3EJEA

Crystal structure of p450bioi in complex with octadec-9z-enoic acid ligated acyl carrier protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
78
structure length
78
Chain Sequence
SHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/lipid transport
molecule keywords Acyl carrier protein
publication title Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 22
structure length 78
sequence length 78
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3ejeA00
2MD9A 2JU1A 2N5HA 2VSQA 2KG6A 4CA3A 2PNGA 1HY8A 2AF8A 2LTEA 5KP6B 2AFDA 2DNWA 4NEOA 5HVCA 2LIWA 2MF4A 4H2XC 2JQ4A 3CE7A 2GDXA 4PXHB 2KORA 1L0HA 4IZ6A 3EJDA 4H2YC 3GZLA 4H2WC 1DV5A 2KW2A 2N98A 2K93A 2CG5B 2LPKA 2FQ0A 4MRTC 2N6YA 2JGPA 1NQ4A 2CGQA 1X3OA 2EHSA 4BPFA 2L4BA 2N6ZA 2K92A 4BPGA 2N5IA 2L9FA 2KG9A 5EJDA 2FADA 2KOOA 2XZ0D 1ACPA 1KLPA 1OR5A 1F80D 2FVFA 2XZ1C 2LKIA 2MVUA 2KGAA 2QNWA 5KP7B 2X2BA 2LMLA 3GZMA 2MR8A 2MY5A 4PWVB 2KGCA 2KWLA 5CZDB 2K0XA 2EHTA 2FVAA 2GDWA 1HQBA 4HKGA 4BPHA 2AFEA 2KG8A 2KGEA 1DNYA 2LIUA 2MR7A 5HV8A 3LMOA 2AVAA 2M5RA 2JU2A 5KP8B 2FVEA 2LL8A 2ROQA 2KR5A 3RG2A 2FQ2A 4DG9A 1AF8A 2L0QA 2FQ1A 2KOQA 2LOLA 2MVVA 3EJBA 2CNRA 2KGDA 2N50A 1T8KA 1VKUA 2FHSC 3NY7B 2FACA 2KOPA 2K0YA 2KOSA 4R0MA 2GDYA 2L22A 2CQ8A 2K94A 1L0IA 2FAEA 3EJEA 2K2QA
chains in the Genus database with same CATH superfamily
2JU1A 1YITP 1Q81Q 3G0VA 1HY8A 1BXIA 2K0DX 2AFDA 2DNWA 2EG5A 1YJNP 2XT1A 1K8AQ 4XFXA 2MF4A 2GZJA 2Z46A 2BHVA 3G1GA 1VQ7P 2M8NA 3B5IA 2KORA 3CCUP 2P9XA 1YI2P 1GXHA 1IMPA 2K93A 2CG5B 4UHPB 2Z44A 5F2KA 2CGQA 1KC8Q 1VQ5P 2OTJP 1QVGO 1AYIA 2L9FA 3GKLC 4QKOA 4COPA 2M8LA 5EJDA 5EW5E 3G4SP 2XZ0D 1ACPA 1OR5A 2FVFA 1GXGA 1ZMBA 2KGAA 1K30A 2MR8A 2PEQA 3DPHA 2GZIA 3CCJP 3DS1A 4XFYA 2EIAA 4BPHA 2AFEA 3H4EA 2ONTA 2MR7A 5HGLA 3LMOA 1GPJA 3G29A 1S72P 4DG9A 1AF8A 2PEIA 7CEIA 1D1DA 3E2DA 3DTJA 4XFZA 3H47A 4COCA 2FACA 2M8PA 2KOSA 2GDYA 