3EJEA

Crystal structure of p450bioi in complex with octadec-9z-enoic acid ligated acyl carrier protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
78
structure length
78
Chain Sequence
SHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/lipid transport
molecule keywords Acyl carrier protein
total genus 22
structure length 78
sequence length 78
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3ejeA00
2FAEA 2AF8A 2MR7A 2K94A 2L0QA 2KGDA 2K0YA 2CG5B 4H2WC 4MRTC 1L0HA 2GDWA 2LTEA 1VKUA 4CA3A 2L22A 2KOSA 2LOLA 4DG9A 1DNYA 2KOPA 1NQ4A 5CZDB 2PNGA 1X3OA 4NEOA 4R0MA 3NY7B 5HVCA 2KGAA 2KW2A 2N5HA 2MVVA 2FHSC 2JU1A 2DNWA 2MF4A 2KG6A 2JU2A 2KORA 2MVUA 2N50A 2KG9A 2QNWA 3GZLA 2FADA 1ACPA 2XZ0D 5KP6B 4H2YC 5HV8A 4H2XC 2X2BA 3EJEA 2K93A 2MY5A 2FQ0A 2K92A 1AF8A 2LIUA 2LL8A 2N5IA 2FQ2A 4BPFA 4BPGA 2LMLA 5EJDA 2FVAA 2EHTA 1KLPA 2KOQA 2LIWA 3LMOA 4IZ6A 2KG8A 2FVFA 2VSQA 3EJBA 1L0IA 1DV5A 2N6ZA 3GZMA 2AVAA 2FVEA 2N98A 2KWLA 2MD9A 4PXHB 2KGEA 4BPHA 2LKIA 1F80D 3RG2A 2MR8A 1OR5A 2CNRA 2KR5A 2XZ1C 2ROQA 2CQ8A 2CGQA 2KOOA 2KGCA 2GDXA 2EHSA 2FQ1A 2K2QA 2K0XA 2FACA 2L4BA 3CE7A 2LPKA 2M5RA 2L9FA 4HKGA 5KP7B 2GDYA 2JGPA 2JQ4A 3EJDA 1HQBA 2N6YA 1HY8A 2AFEA 2AFDA 4PWVB 1T8KA 5KP8B
chains in the Genus database with same CATH superfamily
2VLOA 4XROA 1VQOP 4H2WC 2BHVA 3DS5A 2L22A 2PEMA 4U0FA 1UJZA 3U43A 1DNYA 1Z6MA 4WYMA 3B4QA 1KC8Q 2KGAA 1YITP 2N5HA 2GZEA 4PH0A 2N50A 1M90Q 1MZ8A 4U0EA 3GZLA 4F37A 3CC7P 5KP6B 1RNIA 4XFZA 3I55P 2P9XA 2PEKA 2X2BA 3HYBA 2MY5A 1NJIQ 1AF8A 2FQ2A 1IUQA 2PEQA 3CCVP 2QA4P 2EHTA 1KD1Q 3LMOA 1GPJA 1Q7YQ 4PH1A 1K73Q 1QVFO 2VSQA 1L0IA 3GZMA 4GR6A 2FVEA 2LKIA 1QVGO 1K8AQ 2JB0A 3G26A 2CWOA 2MR8A 1OR5A 2XZ1C 1K9MQ 2ONTA 1VQNP 2GZJA 1S72P 1RO2A 2K0XA 2OARA 2LPKA 1W2BO 2JGPA 3EJDA 1YI2P 1EIAA 5F2KA 1IMQA 5KP8B 2JO0A 1M6NA 2K0DX 2QEXP 2AF8A 3H4EA 3E2DA 2L0QA 2K0YA 2CG5B 4MRTC 2GDWA 2LTEA 1YJNP 2LOLA 2NO8A 1NQ4A 4XFYA 2PNGA 3G4SP 3HZQA 5F2NA 4U0BA 1VQ7P 5HGLA 2XXMA 2MVVA 1GXGA 4COCA 2DNWA 2KG6A 2GZFA 3NTEA 3CC2P 1A43A 1VQLP 3CXCO 4H2XC 1UNKA 