3EJEA

Crystal structure of p450bioi in complex with octadec-9z-enoic acid ligated acyl carrier protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
78
structure length
78
Chain Sequence
b'SHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/lipid transport
total genus 22
structure length 78
sequence length 78
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3ejeA00
2FHSC 2K94A 1HQBA 4H2WC 2N5IA 2FVEA 2K93A 2MVUA 5KP8B 2MF4A 4CA3A 2L9FA 2KGDA 2L22A 2LMLA 2JU2A 1NQ4A 4HKGA 4NEOA 4PXHB 2VSQA 3CE7A 2EHTA 2QNWA 3GZLA 4IZ6A 2FQ0A 1L0HA 2KOOA 2K0XA 2PNGA 2XZ1C 3NY7B 5HVCA 1DV5A 2KG9A 2KOQA 2LTEA 2JQ4A 2K92A 2MD9A 2GDXA 1F80D 2GDYA 4MRTC 2JGPA 2N5HA 4H2XC 4R0MA 2FADA 1VKUA 2EHSA 2CNRA 2LIWA 2AVAA 2MR7A 4PWVB 2K0YA 5HV8A 2LL8A 4BPGA 5KP6B 2L0QA 2KGEA 2LIUA 2JU1A 2MVVA 5CZDB 2KWLA 2DNWA 2ROQA 2FACA 2N6YA 2KG8A 2FQ2A 2LPKA 3EJBA 2LKIA 2LOLA 2GDWA 4H2YC 3EJDA 2AF8A 2KW2A 2N50A 2L4BA 1KLPA 1DNYA 3RG2A 2FQ1A 1T8KA 2KG6A 2XZ0D 1ACPA 1HY8A 5KP7B 2CGQA 3LMOA 2FAEA 2FVAA 3GZMA 4BPFA 2N6ZA 1AF8A 2M5RA 2KGAA 2KGCA 2KORA 2MY5A 4DG9A 1OR5A 2AFEA 2K2QA 1L0IA 4BPHA 2FVFA 1X3OA 2KOPA 2CG5B 2N98A 2KR5A 2X2BA 2AFDA 2MR8A 2CQ8A 5EJDA 2KOSA 3EJEA
chains in the Genus database with same CATH superfamily
1UNKA 2FHSC 1MZ8A 2LF4A 2KGDA 2QA4P 1GXHA 3CC2P 2JU2A 2NO8A 1NQ4A 4PXHB 2QNWA 3NTEA 2FQ0A 2PEQA 1QVGO 1K8AQ 2ERHA 5HVCA 2GZIA 1YITP 1A43A 1VQLP 2MD9A 3VRLC 3G21A 1BAJA 2N5HA 4R0MA 1VKUA 4M0IA 1AUMA 4PWVB 3H47A 4XFYA 2L0QA 1BXIA 2MVVA 5CZDB 1AYIA 5F2KA 2FACA 2EG5A 1GXGA 2FQ2A 1M6EX 2Z46A 2GDWA 5I4TG 2XV6A 1UJZA 5HGLA 1DNYA 3RG2A 1W2BO 3DS5A 2XZ0D 1M6NA 5KP7B 2EFJA 2EIAA 1VQ8P 3GZMA 1VQ5P 3G6EP 1AF8A 2KORA 1YI2P 2K2QA 4BPHA 3CCQP 1X3OA 4COPA 2CG5B 2N98A 2X2BA 3DS3A 2N50A 2JO0A 1Q81Q 2K0DX 2N5IA 1K73Q 1CEIA 2MF4A 4XRQA 2LMLA 4U0BA 4HKGA 4NEOA 3HYBA 3CCJP 4IZ6A 5BS2A 2PEMA 1IUQA 1L0HA 1IMPA 2M8LA 2K0XA 5F2NA 5HGMA 1KQSO 2XZ1C 3M1MA 4GR6A 2K92A 3Q20A 1IMQA 1S72P 1M1KQ 2GDXA 2GDYA 3CC7P 5BS1A 4H2XC 2EHSA 2CNRA 2MR7A 2AVAA 1YJWP 3CCMP 3CCVP 2M8PA 2XT1A 1YIJP 