY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LIU A;  2AVA A;  2AFD A;  2N5I A;  2K0X A;  2KG8 A;  2L4B A;  2XZ0 D;  2X2B A;  3EJE A;  4PXH B;  5CZD B;  2L22 A;  3GZL A;  2JGP A;  2DNW A;  1KLP A;  2KOS A;  2FHS C;  2KOQ A;  1AF8 A;  1VKU A;  2K0Y A;  2LL8 A;  2KGC A;  2GDX A;  2LPK A;  2N6Z A;  2K93 A;  2KG9 A;  1HY8 A;  2EHT A;  5EJD A;  2PNG A;  2VSQ A;  2LTE A;  2ROQ A;  2KR5 A;  2N5H A;  2N98 A;  4R0M A;  2M5R A;  1OR5 A;  3GZM A;  4MRT C;  3EJB A;  2K2Q A;  1X3O A;  2MR7 A;  2L0Q A;  4PWV B;  1DV5 A;  2N50 A;  1L0I A;  2FVA A;  2LML A;  1T8K A;  2L9F A;  4IZ6 A;  2FAE A;  2FQ2 A;  3CE7 A;  2LIW A;  2KOP A;  2LKI A;  2FQ0 A;  3NY7 B;  5KP7 B;  1DNY A;  5KP8 B;  2KW2 A;  2KG6 A;  2CNR A;  2FAD A;  2KGD A;  1F80 D;  2AFE A;  3LMO A;  2MVV A;  2JU2 A;  2FAC A;  4CA3 A;  2KOO A;  2AF8 A;  2K92 A;  4H2W C;  2MVU A;  3RG2 A;  4HKG A;  1L0H A;  2XZ1 C;  1ACP A;  2KGE A;  5KP6 B;  4H2Y C;  2FQ1 A;  2CGQ A;  2JQ4 A;  2KWL A;  2MF4 A;  2K94 A;  4H2X C;  2JU1 A;  4DG9 A;  5HV8 A;  2GDY A;  2FVE A;  3EJD A;  2KGA A;  4BPF A;  1NQ4 A;  2MD9 A;  2CG5 B;  2MR8 A;  2FVF A;  5HVC A;  4BPG A;  2QNW A;  2KOR A;  4NEO A;  2N6Y A;  2EHS A;  2GDW A;  2LOL A;  4BPH A;  1HQB A;  2CQ8 A;  2MY5 A; 
#chains in the Genus database with same CATH topology
 1YIT P;  2N5I A;  2L4B A;  4PXH B;  3EJE A;  5CZD B;  4IPY A;  1KLP A;  1KD1 Q;  1AF8 A;  3G0V A;  7CEI A;  4UHP B;  2LPK A;  2OTL P;  2N6Z A;  2K93 A;  5JPA A;  1D1D A;  2GZJ A;  3CPW O;  3DS3 A;  4GR2 A;  2ROQ A;  1AYI A;  2KR5 A;  4R0M A;  4U0D A;  3EJB A;  2K2Q A;  2L0Q A;  4PWV B;  1DV5 A;  1L0I A;  2LML A;  1T8K A;  2BHV A;  2L9F A;  3CCM P;  1QVG O;  1KQS O;  3DPH A;  3CME P;  1GPJ A;  3NTE A;  2FQ0 A;  3NY7 B;  1DNY A;  2AFE A;  1VQ8 P;  2MVV A;  1VQM P;  1VQN P;  1M6N A;  2FAC A;  5DCK A;  3VRL C;  2M8N A;  4H2W C;  2MVU A;  1VQ5 P;  1AUM A;  4H2Y C;  1IUQ A;  2JQ4 A;  4U0F A;  2E1M A;  2K94 A;  3G21 A;  2ONT A;  2EG5 A;  1EOQ A;  2XV6 A;  3B5I A;  1YHQ P;  1RO2 A;  2FVE A;  1EMV A;  4XRQ A;  4BPF A;  3CCL P;  2MD9 A;  2MR8 A;  2N6Y A;  1M90 Q;  3DS1 A;  2EHS A;  1UNK A;  2CQ8 A;  2AVA A;  1BXI A;  1K73 Q;  2GZE A;  2X2B A;  1RNI A;  3GZL A;  2Z44 A;  1FR2 A;  1VQ7 P;  3CCU P;  2GZG A;  3H0D A;  3I56 P;  2LL8 A;  2L6E A;  2GDX A;  3DTJ A;  1HY8 A;  2EHT A;  5EJD A;  2EFJ A;  2K5X A;  2PNG A;  2LTE A;  2N5H A;  2N98 A;  1YIJ P;  1OR5 A;  4MRT C;  1Z6M A;  1YI2 P;  1S72 P;  2PEI A;  2CWO A;  2JO0 A;  2FVA A;  3H4E A;  2LKI A;  3H47 A;  3E2D A;  1QRJ A;  2WPT A;  5KP8 B;  5F2K A;  2FAD A;  1F80 D;  1RO0 A;  2GZF A;  2QA4 P;  3P05 A;  3CD6 P;  4M0I A;  2K92 A;  3LRY A;  3G26 A;  2VLN A;  2EIA A;  1GXG A;  3MGE A;  1VQP P;  4QKO A;  3G29 A;  3DS0 A;  2GZI A;  2PEK A;  1VHN A;  5HV8 A;  4GR6 A;  2OAR A;  1KC8 Q;  2JB0 A;  5EW5 E;  3G1G A;  1M6E X;  2KGA A;  1Q81 Q;  3WBH A;  2FVF A;  2QNW A;  4COC A;  2KOR A;  4WYM A;  1K8A Q;  2Z45 A;  1Q86 Q;  1M74 A;  5HGM