2AFDA

Solution structure of asl1650, an acyl carrier protein from anabaena sp. pcc 7120 with a variant phosphopantetheinylation-site sequence
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
88
structure length
88
Chain Sequence
GSHMKTIQPASVEDIQSWLIDQFAQQLDVDPDDIDMEESFDNYDLNSSKALILLGRLEKWLGKELNPVLIFNYPTIAQLAKRLGELYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein
molecule keywords protein Asl1650
publication title Solution structure of Asl1650, an acyl carrier protein from Anabaena sp. PCC 7120 with a variant phosphopantetheinylation-site sequence
pubmed doi rcsb
source organism Nostoc sp.
total genus 23
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2afdA00
2K2QA 2K93A 3RG2A 2K92A 1L0IA 1KLPA 1AF8A 1L0HA 4HKGA 2KGDA 2LIUA 2L0QA 2FADA 5KP8B 2EHTA 4CA3A 2QNWA 4PXHB 2JU1A 1DNYA 2AF8A 5KP6B 2FQ2A 4PWVB 2KOOA 2CG5B 2X2BA 4BPGA 4H2YC 2FAEA 2L9FA 1OR5A 4H2WC 2KW2A 2LKIA 4BPFA 2K94A 5EJDA 2M5RA 3EJBA 2LL8A 1F80D 3EJEA 3NY7B 1T8KA 1NQ4A 3GZLA 2PNGA 1HY8A 2FVEA 2MVVA 1ACPA 2FACA 2MVUA 2FVAA 2L4BA 2FQ1A 2KGCA 5KP7B 2LMLA 2KGEA 2LTEA 4DG9A 2GDYA 2KOPA 2JQ4A 2MD9A 2CNRA 2N6YA 4H2XC 2KOSA 2EHSA 2GDXA 3LMOA 4IZ6A 1DV5A 2AFDA 2LPKA 1VKUA 2KGAA 2XZ0D 4BPHA 2CGQA 2CQ8A 2FHSC 2N6ZA 2KWLA 2KR5A 3EJDA 2LIWA 2N5HA 2ROQA 2FVFA 2VSQA 2MR7A 2XZ1C 4NEOA 1HQBA 2KG8A 5HVCA 2MF4A 2FQ0A 2AVAA 5HV8A 2MR8A 1X3OA 2KG6A 2KG9A 2JGPA 2KOQA 2K0YA 2GDWA 2KORA 2MY5A 2N98A 3CE7A 4R0MA 5CZDB 2N50A 2AFEA 2DNWA 4MRTC 2N5IA 3GZMA 2JU2A 2K0XA 2LOLA 2L22A
chains in the Genus database with same CATH superfamily
3CCLP 2K92A 1Z6MA 5HGLA 3I56P 2KGDA 3H0DA 2L0QA 2FADA 2EHTA 3CCEP 1DNYA 1K8AQ 5KP6B 1QVGO 2GZFA 2KOOA 2CG5B 1JJ2O 1YJWP 2Z45A 4BPGA 1KD1Q 2VLNA 1OR5A 2GZEA 1EIAA 4H2WC 2KW2A 2JYGA 1QVFO 2K94A 5EJDA 2M5RA 3DS5A 1M1KQ 1BAJA 1EMVA 1VQ6P 1Q82Q 4U0AA 3G29A 1S72P 3GZLA 2LF4A 2MVUA 1YITP 1NJIQ 2FQ1A 2KGCA 5KP7B 1N8RQ 2LMLA 2OTLP 2EG5A 2XT1A 4F37A 4DG9A 2PENA 4XRQA 4XROA 2CNRA 2N6YA 3H4EA 2KOSA 2Z46A 2GDXA 3LMOA 2BHVA 1DV5A 2LPKA 2XZ0D 2GZJA 1VQ4P 3P05A 2GYKA 2VSQA 5F2KA 2MR7A 1HQBA 2KG8A 1ZMBA 3DPHA 1VQPP 1A8OA 1X3OA 