1VQ7P 3CD6P 3CMAP 4BPGA 4U0EA 2BUOA 2KGEA 1YHQP 1VQOP 1Q86Q 2DNWA 3H4EA 3LRYA 2ROQA 2PENA 2E1MA 3I55P 3HZQA 2PEKA 3B5IA 1K30A 2AF8A 2K5XA 2KW2A 1EOQA 1KD1Q 2GYKA 2FQ1A 2KG6A 2QEXP 1HY8A 2JAZA 3RG6C 2Z44A 3MGEA 4BPFA 2N6ZA 2M5RA 1A8OA 3CC4P 2OTJP 3G71P 4DG9A 2VLOA 3P05A 5DCKA 3CCUP 1VQ4P 3CPWO 2P9XA 4H2WC 2FVEA 2JYGA 1RO2A 5KP8B 2GZEA 1GPJA 4CA3A 2L9FA 2L22A 4F37A 3DS1A 3B4QA 3G28A 4PH1A 2XXMA 3DS0A 1QRJA 1ZNVA 3CCEP 3CE7A 2EHTA 7CEIA 3GZLA 3DPHA 2KOOA 2PNGA 2KG9A 4COCA 1FR2A 2OARA 2LTEA 5HGNA 3GJNA 4WYMA 5F2OA 4MRTC 2JGPA 3CCLP 2LIWA 2L6EA 3G29A 1K9MQ 2K0YA 2VLQA 4QNBA 2ONTA 4U0CA 2PEOA 1EMVA 3GKLC 2BHVA 2JU1A 2KWLA 2N6YA 2JYLA 1VQKP 1VQ9P 2LPKA 2JB0A 2LKIA 4H2YC 4U0DA 2VLNA 1KLPA 3G1GA 4XFZA 2KODA 1T8KA 1EIAA 1ACPA 3OW2O 4UHPB 2DGYA 2KGAA 2KGCA 1JJ2O 2MY5A 2WPTA 1OR5A 1E6JP 1E0HA 1L0IA 2CWOA 2KOPA 3CCRP 2KR5A 3G26A 2M8NA 4IPYA 2AFDA 2GZJA 2MR8A 1F80D 3CXCO 2K94A 1HQBA 4GR2A 2K93A 2MVUA 4XROA 5JPAA 1VHNA 1VQNP 1ZMBA 1Q7YQ 4U0AA 2VSQA 4QKOA 1N8RQ 2Z45A 2PEJA 4XFXA 4PH0A 1KC8Q 1M74A 1Q82Q 3NY7B 3DS4A 1DV5A 3DTJA 2KOQA 2VLPA 3G4SP 2JQ4A 2JBGA 5EW5E 1VQPP 2GZFA 1NJIQ 3G1IA 3CMEP 3E2DA 2FADA 5HV8A 2LL8A 3I56P 3U43A 5KP6B 2LIUA 1Z6MA 1D1DA 1VQMP 2KG8A 1RO0A 3EJBA 1RNIA 2LOLA 1M90Q 3EJDA 3WBHA 2GZGA 2L4BA 3G0VA 5HGOA 2CGQA 3LMOA 2FAEA 2FVAA 2PY8A 1YJNP 3H0DA 3DS2A 1YJ9P 1VQ6P 1QVFO 2PEIA 4U0FA 2OTLP 2AFEA 2FVFA 3CCSP 2CQ8A 5EJDA 2KOSA 3EJEA
chains in the Genus database with same CATH topology
2FHSC 2K94A 1HQBA 4H2WC 2N5IA 2FVEA 2K93A 2MVUA 5KP8B 2MF4A 4CA3A 2L9FA 2KGDA 2L22A 2LMLA 2JU2A 1NQ4A 4HKGA 4NEOA 4PXHB 2VSQA 3CE7A 2EHTA 2QNWA 3GZLA 4IZ6A 2FQ0A 1L0HA 2KOOA 2K0XA 2PNGA 2XZ1C 3NY7B 5HVCA 1DV5A 2KG9A 2KOQA 2LTEA 2JQ4A 2K92A 2MD9A 2GDXA 1F80D 2GDYA 4MRTC 2JGPA 2N5HA 4H2XC 4R0MA 2FADA 1VKUA 2EHSA 2CNRA 2LIWA 2AVAA 2MR7A 4PWVB 2K0YA 5HV8A 2LL8A 4BPGA 5KP6B 2L0QA 2KGEA 2LIUA 2JU1A 2MVVA 5CZDB 2KWLA 2DNWA 2ROQA 2FACA 2N6YA 2KG8A 2FQ2A 2LPKA 3EJBA 2LKIA 2LOLA 2GDWA 4H2YC 3EJDA 2AF8A 2KW2A 2N50A 2L4BA 1KLPA 1DNYA 3RG2A 2FQ1A 1T8KA 2KG6A 2XZ0D 