4IPYA 4IZ6A 3CCEP 1E0HA 1VQPP 1ZNVA 3DS3A 1AUMA 2MD9A 4PXHB 3CCUP 1F80D 2KR5A 3GJNA 2EFJA 2KOOA 3G29A 2LF4A 2GDXA 1M6EX 2FACA 2OTJP 1M74A 2M5RA 4HKGA 2VLQA 4GR2A 3MGEA 2JQ4A 3GKLC 1HQBA 2PENA 2N6YA 1HY8A 1QRJA 1GXHA 2AFDA 3CPWO 1VQMP 1VQKP 4M0IA 4PWVB 5HGOA 2L6EA 1Q81Q 3CMEP 3G28A 2MR7A 2KGDA 2PEIA 3DS1A 3G0VA 1L0HA 1VKUA 2VLPA 3G71P 4CA3A 3OW2O 3G1IA 4DG9A 2KODA 2ERHA 1RO0A 3Q20A 5BS1A 5CZDB 3DPHA 4COPA 1Q86Q 2JBGA 2DGYA 2VLNA 3DS4A 2FHSC 2JU1A 2KORA 1M1KQ 2M8PA 3RG6C 3CC4P 1VQ8P 5HV8A 5HGMA 7CEIA 3EJEA 2XV6A 2LIUA 5JPAA 2LL8A 1VQ4P 4BPGA 2LMLA 5EJDA 3CCJP 2LIWA 4U0CA 1CEIA 2WPTA 2KG8A 1N8RQ 3DTJA 2GZGA 1DV5A 1BXIA 3B5IA 2XT1A 2OTLP 2AVAA 2KWLA 3RG2A 1VHNA 3DS0A 3H47A 2CNRA 2ROQA 2CQ8A 2CGQA 2KGCA 2PEOA 3CCSP 2FQ1A 3CE7A 4QKOA 4XFXA 2M8LA 3CCLP 2GDYA 3G1GA 4UHPB 2Z46A 2FAEA 5HGNA 3CCQP 1YHQP 4U0DA 3DS2A 2K94A 2BUOA 1ZMBA 4XRQA 3LRYA 1Q82Q 2KOSA 2KOPA 5BS2A 5DCKA 1X3OA 1KQSO 3P05A 3I56P 4NEOA 1VQ5P 4R0MA 3NY7B 5HVCA 3CD6P 2K5XA 1EOQA 2KW2A 2M8NA 2MF4A 1BAJA 2JU2A 2MVUA 2JYLA 3G21A 2KG9A 2QNWA 1AYIA 2FADA 3VRLC 1ACPA 2XZ0D 1YJWP 3M1MA 4H2YC 1D1DA 1FR2A 2JYGA 5F2OA 2K93A 2FQ0A 2K92A 2Z45A 2Z44A 2PEJA 5I4TG 1VQ9P 2N5IA 4BPFA 2GYKA 1JJ2O 2FVAA 1KLPA 2KOQA 2GZIA 1A8OA 2PY8A 2FVFA 3EJBA 3G6EP 2N6ZA 2N98A 1YJ9P 4QNBA 1K30A 4BPHA 2KGEA 5EW5E 2E1MA 2JAZA 3CMAP 1E6JP 2EG5A 4U0AA 2EHSA 2K2QA 3CCMP 1EMVA 1VQ6P 2L4BA 3H0DA 1YIJP 2L9FA 3CCRP 5KP7B 1IMPA 2EIAA 2AFEA 3WBHA 1T8KA
chains in the Genus database with same CATH topology
2FAEA 2AF8A 2MR7A 2K94A 2L0QA 2KGDA 2K0YA 2CG5B 4H2WC 4MRTC 1L0HA 2GDWA 2LTEA 1VKUA 4CA3A 2L22A 2KOSA 2LOLA 4DG9A 1DNYA 2KOPA 1NQ4A 5CZDB 2PNGA 1X3OA 4NEOA 4R0MA 3NY7B 5HVCA 2KGAA 2KW2A 2N5HA 2MVVA 2FHSC 2JU1A 2DNWA 2MF4A 2KG6A 2JU2A 2KORA 2MVUA 2N50A 2KG9A 2QNWA 3GZLA 2FADA 1ACPA 2XZ0D 5KP6B 4H2YC 5HV8A 4H2XC 2X2BA 3EJEA 2K93A 2MY5A 2FQ0A 2K92A 1AF8A 2LIUA 2LL8A 2N5IA 2FQ2A 4BPFA 4BPGA 2LMLA 5EJDA 2FVAA 2EHTA 1KLPA 2KOQA 2LIWA 3LMOA 4IZ6A 2KG8A 2FVFA 2VSQA 3EJBA 1L0IA 1DV5A 2N6ZA 3GZMA 2AVAA 2FVEA 2N98A 2KWLA 2MD9A 4PXHB 2KGEA 