2OTLP 2GZEA 1M90Q 3EJEA 5JPAA 2N5HA 2ERHA 5DCKA 3CCMP 2AF8A 2LTEA 3DS0A 4H2XC 2PENA 2GDXA 2VLPA 4H2YC 4H2WC 1DV5A 1VQ4P 3Q20A 2N98A 1IMQA 3OW2O 1QVFO 2FQ0A 3HYBA 2JGPA 1NQ4A 1M6NA 1W2BO 2K92A 3DS5A 4BPGA 5HGOA 1VQLP 1KQSO 3CCQP 2KG9A 2GZGA 3CCRP 1KLPA 1F80D 3G1IA 1YJ9P 2E1MA 4GR6A 2LKIA 1VHNA 3G21A 2LMLA 3CC4P 3G71P 1YJWP 2K0XA 2EHTA 2FVAA 2GDWA 3I55P 2KG8A 2VLOA 4U0AA 1M1KQ 1JJ2O 1UNKA 2LL8A 3CCSP 2Z45A 1VQ6P 2MVVA 1EMVA 1T8KA 1RNIA 1VKUA 2K2QA 2JAZA 2NO8A 2FHSC 2KOPA 2QEXP 2XXMA 1IUQA 2JYGA 3G28A 2FAEA 5HGMA 3H0DA 4QNBA 2MD9A 1Q86Q 2VSQA 1K73Q 2PNGA 2LIWA 1AUMA 1QRJA 1VQPP 1ZNVA 2PY8A 1MZ8A 1L0HA 2PEOA 3EJDA 2WPTA 2KW2A 2KODA 4MRTC 4U0BA 3RG6C 1X3OA 4BPFA 2N6ZA 1E6JP 3CXCO 2FADA 2KOOA 2XZ1C 2MVUA 2PEMA 2L6EA 1EOQA 3CCLP 3GZMA 3CCVP 2MY5A 2KGCA 2KWLA 1VQNP 5HV8A 2JU2A 4F37A 2FVEA 3WBHA 5BS2A 3NTEA 2JYLA 1Q7YQ 2CNRA 2KGDA 2N50A 5BS1A 2JB0A 2CWOA 1E0HA 4U0CA 2K0YA 1K9MQ 2GZFA 2L22A 1M6EX 2CQ8A 2K94A 1L0IA 1BAJA 3DS2A 5F2OA 4U0DA 2LF4A 2KG6A 3DS4A 4PH0A 3HZQA 2VLQA 4WYMA 4CA3A 1YHQP 3G26A 2OARA 5KP6B 1EIAA 3MGEA 2QA4P 4NEOA 5HVCA 3CMEP 3CMAP 2GYKA 2JQ4A 1A8OA 2VLNA 3CE7A 1VQKP 3CC2P 4PXHB 1RO2A 4IZ6A 5F2NA 1VQ8P 3GZLA 5I4TG 2PEJA 1N8RQ 4GR2A 2LPKA 4IPYA 2N6YA 3CCEP 3VRLC 2JO0A 3LRYA 3I56P 2BUOA 5HGNA 2EHSA 1FR2A 2L4BA 2N5IA 2K5XA 1CEIA 4U0FA 1Q82Q 1KD1Q 3DS3A 1VQOP 2QNWA 1M74A 2X2BA 3P05A 5KP7B 2PEKA 3CC7P 4PWVB 3B4QA 1VQ9P 3CPWO 4U0EA 4HKGA 1HQBA 4XROA 2KGEA 1DNYA 2LIUA 3M1MA 2EFJA 2AVAA 2M5RA 5KP8B 1YIJP 2ROQA 2KR5A 3RG2A 2FQ2A 3U43A 4M0IA 3G6EP 2L0QA 2FQ1A 2KOQA 2LOLA 1A43A 3EJBA 1NJIQ 2DGYA 4XRQA 2XV6A 2JBGA 1VQMP 3NY7B 3CD6P 1UJZA 4PH1A 4R0MA 1RO0A 1Z6MA 3GJNA 5CZDB
chains in the Genus database with same CATH topology