1ACPA 1HY8A 5KP7B 2CGQA 3LMOA 2FAEA 2FVAA 3GZMA 4BPFA 2N6ZA 1AF8A 2M5RA 2KGAA 2KGCA 2KORA 2MY5A 4DG9A 1OR5A 2AFEA 2K2QA 1L0IA 4BPHA 2FVFA 1X3OA 2KOPA 2CG5B 2N98A 2KR5A 2X2BA 2AFDA 2MR8A 2CQ8A 5EJDA 2KOSA 3EJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FHS C;  2K94 A;  1HQB A;  4H2W C;  2N5I A;  2FVE A;  2K93 A;  2MVU A;  5KP8 B;  2MF4 A;  4CA3 A;  2L9F A;  2KGD A;  2L22 A;  2LML A;  2JU2 A;  1NQ4 A;  4HKG A;  4NEO A;  4PXH B;  2VSQ A;  3CE7 A;  2EHT A;  2QNW A;  3GZL A;  4IZ6 A;  2FQ0 A;  1L0H A;  2KOO A;  2K0X A;  2PNG A;  2XZ1 C;  3NY7 B;  5HVC A;  1DV5 A;  2KG9 A;  2KOQ A;  2LTE A;  2JQ4 A;  2K92 A;  2MD9 A;  2GDX A;  1F80 D;  2GDY A;  4MRT C;  2JGP A;  2N5H A;  4H2X C;  4R0M A;  2FAD A;  1VKU A;  2EHS A;  2CNR A;  2LIW A;  2AVA A;  2MR7 A;  4PWV B;  2K0Y A;  5HV8 A;  2LL8 A;  4BPG A;  5KP6 B;  2L0Q A;  2KGE A;  2LIU A;  2JU1 A;  2MVV A;  5CZD B;  2KWL A;  2DNW A;  2ROQ A;  2FAC A;  2N6Y A;  2KG8 A;  2FQ2 A;  2LPK A;  3EJB A;  2LKI A;  2LOL A;  2GDW A;  4H2Y C;  3EJD A;  2AF8 A;  2KW2 A;  2N50 A;  2L4B A;  1KLP A;  1DNY A;  3RG2 A;  2FQ1 A;  1T8K A;  2KG6 A;  2XZ0 D;  1ACP A;  1HY8 A;  5KP7 B;  2CGQ A;  3LMO A;  2FAE A;  2FVA A;  3GZM A;  4BPF A;  2N6Z A;  1AF8 A;  2M5R A;  2KGA A;  2KGC A;  2KOR A;  2MY5 A;  4DG9 A;  1OR5 A;  2AFE A;  2K2Q A;  1L0I A;  4BPH A;  2FVF A;  1X3O A;  2KOP A;  2CG5 B;  2N98 A;  2KR5 A;  2X2B A;  2AFD A;  2MR8 A;  2CQ8 A;  5EJD A;  2KOS A;  3EJE A; 
#chains in the Genus database with same CATH topology
 1UNK A;  2FHS C;  1MZ8 A;  2LF4 A;  2KGD A;  2QA4 P;  1GXH A;  3CC2 P;  2JU2 A;  2NO8 A;  1NQ4 A;  4PXH B;  2QNW A;  3NTE A;  2FQ0 A;  2PEQ A;  1QVG O;  1K8A Q;  2ERH A;  5HVC A;  2GZI A;  1YIT P;  1A43 A;  1VQL P;  2MD9 A;  3VRL C;  3G21 A;  1BAJ A;  2N5H A;  4R0M A;  1VKU A;  4M0I A;  1AUM A;  4PWV B;  3H47 A;  4XFY A;  2L0Q A;  1BXI A;  2MVV A;  5CZD B;  1AYI A;  5F2K A;  2FAC A;  2EG5 A;  1GXG A;  2FQ2 A;  1M6E X;  2Z46 A;  2GDW A;  5I4T G;  2XV6 A;  1UJZ A;  5HGL A;  1DNY A;  3RG2 A;  1W2B