2KG6A 1IMQA 2E1MA 2JGPA 2OTJP 2N50A 2AFEA 3DS4A 1VQOP 2JU2A 5HGOA 2K2QA 3WBHA 3RG2A 3G26A 3LRYA 3OW2O 2LIUA 2VLOA 3CCRP 2QNWA 4PXHB 2JU1A 2GZIA 1GXGA 4PH1A 4U0FA 1IMPA 2X2BA 4GR6A 1Q81Q 1IUQA 4H2YC 1VHNA 2ERHA 2L9FA 2JYLA 3CCVP 1K30A 4XFXA 2LKIA 4BPFA 3GJNA 2WPTA 3EJBA 2PEOA 4QNBA 3HYBA 4M0IA 2EIAA 1T8KA 2PNGA 2M8LA 3CD6P 4U0DA 5I4TG 1HY8A 2MVVA 2L4BA 3I55P 2JAZA 2GDYA 2JQ4A 2MD9A 1UJZA 1VQLP 2QEXP 3DS0A 3H47A 4QKOA 1YJNP 3CCMP 1M6EX 1VQ8P 2XXMA 1E0HA 1VQ7P 2CQ8A 3CXCO 5JPAA 3EJDA 2LIWA 3RG6C 2N5HA 4COPA 7CEIA 1VQNP 1D1DA 5HV8A 2L6EA 5BS1A 5HGNA 4R0MA 4MRTC 1FR2A 4IPYA 4U0BA 1ZNVA 3G71P 1Q86Q 2ONTA 1W2BO 3DTJA 1KLPA 5HGMA 1AF8A 2M8PA 3NTEA 4HKGA 3M1MA 5KP8B 3G28A 3CC7P 4CA3A 5F2OA 2AF8A 2FQ2A 2FAEA 1KQSO 2M8NA 1E6JP 1CEIA 1MZ8A 2KODA 2LL8A 3DS2A 1F80D 3G1GA 1UNKA 3EJEA 3NY7B 1M6NA 3B5IA 1NQ4A 3DS1A 2PEQA 2FVEA 1GXHA 2FACA 2FVAA 1VQ5P 3GKLC 2CWOA 2KGEA 2LTEA 4UHPB 5EW5E 1M74A 4XFYA 1RO2A 2EHSA 1RO0A 2BUOA 3CCJP 3HZQA 1K9MQ 4GR2A 2AFDA 1VKUA 2KGAA 3CC4P 2QA4P 3G21A 3CMAP 3G1IA 2N6ZA 2FVFA 4NEOA 2MF4A 1VQKP 2FQ0A 2AVAA 2NO8A 2KOQA 1QRJA 2K0YA 2GDWA 2KORA 3CE7A 2DNWA 1VQ9P 2N5IA 2PY8A 2K0XA 1GPJA 3G6EP 2LOLA 1EOQA 2L22A 2PEKA 3VRLC 2K93A 2XV6A 2VLQA 1L0IA 1L0HA 2EFJA 4COCA 2OARA 2JBGA 4PWVB 2DGYA 5F2NA 3CCQP 3U43A 5BS2A 3MGEA 2K5XA 3B4QA 1BXIA 1ACPA 3CCUP 1Q7YQ 2JO0A 1YHQP 3CC2P 2VLPA 2KOPA 4U0EA 2PEJA 1AYIA 4H2XC 2GZGA 4WYMA 3CPWO 4IZ6A 3DS3A 1RNIA 3CCSP 4BPHA 2CGQA 1YIJP 3CMEP 3G4SP 2FHSC 1M90Q 1A43A 2Z44A 2KWLA 2KR5A 2ROQA 2XZ1C 2PEMA 3Q20A 1YJ9P 5HVCA 2JB0A 1AUMA 2MR8A 2P9XA 1K73Q 2KG9A 1YI2P 4U0CA 2N98A 4PH0A 2MY5A 2PEIA 5DCKA 5CZDB 1KC8Q 2K0DX 3G0VA 1VQMP 3GZMA 3E2DA 4XFZA
chains in the Genus database with same CATH topology
2K2QA 2K93A 3RG2A 2K92A 1L0IA 1KLPA 1AF8A 1L0HA 4HKGA 2KGDA 2LIUA 2L0QA 2FADA 5KP8B 2EHTA 4CA3A 2QNWA 4PXHB 2JU1A 1DNYA 2AF8A 5KP6B 2FQ2A 4PWVB 2KOOA 2CG5B 2X2BA 4BPGA 4H2YC 2FAEA 2L9FA 1OR5A 4H2WC 2KW2A 2LKIA 4BPFA 2K94A 5EJDA 2M5RA 3EJBA 2LL8A 1F80D 3EJEA 3NY7B 1T8KA 1NQ4A 3GZLA 2PNGA 1HY8A 2FVEA 2MVVA 1ACPA 2FACA 2MVUA 2FVAA 2L4BA 2FQ1A 2KGCA 5KP7B 2LMLA 2KGEA 2LTEA 