3EJEA

Crystal structure of p450bioi in complex with octadec-9z-enoic acid ligated acyl carrier protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
78
structure length
78
Chain Sequence
SHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/lipid transport
molecule keywords Acyl carrier protein
total genus 22
structure length 78
sequence length 78
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3ejeA00
2L9FA 2K2QA 2AFDA 2EHSA 3EJEA 2GDYA 2L4BA 2KR5A 1HY8A 2X2BA 2FVAA 2LIUA 4R0MA 2N6ZA 2LIWA 2CQ8A 1X3OA 2FHSC 3EJBA 2KGCA 3LMOA 1HQBA 2K92A 5KP6B 5CZDB 1AF8A 2KORA 2FAEA 2KOSA 2KGEA 2MD9A 2EHTA 2LPKA 1OR5A 4NEOA 2PNGA 4PWVB 5EJDA 2JU1A 2AFEA 4H2WC 2FVFA 2CG5B 2K0YA 4MRTC 4HKGA 4CA3A 2AVAA 2MVVA 5KP7B 2GDXA 2L22A 2N98A 2KG6A 2LMLA 2JGPA 2GDWA 2MY5A 2FQ0A 1ACPA 1L0IA 2CGQA 2N5HA 3NY7B 5HVCA 2KG9A 2L0QA 4BPFA 4H2XC 2LTEA 2LKIA 2N5IA 2KWLA 2QNWA 2VSQA 2KGAA 4PXHB 3GZMA 2LL8A 1VKUA 2CNRA 5KP8B 2KOOA 4IZ6A 2XZ0D 2LOLA 4BPHA 4BPGA 2K93A 1L0HA 2JQ4A 1NQ4A 2FACA 2KOPA 2K94A 2XZ1C 2KOQA 1T8KA 2MVUA 2M5RA 1KLPA 2K0XA 5HV8A 4H2YC 1DNYA 2N6YA 4DG9A 2ROQA 3RG2A 2KGDA 2DNWA 2AF8A 3GZLA 2MR7A 2FQ2A 3CE7A 2FVEA 2KG8A 3EJDA 1DV5A 2FQ1A 2MR8A 2MF4A 1F80D 2JU2A 2N50A 2KW2A 2FADA
chains in the Genus database with same CATH superfamily
3DS3A 1M6NA 2Z46A 4COCA 1FR2A 1GXHA 1K30A 3EJBA 2L6EA 3LMOA 4M0IA 4GR6A 1Q7YQ 1IMPA 3DS2A 5KP6B 1A8OA 1RNIA 2KORA 3CC2P 5F2NA 2KOSA 3CC4P 2PEMA 3CCMP 3H4EA 1CEIA 2PNGA 1UNKA 5F2OA 3B5IA 2AFEA 3Q20A 4XFXA 2FVFA 3DTJA 4MRTC 2GDXA 5I4TG 2N98A 2LMLA 1MZ8A 2PEQA 1L0IA 2CGQA 2N5HA 1YHQP 2KG9A 1M90Q 3I55P 4BPFA 3WBHA 2KWLA 1VQMP 3GZMA 2NO8A 2LL8A 4U0DA 2CNRA 1E0HA 3DS5A 1EIAA 4IZ6A 2GZIA 2M8NA 1L0HA 1AYIA 1K8AQ 1M6EX 1NQ4A 4XROA 2EIAA 1VQOP 2VLQA 2KOQA 2Z44A 1DNYA 4DG9A 1M74A 3RG2A 3GZLA 3DS0A 2PEKA 2MR7A 1YJ9P 2FQ2A 2PEJA 3CCEP 1DV5A 2MR8A 1F80D 3CCUP 2QA4P 2KW2A 1QVFO 2K2QA 3HZQA 2GDYA 2L4BA 1NJIQ 1AUMA 4UHPB 2KR5A 2FVAA 2LIUA 3H47A 2CQ8A 3G1GA 2KGCA 1QRJA 2JO0A 3G29A 4F37A 5CZDB 3CCJP 1AF8A 1N8RQ 2FAEA 3CXCO 2MD9A 4COPA 4U0EA 