O;  3DS5 A;  2XZ0 D;  1M6N A;  5KP7 B;  2EFJ A;  2EIA A;  1VQ8 P;  3GZM A;  1VQ5 P;  3G6E P;  1AF8 A;  2KOR A;  1YI2 P;  2K2Q A;  4BPH A;  3CCQ P;  1X3O A;  4COP A;  2CG5 B;  2N98 A;  2X2B A;  3DS3 A;  2N50 A;  2JO0 A;  1Q81 Q;  2K0D X;  2N5I A;  1K73 Q;  1CEI A;  2MF4 A;  4XRQ A;  2LML A;  4U0B A;  4HKG A;  4NEO A;  3HYB A;  3CCJ P;  4IZ6 A;  5BS2 A;  2PEM A;  1IUQ A;  1L0H A;  1IMP A;  2M8L A;  2K0X A;  5F2N A;  5HGM A;  1KQS O;  2XZ1 C;  3M1M A;  4GR6 A;  2K92 A;  3Q20 A;  1IMQ A;  1S72 P;  1M1K Q;  2GDX A;  2GDY A;  3CC7 P;  5BS1 A;  4H2X C;  2EHS A;  2CNR A;  2MR7 A;  2AVA A;  1YJW P;  3CCM P;  3CCV P;  2M8P A;  2XT1 A;  1YIJ P;  1VQ7 P;  3CD6 P;  3CMA P;  4BPG A;  4U0E A;  2BUO A;  2KGE A;  1YHQ P;  1VQO P;  1Q86 Q;  2DNW A;  3H4E A;  3LRY A;  2ROQ A;  2PEN A;  2E1M A;  3I55 P;  3HZQ A;  2PEK A;  3B5I A;  1K30 A;  2AF8 A;  2K5X A;  2KW2 A;  1EOQ A;  1KD1 Q;  2GYK A;  2FQ1 A;  2KG6 A;  2QEX P;  1HY8 A;  2JAZ A;  3RG6 C;  2Z44 A;  3MGE A;  4BPF A;  2N6Z A;  2M5R A;  1A8O A;  3CC4 P;  2OTJ P;  3G71 P;  4DG9 A;  2VLO A;  3P05 A;  5DCK A;  3CCU P;  1VQ4 P;  3CPW O;  2P9X A;  4H2W C;  2FVE A;  2JYG A;  1RO2 A;  5KP8 B;  2GZE A;  1GPJ A;  4CA3 A;  2L9F A;  2L22 A;  4F37 A;  3DS1 A;  3B4Q A;  3G28 A;  4PH1 A;  2XXM A;  3DS0 A;  1QRJ A;  1ZNV A;  3CCE P;  3CE7 A;  2EHT A;  7CEI A;  3GZL A;  3DPH A;  2KOO A;  2PNG A;  2KG9 A;  4COC A;  1FR2 A;  2OAR A;  2LTE A;  5HGN A;  3GJN A;  4WYM A;  5F2O A;  4MRT C;  2JGP A;  3CCL P;  2LIW A;  2L6E A;  3G29 A;  1K9M Q;  2K0Y A;  2VLQ A;  4QNB A;  2ONT A;  4U0C A;  2PEO A;  1EMV A;  3GKL C;  2BHV A;  2JU1 A;  2KWL A;  2N6Y A;  2JYL A;  1VQK P;  1VQ9 P;  2LPK A;  2JB0 A;  2LKI A;  4H2Y C;  4U0D A;  2VLN A;  1KLP A;  3G1G A;  4XFZ A;  2KOD A;  1T8K A;  1EIA A;  1ACP A;  3OW2 O;  4UHP B;  2DGY A;  2KGA A;  2KGC A;  1JJ2 O;  2MY5 A;  2WPT A;  1OR5 A;  1E6J P;  1E0H A;  1L0I A;  2CWO A;  2KOP A;  3CCR P;  2KR5 A;  3G26 A;  2M8N A;  4IPY A;  2AFD A;  2GZJ A;  2MR8 A;  1F80 D;  3CXC O;  2K94 A;  1HQB A;  