4BPHA 2LKIA 1F80D 3RG2A 2MR8A 1OR5A 2CNRA 2KR5A 2XZ1C 2ROQA 2CQ8A 2CGQA 2KOOA 2KGCA 2GDXA 2EHSA 2FQ1A 2K2QA 2K0XA 2FACA 2L4BA 3CE7A 2LPKA 2M5RA 2L9FA 4HKGA 5KP7B 2GDYA 2JGPA 2JQ4A 3EJDA 1HQBA 2N6YA 1HY8A 2AFEA 2AFDA 4PWVB 1T8KA 5KP8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAE A;  2AF8 A;  2MR7 A;  2K94 A;  2L0Q A;  2KGD A;  2K0Y A;  2CG5 B;  4H2W C;  4MRT C;  1L0H A;  2GDW A;  2LTE A;  1VKU A;  4CA3 A;  2L22 A;  2KOS A;  2LOL A;  4DG9 A;  1DNY A;  2KOP A;  1NQ4 A;  5CZD B;  2PNG A;  1X3O A;  4NEO A;  4R0M A;  3NY7 B;  5HVC A;  2KGA A;  2KW2 A;  2N5H A;  2MVV A;  2FHS C;  2JU1 A;  2DNW A;  2MF4 A;  2KG6 A;  2JU2 A;  2KOR A;  2MVU A;  2N50 A;  2KG9 A;  2QNW A;  3GZL A;  2FAD A;  1ACP A;  2XZ0 D;  5KP6 B;  4H2Y C;  5HV8 A;  4H2X C;  2X2B A;  3EJE A;  2K93 A;  2MY5 A;  2FQ0 A;  2K92 A;  1AF8 A;  2LIU A;  2LL8 A;  2N5I A;  2FQ2 A;  4BPF A;  4BPG A;  2LML A;  5EJD A;  2FVA A;  2EHT A;  1KLP A;  2KOQ A;  2LIW A;  3LMO A;  4IZ6 A;  2KG8 A;  2FVF A;  2VSQ A;  3EJB A;  1L0I A;  1DV5 A;  2N6Z A;  3GZM A;  2AVA A;  2FVE A;  2N98 A;  2KWL A;  2MD9 A;  4PXH B;  2KGE A;  4BPH A;  2LKI A;  1F80 D;  3RG2 A;  2MR8 A;  1OR5 A;  2CNR A;  2KR5 A;  2XZ1 C;  2ROQ A;  2CQ8 A;  2CGQ A;  2KOO A;  2KGC A;  2GDX A;  2EHS A;  2FQ1 A;  2K2Q A;  2K0X A;  2FAC A;  2L4B A;  3CE7 A;  2LPK A;  2M5R A;  2L9F A;  4HKG A;  5KP7 B;  2GDY A;  2JGP A;  2JQ4 A;  3EJD A;  1HQB A;  2N6Y A;  1HY8 A;  2AFE A;  2AFD A;  4PWV B;  1T8K A;  5KP8 B; 
#chains in the Genus database with same CATH topology
 2VLO A;  4XRO A;  1VQO P;  4H2W C;  2BHV A;  3DS5 A;  2L22 A;  2PEM A;  4U0F A;  1UJZ A;  3U43 A;  1DNY A;  1Z6M A;  4WYM A;  3B4Q A;  1KC8 Q;  2KGA A;  1YIT P;  2N5H A;  2GZE A;  4PH0 A;  2N50 A;  1M90 Q;  1MZ8 A;  4U0E A;  3GZL A;  4F37 A;  3CC7 P;  5KP6 B;  1RNI A;  4XFZ A;  3I55 P;  2P9X A;  2PEK A;  2X2B A;  3HYB A;  2MY5 A;  1NJI Q;  1AF8 A;  2FQ2 A;  1IUQ A;  2PEQ A;  3CCV P;  2QA4 P;  2EHT A;  1KD1 Q;  3LMO A;  1GPJ A;  1Q7Y Q;  4PH1 A;  1K73 Q;  1QVF O;  2VSQ A;  1L0I A;  