1VQLP 1BAJA 4PWVB 1M1KQ 3P05A 2M8PA 5JPAA 2GZGA 2ERHA 2MVVA 1Q86Q 3E2DA 2JGPA 1ACPA 3CCQP 3B4QA 5F2KA 2WPTA 4U0FA 1Q81Q 2LTEA 3RG6C 2QNWA 2GZFA 7CEIA 2KOOA 2XZ0D 2K93A 3CC7P 4QNBA 4GR2A 4U0CA 2VLOA 2PY8A 2KOPA 1ZNVA 1YJWP 1Z6MA 2EG5A 3G4SP 1YIJP 2MVUA 2M5RA 1KLPA 2DGYA 1K9MQ 2EFJA 2JB0A 3CCLP 5HGLA 2K0DX 2E1MA 1KD1Q 3CMEP 2VLNA 2MF4A 2JU2A 2PENA 1A43A 3HYBA 2FADA 3NTEA 2L9FA 2AFDA 5BS1A 3DPHA 1HY8A 3CCVP 2LIWA 1X3OA 2FHSC 3I56P 2K92A 5BS2A 4U0AA 2CWOA 1GPJA 3M1MA 3DS1A 1VHNA 2KGEA 2EHTA 3GKLC 1Q82Q 2LPKA 3CCSP 2QEXP 1OR5A 3G26A 5EJDA 4PH0A 2LF4A 4XRQA 5HGMA 1YJNP 4CA3A 2AVAA 2XT1A 3U43A 2L22A 3OW2O 2BHVA 2GDWA 2MY5A 4QKOA 1YI2P 5HVCA 1S72P 2L0QA 3G0VA 4H2XC 3H0DA 2K5XA 1VQ5P 2N5IA 2PEOA 1YITP 1VQ8P 1VKUA 1VQ7P 5KP8B 3CMAP 2OARA 4BPGA 3G6EP 1E6JP 2FACA 4XFZA 2ONTA 1EMVA 2K94A 2GZEA 4PH1A 2JYGA 1T8KA 2BUOA 4IPYA 5EW5E 1IUQA 2K0XA 2M8LA 4H2YC 3LRYA 2PEIA 5HGOA 2KG8A 1JJ2O 1ZMBA 4XFYA 2EHSA 3EJEA 2KODA 4U0BA 2XV6A 2X2BA 4R0MA 2N6ZA 2Z45A 1IMQA 1HQBA 5HGNA 4WYMA 1QVGO 1RO2A 1RO0A 3G21A 1K73Q 2JAZA 3CCRP 3VRLC 2VLPA 4NEOA 2GYKA 1KQSO 1VQNP 1UJZA 2OTJP 2JU1A 3GJNA 2OTLP 3DS4A 4H2WC 3CPWO 2CG5B 2GZJA 2K0YA 4HKGA 1BXIA 5KP7B 1GXGA 2KG6A 5DCKA 2FQ0A 3NY7B 2LKIA 2VSQA 2KGAA 4PXHB 2P9XA 2LOLA 4BPHA 2XXMA 2JBGA 3G28A 2JQ4A 1VQPP 1VQ9P 2JYLA 1W2BO 1EOQA 1VQ6P 2XZ1C 3CD6P 1D1DA 1VQKP 5HV8A 2N6YA 2ROQA 2KGDA 3G1IA 2DNWA 2AF8A 3MGEA 1KC8Q 3CE7A 2FVEA 3EJDA 2FQ1A 3G71P 2N50A 1VQ4P
chains in the Genus database with same CATH topology
2L9FA 2K2QA 2AFDA 2EHSA 3EJEA 2GDYA 2L4BA 2KR5A 1HY8A 2X2BA 2FVAA 2LIUA 4R0MA 2N6ZA 2LIWA 2CQ8A 1X3OA 2FHSC 3EJBA 2KGCA 3LMOA 1HQBA 2K92A 5KP6B 5CZDB 1AF8A 2KORA 2FAEA 2KOSA 2KGEA 2MD9A 2EHTA 2LPKA 1OR5A 4NEOA 2PNGA 4PWVB 5EJDA 2JU1A 2AFEA 4H2WC 2FVFA 2CG5B 2K0YA 4MRTC 4HKGA 4CA3A 2AVAA 2MVVA 5KP7B 2GDXA 2L22A 2N98A 2KG6A 2LMLA 2JGPA 2GDWA 2MY5A 2FQ0A 1ACPA 1L0IA 2CGQA 2N5HA 3NY7B 5HVCA 2KG9A 2L0QA 4BPFA 4H2XC 2LTEA 2LKIA 2N5IA 2KWLA 2QNWA 2VSQA 2KGAA 4PXHB 3GZMA 2LL8A 1VKUA 2CNRA 5KP8B 2KOOA 4IZ6A 2XZ0D 2LOLA 4BPHA 4BPGA 2K93A 