4DG9A 2GDYA 2KOPA 2JQ4A 2MD9A 2CNRA 2N6YA 4H2XC 2KOSA 2EHSA 2GDXA 3LMOA 4IZ6A 1DV5A 2AFDA 2LPKA 1VKUA 2KGAA 2XZ0D 4BPHA 2CGQA 2CQ8A 2FHSC 2N6ZA 2KWLA 2KR5A 3EJDA 2LIWA 2N5HA 2ROQA 2FVFA 2VSQA 2MR7A 2XZ1C 4NEOA 1HQBA 2KG8A 5HVCA 2MF4A 2FQ0A 2AVAA 5HV8A 2MR8A 1X3OA 2KG6A 2KG9A 2JGPA 2KOQA 2K0YA 2GDWA 2KORA 2MY5A 2N98A 3CE7A 4R0MA 5CZDB 2N50A 2AFEA 2DNWA 4MRTC 2N5IA 3GZMA 2JU2A 2K0XA 2LOLA 2L22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2Q A;  2K93 A;  3RG2 A;  2K92 A;  1L0I A;  1KLP A;  1AF8 A;  1L0H A;  4HKG A;  2KGD A;  2LIU A;  2L0Q A;  2FAD A;  5KP8 B;  2EHT A;  4CA3 A;  2QNW A;  4PXH B;  2JU1 A;  1DNY A;  2AF8 A;  5KP6 B;  2FQ2 A;  4PWV B;  2KOO A;  2CG5 B;  2X2B A;  4BPG A;  4H2Y C;  2FAE A;  2L9F A;  1OR5 A;  4H2W C;  2KW2 A;  2LKI A;  4BPF A;  2K94 A;  5EJD A;  2M5R A;  3EJB A;  2LL8 A;  1F80 D;  3EJE A;  3NY7 B;  1T8K A;  1NQ4 A;  3GZL A;  2PNG A;  1HY8 A;  2FVE A;  2MVV A;  1ACP A;  2FAC A;  2MVU A;  2FVA A;  2L4B A;  2FQ1 A;  2KGC A;  5KP7 B;  2LML A;  2KGE A;  2LTE A;  4DG9 A;  2GDY A;  2KOP A;  2JQ4 A;  2MD9 A;  2CNR A;  2N6Y A;  4H2X C;  2KOS A;  2EHS A;  2GDX A;  3LMO A;  4IZ6 A;  1DV5 A;  2AFD A;  2LPK A;  1VKU A;  2KGA A;  2XZ0 D;  4BPH A;  2CGQ A;  2CQ8 A;  2FHS C;  2N6Z A;  2KWL A;  2KR5 A;  3EJD A;  2LIW A;  2N5H A;  2ROQ A;  2FVF A;  2VSQ A;  2MR7 A;  2XZ1 C;  4NEO A;  1HQB A;  2KG8 A;  5HVC A;  2MF4 A;  2FQ0 A;  2AVA A;  5HV8 A;  2MR8 A;  1X3O A;  2KG6 A;  2KG9 A;  2JGP A;  2KOQ A;  2K0Y A;  2GDW A;  2KOR A;  2MY5 A;  2N98 A;  3CE7 A;  4R0M A;  5CZD B;  2N50 A;  2AFE A;  2DNW A;  4MRT C;  2N5I A;  3GZM A;  2JU2 A;  2K0X A;  2LOL A;  2L22 A; 
#chains in the Genus database with same CATH topology
 3CCL P;  2K92 A;  1Z6M A;  5HGL A;  3I56 P;  2KGD A;  3H0D A;  2L0Q A;  2FAD A;  2EHT A;  3CCE P;  1DNY A;  1K8A Q;  5KP6 B;  1QVG O;  2GZF A;  2KOO A;  2CG5 B;  1JJ2 O;  1YJW P;  2Z45 A;  4BPG A;  1KD1 Q;  2VLN A;  1OR5 A;  2GZE A;  1EIA A;  4H2W C;  2KW2 A;  2JYG A;  1QVF O;  2K94 A;  5EJD A;  2M5R A;  3DS5 A;  1M1K Q;  1BAJ A;  1EMV A;  1VQ6 P;  1Q82 Q;  4U0A A;  3G29 A;  