2MD9A 2JU1A 2N5HA 2VSQA 2KG6A 4CA3A 2PNGA 1HY8A 2AF8A 2LTEA 5KP6B 2AFDA 2DNWA 4NEOA 5HVCA 2LIWA 2MF4A 4H2XC 2JQ4A 3CE7A 2GDXA 4PXHB 2KORA 1L0HA 4IZ6A 3EJDA 4H2YC 3GZLA 4H2WC 1DV5A 2KW2A 2N98A 2K93A 2CG5B 2LPKA 2FQ0A 4MRTC 2N6YA 2JGPA 1NQ4A 2CGQA 1X3OA 2EHSA 4BPFA 2L4BA 2N6ZA 2K92A 4BPGA 2N5IA 2L9FA 2KG9A 5EJDA 2FADA 2KOOA 2XZ0D 1ACPA 1KLPA 1OR5A 1F80D 2FVFA 2XZ1C 2LKIA 2MVUA 2KGAA 2QNWA 5KP7B 2X2BA 2LMLA 3GZMA 2MR8A 2MY5A 4PWVB 2KGCA 2KWLA 5CZDB 2K0XA 2EHTA 2FVAA 2GDWA 1HQBA 4HKGA 4BPHA 2AFEA 2KG8A 2KGEA 1DNYA 2LIUA 2MR7A 5HV8A 3LMOA 2AVAA 2M5RA 2JU2A 5KP8B 2FVEA 2LL8A 2ROQA 2KR5A 3RG2A 2FQ2A 4DG9A 1AF8A 2L0QA 2FQ1A 2KOQA 2LOLA 2MVVA 3EJBA 2CNRA 2KGDA 2N50A 1T8KA 1VKUA 2FHSC 3NY7B 2FACA 2KOPA 2K0YA 2KOSA 4R0MA 2GDYA 2L22A 2CQ8A 2K94A 1L0IA 2FAEA 3EJEA 2K2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MD9 A;  2JU1 A;  2N5H A;  2VSQ A;  2KG6 A;  4CA3 A;  2PNG A;  1HY8 A;  2AF8 A;  2LTE A;  5KP6 B;  2AFD A;  2DNW A;  4NEO A;  5HVC A;  2LIW A;  2MF4 A;  4H2X C;  2JQ4 A;  3CE7 A;  2GDX A;  4PXH B;  2KOR A;  1L0H A;  4IZ6 A;  3EJD A;  4H2Y C;  3GZL A;  4H2W C;  1DV5 A;  2KW2 A;  2N98 A;  2K93 A;  2CG5 B;  2LPK A;  2FQ0 A;  4MRT C;  2N6Y A;  2JGP A;  1NQ4 A;  2CGQ A;  1X3O A;  2EHS A;  4BPF A;  2L4B A;  2N6Z A;  2K92 A;  4BPG A;  2N5I A;  2L9F A;  2KG9 A;  5EJD A;  2FAD A;  2KOO A;  2XZ0 D;  1ACP A;  1KLP A;  1OR5 A;  1F80 D;  2FVF A;  2XZ1 C;  2LKI A;  2MVU A;  2KGA A;  2QNW A;  5KP7 B;  2X2B A;  2LML A;  3GZM A;  2MR8 A;  2MY5 A;  4PWV B;  2KGC A;  2KWL A;  5CZD B;  2K0X A;  2EHT A;  2FVA A;  2GDW A;  1HQB A;  4HKG A;  4BPH A;  2AFE A;  2KG8 A;  2KGE A;  1DNY A;  2LIU A;  2MR7 A;  5HV8 A;  3LMO A;  2AVA A;  2M5R A;  2JU2 A;  5KP8 B;  2FVE A;  2LL8 A;  2ROQ A;  2KR5 A;  3RG2 A;  2FQ2 A;  4DG9 A;  1AF8 A;  2L0Q A;  2FQ1 A;  2KOQ A;  2LOL A;  2MVV A;  3EJB A;  2CNR A;  2KGD A;  2N50 A;  1T8K A;  1VKU A;  2FHS C;  3NY7 B;  2FAC A;  2KOP A;  2K0Y A;  2KOS A;  4R0M A;  2GDY A;  2L22 A;  2CQ8 A;  2K94 A;  1L0I A;  2FAE A;  3EJE A;  2K2Q A; 
#chains in the Genus database with same CATH topology