1L0HA 2JQ4A 1NQ4A 2FACA 2KOPA 2K94A 2XZ1C 2KOQA 1T8KA 2MVUA 2M5RA 1KLPA 2K0XA 5HV8A 4H2YC 1DNYA 2N6YA 4DG9A 2ROQA 3RG2A 2KGDA 2DNWA 2AF8A 3GZLA 2MR7A 2FQ2A 3CE7A 2FVEA 2KG8A 3EJDA 1DV5A 2FQ1A 2MR8A 2MF4A 1F80D 2JU2A 2N50A 2KW2A 2FADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9F A;  2K2Q A;  2AFD A;  2EHS A;  3EJE A;  2GDY A;  2L4B A;  2KR5 A;  1HY8 A;  2X2B A;  2FVA A;  2LIU A;  4R0M A;  2N6Z A;  2LIW A;  2CQ8 A;  1X3O A;  2FHS C;  3EJB A;  2KGC A;  3LMO A;  1HQB A;  2K92 A;  5KP6 B;  5CZD B;  1AF8 A;  2KOR A;  2FAE A;  2KOS A;  2KGE A;  2MD9 A;  2EHT A;  2LPK A;  1OR5 A;  4NEO A;  2PNG A;  4PWV B;  5EJD A;  2JU1 A;  2AFE A;  4H2W C;  2FVF A;  2CG5 B;  2K0Y A;  4MRT C;  4HKG A;  4CA3 A;  2AVA A;  2MVV A;  5KP7 B;  2GDX A;  2L22 A;  2N98 A;  2KG6 A;  2LML A;  2JGP A;  2GDW A;  2MY5 A;  2FQ0 A;  1ACP A;  1L0I A;  2CGQ A;  2N5H A;  3NY7 B;  5HVC A;  2KG9 A;  2L0Q A;  4BPF A;  4H2X C;  2LTE A;  2LKI A;  2N5I A;  2KWL A;  2QNW A;  2VSQ A;  2KGA A;  4PXH B;  3GZM A;  2LL8 A;  1VKU A;  2CNR A;  5KP8 B;  2KOO A;  4IZ6 A;  2XZ0 D;  2LOL A;  4BPH A;  4BPG A;  2K93 A;  1L0H A;  2JQ4 A;  1NQ4 A;  2FAC A;  2KOP A;  2K94 A;  2XZ1 C;  2KOQ A;  1T8K A;  2MVU A;  2M5R A;  1KLP A;  2K0X A;  5HV8 A;  4H2Y C;  1DNY A;  2N6Y A;  4DG9 A;  2ROQ A;  3RG2 A;  2KGD A;  2DNW A;  2AF8 A;  3GZL A;  2MR7 A;  2FQ2 A;  3CE7 A;  2FVE A;  2KG8 A;  3EJD A;  1DV5 A;  2FQ1 A;  2MR8 A;  2MF4 A;  1F80 D;  2JU2 A;  2N50 A;  2KW2 A;  2FAD A; 
#chains in the Genus database with same CATH topology
 3DS3 A;  1M6N A;  2Z46 A;  4COC A;  1FR2 A;  1GXH A;  1K30 A;  3EJB A;  2L6E A;  3LMO A;  4M0I A;  4GR6 A;  1Q7Y Q;  1IMP A;  3DS2 A;  5KP6 B;  1A8O A;  1RNI A;  2KOR A;  3CC2 P;  5F2N A;  2KOS A;  3CC4 P;  2PEM A;  3CCM P;  3H4E A;  1CEI A;  2PNG A;  1UNK A;  5F2O A;  3B5I A;  2AFE A;  3Q20 A;  4XFX A;  2FVF A;  3DTJ A;  4MRT C;  2GDX A;  5I4T G;  2N98 A;  2LML A;  1MZ8 A;  2PEQ A;  1L0I A;  2CGQ A;  2N5H A;  1YHQ P;  2KG9 A;  1M90 Q;  3I55 P;  4BPF A;  3WBH A;  2KWL A;  1VQM P;  