1S72 P;  3GZL A;  2LF4 A;  2MVU A;  1YIT P;  1NJI Q;  2FQ1 A;  2KGC A;  5KP7 B;  1N8R Q;  2LML A;  2OTL P;  2EG5 A;  2XT1 A;  4F37 A;  4DG9 A;  2PEN A;  4XRQ A;  4XRO A;  2CNR A;  2N6Y A;  3H4E A;  2KOS A;  2Z46 A;  2GDX A;  3LMO A;  2BHV A;  1DV5 A;  2LPK A;  2XZ0 D;  2GZJ A;  1VQ4 P;  3P05 A;  2GYK A;  2VSQ A;  5F2K A;  2MR7 A;  1HQB A;  2KG8 A;  1ZMB A;  3DPH A;  1VQP P;  1A8O A;  1X3O A;  2KG6 A;  1IMQ A;  2E1M A;  2JGP A;  2OTJ P;  2N50 A;  2AFE A;  3DS4 A;  1VQO P;  2JU2 A;  5HGO A;  2K2Q A;  3WBH A;  3RG2 A;  3G26 A;  3LRY A;  3OW2 O;  2LIU A;  2VLO A;  3CCR P;  2QNW A;  4PXH B;  2JU1 A;  2GZI A;  1GXG A;  4PH1 A;  4U0F A;  1IMP A;  2X2B A;  4GR6 A;  1Q81 Q;  1IUQ A;  4H2Y C;  1VHN A;  2ERH A;  2L9F A;  2JYL A;  3CCV P;  1K30 A;  4XFX A;  2LKI A;  4BPF A;  3GJN A;  2WPT A;  3EJB A;  2PEO A;  4QNB A;  3HYB A;  4M0I A;  2EIA A;  1T8K A;  2PNG A;  2M8L A;  3CD6 P;  4U0D A;  5I4T G;  1HY8 A;  2MVV A;  2L4B A;  3I55 P;  2JAZ A;  2GDY A;  2JQ4 A;  2MD9 A;  1UJZ A;  1VQL P;  2QEX P;  3DS0 A;  3H47 A;  4QKO A;  1YJN P;  3CCM P;  1M6E X;  1VQ8 P;  2XXM A;  1E0H A;  1VQ7 P;  2CQ8 A;  3CXC O;  5JPA A;  3EJD A;  2LIW A;  3RG6 C;  2N5H A;  4COP A;  7CEI A;  1VQN P;  1D1D A;  5HV8 A;  2L6E A;  5BS1 A;  5HGN A;  4R0M A;  4MRT C;  1FR2 A;  4IPY A;  4U0B A;  1ZNV A;  3G71 P;  1Q86 Q;  2ONT A;  1W2B O;  3DTJ A;  1KLP A;  5HGM A;  1AF8 A;  2M8P A;  3NTE A;  4HKG A;  3M1M A;  5KP8 B;  3G28 A;  3CC7 P;  4CA3 A;  5F2O A;  2AF8 A;  2FQ2 A;  2FAE A;  1KQS O;  2M8N A;  1E6J P;  1CEI A;  1MZ8 A;  2KOD A;  2LL8 A;  3DS2 A;  1F80 D;  3G1G A;  1UNK A;  3EJE A;  3NY7 B;  1M6N A;  3B5I A;  1NQ4 A;  3DS1 A;  2PEQ A;  2FVE A;  1GXH A;  2FAC A;  2FVA A;  1VQ5 P;  3GKL C;  2CWO A;  2KGE A;  2LTE A;  4UHP B;  5EW5 E;  1M74 A;  4XFY A;  1RO2 A;  2EHS A;  1RO0 A;  2BUO A;  3CCJ P;  3HZQ A;  1K9M Q;  4GR2 A;  2AFD A;  1VKU A;  2KGA A;  3CC4 P;  2QA4 P;  3G21 A;  3CMA P;  3G1I A;  2N6Z A;  2FVF A;  4NEO A;  2MF4 A;  1VQK P;  2FQ0 A;  2AVA A;  2NO8 A;  2KOQ A;  1QRJ A;  2K0Y A;  2GDW A;  2KOR A;  3CE7 A;  2DNW A;  1VQ9 P;  2N5I