3GZM A;  4GR6 A;  2FVE A;  2LKI A;  1QVG O;  1K8A Q;  2JB0 A;  3G26 A;  2CWO A;  2MR8 A;  1OR5 A;  2XZ1 C;  1K9M Q;  2ONT A;  1VQN P;  2GZJ A;  1S72 P;  1RO2 A;  2K0X A;  2OAR A;  2LPK A;  1W2B O;  2JGP A;  3EJD A;  1YI2 P;  1EIA A;  5F2K A;  1IMQ A;  5KP8 B;  2JO0 A;  1M6N A;  2K0D X;  2QEX P;  2AF8 A;  3H4E A;  3E2D A;  2L0Q A;  2K0Y A;  2CG5 B;  4MRT C;  2GDW A;  2LTE A;  1YJN P;  2LOL A;  2NO8 A;  1NQ4 A;  4XFY A;  2PNG A;  3G4S P;  3HZQ A;  5F2N A;  4U0B A;  1VQ7 P;  5HGL A;  2XXM A;  2MVV A;  1GXG A;  4COC A;  2DNW A;  2KG6 A;  2GZF A;  3NTE A;  3CC2 P;  1A43 A;  1VQL P;  3CXC O;  4H2X C;  1UNK A;  4IPY A;  4IZ6 A;  3CCE P;  1E0H A;  1VQP P;  1ZNV A;  3DS3 A;  1AUM A;  2MD9 A;  4PXH B;  3CCU P;  1F80 D;  2KR5 A;  3GJN A;  2EFJ A;  2KOO A;  3G29 A;  2LF4 A;  2GDX A;  1M6E X;  2FAC A;  2OTJ P;  1M74 A;  2M5R A;  4HKG A;  2VLQ A;  4GR2 A;  3MGE A;  2JQ4 A;  3GKL C;  1HQB A;  2PEN A;  2N6Y A;  1HY8 A;  1QRJ A;  1GXH A;  2AFD A;  3CPW O;  1VQM P;  1VQK P;  4M0I A;  4PWV B;  5HGO A;  2L6E A;  1Q81 Q;  3CME P;  3G28 A;  2MR7 A;  2KGD A;  2PEI A;  3DS1 A;  3G0V A;  1L0H A;  1VKU A;  2VLP A;  3G71 P;  4CA3 A;  3OW2 O;  3G1I A;  4DG9 A;  2KOD A;  2ERH A;  1RO0 A;  3Q20 A;  5BS1 A;  5CZD B;  3DPH A;  4COP A;  1Q86 Q;  2JBG A;  2DGY A;  2VLN A;  3DS4 A;  2FHS C;  2JU1 A;  2KOR A;  1M1K Q;  2M8P A;  3RG6 C;  3CC4 P;  1VQ8 P;  5HV8 A;  5HGM A;  7CEI A;  3EJE A;  2XV6 A;  2LIU A;  5JPA A;  2LL8 A;  1VQ4 P;  4BPG A;  2LML A;  5EJD A;  3CCJ P;  2LIW A;  4U0C A;  1CEI A;  2WPT A;  2KG8 A;  1N8R Q;  3DTJ A;  2GZG A;  1DV5 A;  1BXI A;  3B5I A;  2XT1 A;  2OTL P;  2AVA A;  2KWL A;  3RG2 A;  1VHN A;  3DS0 A;  3H47 A;  2CNR A;  2ROQ A;  2CQ8 A;  2CGQ A;  2KGC A;  2PEO A;  3CCS P;  2FQ1 A;  3CE7 A;  4QKO A;  4XFX A;  2M8L A;  3CCL P;  2GDY A;  3G1G A;  4UHP B;  2Z46 A;  2FAE A;  5HGN A;  3CCQ P;  1YHQ P;  4U0D A;  3DS2 A;  2K94 A;  2BUO A;  1ZMB A;  4XRQ A;  3LRY A;  1Q82 Q;  2KOS A;  2KOP A;  5BS2 A;  5DCK A;  1X3O A;  1KQS O;  3P05 A;  3I56 P;  4NEO A;  1VQ5 