3GZM A;  2NO8 A;  2LL8 A;  4U0D A;  2CNR A;  1E0H A;  3DS5 A;  1EIA A;  4IZ6 A;  2GZI A;  2M8N A;  1L0H A;  1AYI A;  1K8A Q;  1M6E X;  1NQ4 A;  4XRO A;  2EIA A;  1VQO P;  2VLQ A;  2KOQ A;  2Z44 A;  1DNY A;  4DG9 A;  1M74 A;  3RG2 A;  3GZL A;  3DS0 A;  2PEK A;  2MR7 A;  1YJ9 P;  2FQ2 A;  2PEJ A;  3CCE P;  1DV5 A;  2MR8 A;  1F80 D;  3CCU P;  2QA4 P;  2KW2 A;  1QVF O;  2K2Q A;  3HZQ A;  2GDY A;  2L4B A;  1NJI Q;  1AUM A;  4UHP B;  2KR5 A;  2FVA A;  2LIU A;  3H47 A;  2CQ8 A;  3G1G A;  2KGC A;  1QRJ A;  2JO0 A;  3G29 A;  4F37 A;  5CZD B;  3CCJ P;  1AF8 A;  1N8R Q;  2FAE A;  3CXC O;  2MD9 A;  4COP A;  4U0E A;  1VQL P;  1BAJ A;  4PWV B;  1M1K Q;  3P05 A;  2M8P A;  5JPA A;  2GZG A;  2ERH A;  2MVV A;  1Q86 Q;  3E2D A;  2JGP A;  1ACP A;  3CCQ P;  3B4Q A;  5F2K A;  2WPT A;  4U0F A;  1Q81 Q;  2LTE A;  3RG6 C;  2QNW A;  2GZF A;  7CEI A;  2KOO A;  2XZ0 D;  2K93 A;  3CC7 P;  4QNB A;  4GR2 A;  4U0C A;  2VLO A;  2PY8 A;  2KOP A;  1ZNV A;  1YJW P;  1Z6M A;  2EG5 A;  3G4S P;  1YIJ P;  2MVU A;  2M5R A;  1KLP A;  2DGY A;  1K9M Q;  2EFJ A;  2JB0 A;  3CCL P;  5HGL A;  2K0D X;  2E1M A;  1KD1 Q;  3CME P;  2VLN A;  2MF4 A;  2JU2 A;  2PEN A;  1A43 A;  3HYB A;  2FAD A;  3NTE A;  2L9F A;  2AFD A;  5BS1 A;  3DPH A;  1HY8 A;  3CCV P;  2LIW A;  1X3O A;  2FHS C;  3I56 P;  2K92 A;  5BS2 A;  4U0A A;  2CWO A;  1GPJ A;  3M1M A;  3DS1 A;  1VHN A;  2KGE A;  2EHT A;  3GKL C;  1Q82 Q;  2LPK A;  3CCS P;  2QEX P;  1OR5 A;  3G26 A;  5EJD A;  4PH0 A;  2LF4 A;  4XRQ A;  5HGM A;  1YJN P;  4CA3 A;  2AVA A;  2XT1 A;  3U43 A;  2L22 A;  3OW2 O;  2BHV A;  2GDW A;  2MY5 A;  4QKO A;  1YI2 P;  5HVC A;  1S72 P;  2L0Q A;  3G0V A;  4H2X C;  3H0D A;  2K5X A;  1VQ5 P;  2N5I A;  2PEO A;  1YIT P;  1VQ8 P;  1VKU A;  1VQ7 P;  5KP8 B;  3CMA P;  2OAR A;  4BPG A;  3G6E P;  1E6J P;  2FAC A;  4XFZ A;  2ONT A;  1EMV A;  2K94 A;  2GZE A;  4PH1 A;  2JYG A;  1T8K A;  2BUO A;  4IPY A;  5EW5 E;  1IUQ A;  2K0X A;  2M8L A;  4H2Y C;  3LRY A;  2PEI A;  5HGO A;  2KG8 A;  1JJ2 O;  1ZMB A;  4XFY A;  2EHS A;  3EJE A;  2KOD