A;  2PY8 A;  2K0X A;  1GPJ A;  3G6E P;  2LOL A;  1EOQ A;  2L22 A;  2PEK A;  3VRL C;  2K93 A;  2XV6 A;  2VLQ A;  1L0I A;  1L0H A;  2EFJ A;  4COC A;  2OAR A;  2JBG A;  4PWV B;  2DGY A;  5F2N A;  3CCQ P;  3U43 A;  5BS2 A;  3MGE A;  2K5X A;  3B4Q A;  1BXI A;  1ACP A;  3CCU P;  1Q7Y Q;  2JO0 A;  1YHQ P;  3CC2 P;  2VLP A;  2KOP A;  4U0E A;  2PEJ A;  1AYI A;  4H2X C;  2GZG A;  4WYM A;  3CPW O;  4IZ6 A;  3DS3 A;  1RNI A;  3CCS P;  4BPH A;  2CGQ A;  1YIJ P;  3CME P;  3G4S P;  2FHS C;  1M90 Q;  1A43 A;  2Z44 A;  2KWL A;  2KR5 A;  2ROQ A;  2XZ1 C;  2PEM A;  3Q20 A;  1YJ9 P;  5HVC A;  2JB0 A;  1AUM A;  2MR8 A;  2P9X A;  1K73 Q;  2KG9 A;  1YI2 P;  4U0C A;  2N98 A;  4PH0 A;  2MY5 A;  2PEI A;  5DCK A;  5CZD B;  1KC8 Q;  2K0D X;  3G0V A;  1VQM P;  3GZM A;  3E2D A;  4XFZ A; 
#chains in the Genus database with same CATH homology
 2K2Q A;  2K93 A;  3RG2 A;  2K92 A;  1L0I A;  1KLP A;  1AF8 A;  1L0H A;  4HKG A;  2KGD A;  2LIU A;  2L0Q A;  2FAD A;  5KP8 B;  2EHT A;  4CA3 A;  2QNW A;  4PXH B;  2JU1 A;  1DNY A;  2AF8 A;  5KP6 B;  2FQ2 A;  4PWV B;  2KOO A;  2CG5 B;  2X2B A;  4BPG A;  4H2Y C;  2FAE A;  2L9F A;  1OR5 A;  4H2W C;  2KW2 A;  2LKI A;  4BPF A;  2K94 A;  5EJD A;  2M5R A;  3EJB A;  2LL8 A;  1F80 D;  3EJE A;  3NY7 B;  1T8K A;  1NQ4 A;  3GZL A;  2PNG A;  1HY8 A;  2FVE A;  2MVV A;  1ACP A;  2FAC A;  2MVU A;  2FVA A;  2L4B A;  2FQ1 A;  2KGC A;  5KP7 B;  2LML A;  2KGE A;  2LTE A;  4DG9 A;  2GDY A;  2KOP A;  2JQ4 A;  2MD9 A;  2CNR A;  2N6Y A;  4H2X C;  2KOS A;  2EHS A;  2GDX A;  3LMO A;  4IZ6 A;  1DV5 A;  2AFD A;  2LPK A;  1VKU A;  2KGA A;  2XZ0 D;  4BPH A;  2CGQ A;  2CQ8 A;  2FHS C;  2N6Z A;  2KWL A;  2KR5 A;  3EJD A;  2LIW A;  2N5H A;  2ROQ A;  2FVF A;  2VSQ A;  2MR7 A;  2XZ1 C;  4NEO A;  1HQB A;  2KG8 A;  5HVC A;  2MF4 A;  2FQ0 A;  2AVA A;  5HV8 A;  2MR8 A;  1X3O A;  2KG6 A;  2KG9 A;  2JGP A;  2KOQ A;  2K0Y A;  2GDW A;  2KOR A;  2MY5 A;  2N98 A;  3CE7 A;  4R0M A;  5CZD B;  2N50 A;  2AFE A;  2DNW A;  4MRT C;  2N5I A;  3GZM A;  2JU2 A;  2K0X A;  2LOL A;  2L22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...