P;  4R0M A;  3NY7 B;  5HVC A;  3CD6 P;  2K5X A;  1EOQ A;  2KW2 A;  2M8N A;  2MF4 A;  1BAJ A;  2JU2 A;  2MVU A;  2JYL A;  3G21 A;  2KG9 A;  2QNW A;  1AYI A;  2FAD A;  3VRL C;  1ACP A;  2XZ0 D;  1YJW P;  3M1M A;  4H2Y C;  1D1D A;  1FR2 A;  2JYG A;  5F2O A;  2K93 A;  2FQ0 A;  2K92 A;  2Z45 A;  2Z44 A;  2PEJ A;  5I4T G;  1VQ9 P;  2N5I A;  4BPF A;  2GYK A;  1JJ2 O;  2FVA A;  1KLP A;  2KOQ A;  2GZI A;  1A8O A;  2PY8 A;  2FVF A;  3EJB A;  3G6E P;  2N6Z A;  2N98 A;  1YJ9 P;  4QNB A;  1K30 A;  4BPH A;  2KGE A;  5EW5 E;  2E1M A;  2JAZ A;  3CMA P;  1E6J P;  2EG5 A;  4U0A A;  2EHS A;  2K2Q A;  3CCM P;  1EMV A;  1VQ6 P;  2L4B A;  3H0D A;  1YIJ P;  2L9F A;  3CCR P;  5KP7 B;  1IMP A;  2EIA A;  2AFE A;  3WBH A;  1T8K A; 
#chains in the Genus database with same CATH homology
 2FAE A;  2AF8 A;  2MR7 A;  2K94 A;  2L0Q A;  2KGD A;  2K0Y A;  2CG5 B;  4H2W C;  4MRT C;  1L0H A;  2GDW A;  2LTE A;  1VKU A;  4CA3 A;  2L22 A;  2KOS A;  2LOL A;  4DG9 A;  1DNY A;  2KOP A;  1NQ4 A;  5CZD B;  2PNG A;  1X3O A;  4NEO A;  4R0M A;  3NY7 B;  5HVC A;  2KGA A;  2KW2 A;  2N5H A;  2MVV A;  2FHS C;  2JU1 A;  2DNW A;  2MF4 A;  2KG6 A;  2JU2 A;  2KOR A;  2MVU A;  2N50 A;  2KG9 A;  2QNW A;  3GZL A;  2FAD A;  1ACP A;  2XZ0 D;  5KP6 B;  4H2Y C;  5HV8 A;  4H2X C;  2X2B A;  3EJE A;  2K93 A;  2MY5 A;  2FQ0 A;  2K92 A;  1AF8 A;  2LIU A;  2LL8 A;  2N5I A;  2FQ2 A;  4BPF A;  4BPG A;  2LML A;  5EJD A;  2FVA A;  2EHT A;  1KLP A;  2KOQ A;  2LIW A;  3LMO A;  4IZ6 A;  2KG8 A;  2FVF A;  2VSQ A;  3EJB A;  1L0I A;  1DV5 A;  2N6Z A;  3GZM A;  2AVA A;  2FVE A;  2N98 A;  2KWL A;  2MD9 A;  4PXH B;  2KGE A;  4BPH A;  2LKI A;  1F80 D;  3RG2 A;  2MR8 A;  1OR5 A;  2CNR A;  2KR5 A;  2XZ1 C;  2ROQ A;  2CQ8 A;  2CGQ A;  2KOO A;  2KGC A;  2GDX A;  2EHS A;  2FQ1 A;  2K2Q A;  2K0X A;  2FAC A;  2L4B A;  3CE7 A;  2LPK A;  2M5R A;  2L9F A;  4HKG A;  5KP7 B;  2GDY A;  2JGP A;  2JQ4 A;  3EJD A;  1HQB A;  2N6Y A;  1HY8 A;  2AFE A;  2AFD A;  4PWV B;  1T8K A;  5KP8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...