 2JU1 A;  1YIT P;  1Q81 Q;  3G0V A;  1HY8 A;  1BXI A;  2K0D X;  2AFD A;  2DNW A;  2EG5 A;  1YJN P;  2XT1 A;  1K8A Q;  4XFX A;  2MF4 A;  2GZJ A;  2Z46 A;  2BHV A;  3G1G A;  1VQ7 P;  2M8N A;  3B5I A;  2KOR A;  3CCU P;  2P9X A;  1YI2 P;  1GXH A;  1IMP A;  2K93 A;  2CG5 B;  4UHP B;  2Z44 A;  5F2K A;  2CGQ A;  1KC8 Q;  1VQ5 P;  2OTJ P;  1QVG O;  1AYI A;  2L9F A;  3GKL C;  4QKO A;  4COP A;  2M8L A;  5EJD A;  5EW5 E;  3G4S P;  2XZ0 D;  1ACP A;  1OR5 A;  2FVF A;  1GXG A;  1ZMB A;  2KGA A;  1K30 A;  2MR8 A;  2PEQ A;  3DPH A;  2GZI A;  3CCJ P;  3DS1 A;  4XFY A;  2EIA A;  4BPH A;  2AFE A;  3H4E A;  2ONT A;  2MR7 A;  5HGL A;  3LMO A;  1GPJ A;  3G29 A;  1S72 P;  4DG9 A;  1AF8 A;  2PEI A;  7CEI A;  1D1D A;  3E2D A;  3DTJ A;  4XFZ A;  3H47 A;  4COC A;  2FAC A;  2M8P A;  2KOS A;  2GDY A;  2OTL P;  2GZE A;  1M90 Q;  3EJE A;  5JPA A;  2N5H A;  2ERH A;  5DCK A;  3CCM P;  2AF8 A;  2LTE A;  3DS0 A;  4H2X C;  2PEN A;  2GDX A;  2VLP A;  4H2Y C;  4H2W C;  1DV5 A;  1VQ4 P;  3Q20 A;  2N98 A;  1IMQ A;  3OW2 O;  1QVF O;  2FQ0 A;  3HYB A;  2JGP A;  1NQ4 A;  1M6N A;  1W2B O;  2K92 A;  3DS5 A;  4BPG A;  5HGO A;  1VQL P;  1KQS O;  3CCQ P;  2KG9 A;  2GZG A;  3CCR P;  1KLP A;  1F80 D;  3G1I A;  1YJ9 P;  2E1M A;  4GR6 A;  2LKI A;  1VHN A;  3G21 A;  2LML A;  3CC4 P;  3G71 P;  1YJW P;  2K0X A;  2EHT A;  2FVA A;  2GDW A;  3I55 P;  2KG8 A;  2VLO A;  4U0A A;  1M1K Q;  1JJ2 O;  1UNK A;  2LL8 A;  3CCS P;  2Z45 A;  1VQ6 P;  2MVV A;  1EMV A;  1T8K A;  1RNI A;  1VKU A;  2K2Q A;  2JAZ A;  2NO8 A;  2FHS C;  2KOP A;  2QEX P;  2XXM A;  1IUQ A;  2JYG A;  3G28 A;  2FAE A;  5HGM A;  3H0D A;  4QNB A;  2MD9 A;  1Q86 Q;  2VSQ A;  1K73 Q;  2PNG A;  2LIW A;  1AUM A;  1QRJ A;  1VQP P;  1ZNV A;  2PY8 A;  1MZ8 A;  1L0H A;  2PEO A;  3EJD A;  2WPT A;  2KW2 A;  2KOD A;  4MRT C;  4U0B A;  3RG6 C;  1X3O A;  4BPF A;  2N6Z A;  1E6J P;  3CXC