A;  2LIU A;  1BAJ A;  2AFD A;  2KG8 A;  2XZ0 D;  5HGO A;  2L22 A;  2JGP A;  2DNW A;  5BS1 A;  2KOS A;  1Q82 Q;  4XFX A;  1K9M Q;  2K0Y A;  3U43 A;  1Q7Y Q;  1W2B O;  3Q20 A;  5HGL A;  1YJN P;  2VLQ A;  2VSQ A;  2VLP A;  1X3O A;  2MR7 A;  2N50 A;  2XT1 A;  2GYK A;  2P9X A;  4IZ6 A;  2FAE A;  3CE7 A;  2LIW A;  3HYB A;  2JYL A;  3DS4 A;  2KOP A;  5KP7 B;  3GKL C;  2KW2 A;  2CNR A;  3CCJ P;  2KGD A;  3LMO A;  3CC4 P;  2DGY A;  2OTJ P;  1VQK P;  3G4S P;  2KOO A;  1ZNV A;  3CC2 P;  2JYG A;  2M8P A;  4PH0 A;  3RG2 A;  4HKG A;  1VQ9 P;  1L0H A;  2XZ1 C;  2KGE A;  2CGQ A;  2K0D X;  2BUO A;  3CXC O;  4COP A;  1VQL P;  4H2X C;  1VQO P;  2JU1 A;  1NJI Q;  2PEJ A;  2PEN A;  4U0A A;  3DS5 A;  1CEI A;  4BPG A;  3G6E P;  2GDW A;  2LOL A;  4BPH A;  5I4T G;  3CMA P;  2K0X A;  5HGN A;  1YJ9 P;  3B4Q A;  4U0E A;  1VQ6 P;  1UJZ A;  3M1M A;  1IMP A;  2FHS C;  2KOQ A;  1A8O A;  2KOD A;  2PEQ A;  2JBG A;  1VKU A;  2KGC A;  1M1K Q;  2KG9 A;  2NO8 A;  4PH1 A;  2PEM A;  2ERH A;  2M5R A;  3GZM A;  1ZMB A;  3G71 P;  1YJW P;  1VQ4 P;  2XXM A;  2LF4 A;  2FQ2 A;  3CCR P;  4U0B A;  2PEO A;  3CC7 P;  1N8R Q;  1MZ8 A;  4U0C A;  2KG6 A;  3OW2 O;  5F2N A;  1GXH A;  3G1I A;  4XFY A;  2JU2 A;  5F2O A;  1QVF O;  1IMQ A;  4QNB A;  1K30 A;  4CA3 A;  1E0H A;  1EIA A;  2AF8 A;  3G28 A;  3CCE P;  3CCS P;  4XFZ A;  1ACP A;  4XRO A;  3RG6 C;  5KP6 B;  2QEX P;  1E6J P;  2FQ1 A;  3DS2 A;  3I55 P;  2KWL A;  2MF4 A;  1A43 A;  2JAZ A;  5BS2 A;  4DG9 A;  3GJN A;  2M8L A;  2Z46 A;  2GDY A;  3EJD A;  4F37 A;  2VLO A;  1JJ2 O;  1NQ4 A;  2CG5 B;  3HZQ A;  5HVC A;  2PY8 A;  3CCQ P;  4NEO A;  1HQB A;  2MY5 A;  3CCV P; 
#chains in the Genus database with same CATH homology
 2LIU A;  2AVA A;  2AFD A;  2N5I A;  2K0X A;  2KG8 A;  2L4B A;  2XZ0 D;  2X2B A;  3EJE A;  4PXH B;  5CZD B;  2L22 A;  3GZL A;  2JGP A;  2DNW A;  1KLP A;  2KOS A;  2FHS C;  2KOQ A;  1AF8 A;  1VKU A;  2K0Y A;  2LL8 A;  2KGC A;  2GDX A;  2LPK A;  2N6Z A;  2K93 A;  2KG9 A;  1HY8 A;  2EHT A;  5EJD A;  2PNG A;  2VSQ A;  2LTE A;  2ROQ A;  2KR5 A;  2N5H A;  2N98 A;  4R0M A;  2M5R A;  1OR5 A;  3GZM A;  4MRT C;  3EJB A;  2K2Q A;  1X3O A;  2MR7 A;  2L0Q A;  4PWV B;  1DV5 A;  2N50 A;  1L0I A;  2FVA A;  2LML A;  1T8K A;  2L9F A;  4IZ6 A;  2FAE A;  2FQ2 A;  3CE7 A;  2LIW A;  2KOP A;  2LKI A;  2FQ0 A;  3NY7 B;  5KP7 B;  1DNY A;  5KP8 B;  2KW2 A;  2KG6 A;  2CNR A;  2FAD A;  2KGD A;  1F80 D;  2AFE A;  3LMO A;  2MVV A;  2JU2 A;  2FAC A;  4CA3 A;  2KOO A;  2AF8 A;  2K92 A;  4H2W C;  2MVU A;  3RG2 A;  4HKG A;  1L0H A;  2XZ1 C;  1ACP A;  2KGE A;  5KP6 B;  4H2Y C;  2FQ1 A;  2CGQ A;  2JQ4 A;  2KWL A;  2MF4 A;  2K94 A;  4H2X C;  2JU1 A;  4DG9 A;  5HV8 A;  2GDY A;  2FVE A;  3EJD A;  2KGA A;  4BPF A;  1NQ4 A;  2MD9 A;  2CG5 B;  2MR8 A;  2FVF A;  5HVC A;  4BPG A;  2QNW A;  2KOR A;  4NEO A;  2N6Y A;  2EHS A;  2GDW A;  2LOL A;  4BPH A;  1HQB A;  2CQ8 A;  2MY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...