4GR2 A;  2K93 A;  2MVU A;  4XRO A;  5JPA A;  1VHN A;  1VQN P;  1ZMB A;  1Q7Y Q;  4U0A A;  2VSQ A;  4QKO A;  1N8R Q;  2Z45 A;  2PEJ A;  4XFX A;  4PH0 A;  1KC8 Q;  1M74 A;  1Q82 Q;  3NY7 B;  3DS4 A;  1DV5 A;  3DTJ A;  2KOQ A;  2VLP A;  3G4S P;  2JQ4 A;  2JBG A;  5EW5 E;  1VQP P;  2GZF A;  1NJI Q;  3G1I A;  3CME P;  3E2D A;  2FAD A;  5HV8 A;  2LL8 A;  3I56 P;  3U43 A;  5KP6 B;  2LIU A;  1Z6M A;  1D1D A;  1VQM P;  2KG8 A;  1RO0 A;  3EJB A;  1RNI A;  2LOL A;  1M90 Q;  3EJD A;  3WBH A;  2GZG A;  2L4B A;  3G0V A;  5HGO A;  2CGQ A;  3LMO A;  2FAE A;  2FVA A;  2PY8 A;  1YJN P;  3H0D A;  3DS2 A;  1YJ9 P;  1VQ6 P;  1QVF O;  2PEI A;  4U0F A;  2OTL P;  2AFE A;  2FVF A;  3CCS P;  2CQ8 A;  5EJD A;  2KOS A;  3EJE A; 
#chains in the Genus database with same CATH homology
 2FHS C;  2K94 A;  1HQB A;  4H2W C;  2N5I A;  2FVE A;  2K93 A;  2MVU A;  5KP8 B;  2MF4 A;  4CA3 A;  2L9F A;  2KGD A;  2L22 A;  2LML A;  2JU2 A;  1NQ4 A;  4HKG A;  4NEO A;  4PXH B;  2VSQ A;  3CE7 A;  2EHT A;  2QNW A;  3GZL A;  4IZ6 A;  2FQ0 A;  1L0H A;  2KOO A;  2K0X A;  2PNG A;  2XZ1 C;  3NY7 B;  5HVC A;  1DV5 A;  2KG9 A;  2KOQ A;  2LTE A;  2JQ4 A;  2K92 A;  2MD9 A;  2GDX A;  1F80 D;  2GDY A;  4MRT C;  2JGP A;  2N5H A;  4H2X C;  4R0M A;  2FAD A;  1VKU A;  2EHS A;  2CNR A;  2LIW A;  2AVA A;  2MR7 A;  4PWV B;  2K0Y A;  5HV8 A;  2LL8 A;  4BPG A;  5KP6 B;  2L0Q A;  2KGE A;  2LIU A;  2JU1 A;  2MVV A;  5CZD B;  2KWL A;  2DNW A;  2ROQ A;  2FAC A;  2N6Y A;  2KG8 A;  2FQ2 A;  2LPK A;  3EJB A;  2LKI A;  2LOL A;  2GDW A;  4H2Y C;  3EJD A;  2AF8 A;  2KW2 A;  2N50 A;  2L4B A;  1KLP A;  1DNY A;  3RG2 A;  2FQ1 A;  1T8K A;  2KG6 A;  2XZ0 D;  1ACP A;  1HY8 A;  5KP7 B;  2CGQ A;  3LMO A;  2FAE A;  2FVA A;  3GZM A;  4BPF A;  2N6Z A;  1AF8 A;  2M5R A;  2KGA A;  2KGC A;  2KOR A;  2MY5 A;  4DG9 A;  1OR5 A;  2AFE A;  2K2Q A;  1L0I A;  4BPH A;  2FVF A;  1X3O A;  2KOP A;  2CG5 B;  2N98 A;  2KR5 A;  2X2B A;  2AFD A;  2MR8 A;  2CQ8 A;  5EJD A;  2KOS A;  3EJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...