A;  4U0B A;  2XV6 A;  2X2B A;  4R0M A;  2N6Z A;  2Z45 A;  1IMQ A;  1HQB A;  5HGN A;  4WYM A;  1QVG O;  1RO2 A;  1RO0 A;  3G21 A;  1K73 Q;  2JAZ A;  3CCR P;  3VRL C;  2VLP A;  4NEO A;  2GYK A;  1KQS O;  1VQN P;  1UJZ A;  2OTJ P;  2JU1 A;  3GJN A;  2OTL P;  3DS4 A;  4H2W C;  3CPW O;  2CG5 B;  2GZJ A;  2K0Y A;  4HKG A;  1BXI A;  5KP7 B;  1GXG A;  2KG6 A;  5DCK A;  2FQ0 A;  3NY7 B;  2LKI A;  2VSQ A;  2KGA A;  4PXH B;  2P9X A;  2LOL A;  4BPH A;  2XXM A;  2JBG A;  3G28 A;  2JQ4 A;  1VQP P;  1VQ9 P;  2JYL A;  1W2B O;  1EOQ A;  1VQ6 P;  2XZ1 C;  3CD6 P;  1D1D A;  1VQK P;  5HV8 A;  2N6Y A;  2ROQ A;  2KGD A;  3G1I A;  2DNW A;  2AF8 A;  3MGE A;  1KC8 Q;  3CE7 A;  2FVE A;  3EJD A;  2FQ1 A;  3G71 P;  2N50 A;  1VQ4 P; 
#chains in the Genus database with same CATH homology
 2L9F A;  2K2Q A;  2AFD A;  2EHS A;  3EJE A;  2GDY A;  2L4B A;  2KR5 A;  1HY8 A;  2X2B A;  2FVA A;  2LIU A;  4R0M A;  2N6Z A;  2LIW A;  2CQ8 A;  1X3O A;  2FHS C;  3EJB A;  2KGC A;  3LMO A;  1HQB A;  2K92 A;  5KP6 B;  5CZD B;  1AF8 A;  2KOR A;  2FAE A;  2KOS A;  2KGE A;  2MD9 A;  2EHT A;  2LPK A;  1OR5 A;  4NEO A;  2PNG A;  4PWV B;  5EJD A;  2JU1 A;  2AFE A;  4H2W C;  2FVF A;  2CG5 B;  2K0Y A;  4MRT C;  4HKG A;  4CA3 A;  2AVA A;  2MVV A;  5KP7 B;  2GDX A;  2L22 A;  2N98 A;  2KG6 A;  2LML A;  2JGP A;  2GDW A;  2MY5 A;  2FQ0 A;  1ACP A;  1L0I A;  2CGQ A;  2N5H A;  3NY7 B;  5HVC A;  2KG9 A;  2L0Q A;  4BPF A;  4H2X C;  2LTE A;  2LKI A;  2N5I A;  2KWL A;  2QNW A;  2VSQ A;  2KGA A;  4PXH B;  3GZM A;  2LL8 A;  1VKU A;  2CNR A;  5KP8 B;  2KOO A;  4IZ6 A;  2XZ0 D;  2LOL A;  4BPH A;  4BPG A;  2K93 A;  1L0H A;  2JQ4 A;  1NQ4 A;  2FAC A;  2KOP A;  2K94 A;  2XZ1 C;  2KOQ A;  1T8K A;  2MVU A;  2M5R A;  1KLP A;  2K0X A;  5HV8 A;  4H2Y C;  1DNY A;  2N6Y A;  4DG9 A;  2ROQ A;  3RG2 A;  2KGD A;  2DNW A;  2AF8 A;  3GZL A;  2MR7 A;  2FQ2 A;  3CE7 A;  2FVE A;  2KG8 A;  3EJD A;  1DV5 A;  2FQ1 A;  2MR8 A;  2MF4 A;  1F80 D;  2JU2 A;  2N50 A;  2KW2 A;  2FAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...