O;  2FAD A;  2KOO A;  2XZ1 C;  2MVU A;  2PEM A;  2L6E A;  1EOQ A;  3CCL P;  3GZM A;  3CCV P;  2MY5 A;  2KGC A;  2KWL A;  1VQN P;  5HV8 A;  2JU2 A;  4F37 A;  2FVE A;  3WBH A;  5BS2 A;  3NTE A;  2JYL A;  1Q7Y Q;  2CNR A;  2KGD A;  2N50 A;  5BS1 A;  2JB0 A;  2CWO A;  1E0H A;  4U0C A;  2K0Y A;  1K9M Q;  2GZF A;  2L22 A;  1M6E X;  2CQ8 A;  2K94 A;  1L0I A;  1BAJ A;  3DS2 A;  5F2O A;  4U0D A;  2LF4 A;  2KG6 A;  3DS4 A;  4PH0 A;  3HZQ A;  2VLQ A;  4WYM A;  4CA3 A;  1YHQ P;  3G26 A;  2OAR A;  5KP6 B;  1EIA A;  3MGE A;  2QA4 P;  4NEO A;  5HVC A;  3CME P;  3CMA P;  2GYK A;  2JQ4 A;  1A8O A;  2VLN A;  3CE7 A;  1VQK P;  3CC2 P;  4PXH B;  1RO2 A;  4IZ6 A;  5F2N A;  1VQ8 P;  3GZL A;  5I4T G;  2PEJ A;  1N8R Q;  4GR2 A;  2LPK A;  4IPY A;  2N6Y A;  3CCE P;  3VRL C;  2JO0 A;  3LRY A;  3I56 P;  2BUO A;  5HGN A;  2EHS A;  1FR2 A;  2L4B A;  2N5I A;  2K5X A;  1CEI A;  4U0F A;  1Q82 Q;  1KD1 Q;  3DS3 A;  1VQO P;  2QNW A;  1M74 A;  2X2B A;  3P05 A;  5KP7 B;  2PEK A;  3CC7 P;  4PWV B;  3B4Q A;  1VQ9 P;  3CPW O;  4U0E A;  4HKG A;  1HQB A;  4XRO A;  2KGE A;  1DNY A;  2LIU A;  3M1M A;  2EFJ A;  2AVA A;  2M5R A;  5KP8 B;  1YIJ P;  2ROQ A;  2KR5 A;  3RG2 A;  2FQ2 A;  3U43 A;  4M0I A;  3G6E P;  2L0Q A;  2FQ1 A;  2KOQ A;  2LOL A;  1A43 A;  3EJB A;  1NJI Q;  2DGY A;  4XRQ A;  2XV6 A;  2JBG A;  1VQM P;  3NY7 B;  3CD6 P;  1UJZ A;  4PH1 A;  4R0M A;  1RO0 A;  1Z6M A;  3GJN A;  5CZD B; 
#chains in the Genus database with same CATH homology
 2MD9 A;  2JU1 A;  2N5H A;  2VSQ A;  2KG6 A;  4CA3 A;  2PNG A;  1HY8 A;  2AF8 A;  2LTE A;  5KP6 B;  2AFD A;  2DNW A;  4NEO A;  5HVC A;  2LIW A;  2MF4 A;  4H2X C;  2JQ4 A;  3CE7 A;  2GDX A;  4PXH B;  2KOR A;  1L0H A;  4IZ6 A;  3EJD A;  4H2Y C;  3GZL A;  4H2W C;  1DV5 A;  2KW2 A;  2N98 A;  2K93 A;  2CG5 B;  2LPK A;  2FQ0 A;  4MRT C;  2N6Y A;  2JGP A;  1NQ4 A;  2CGQ A;  1X3O A;  2EHS A;  4BPF A;  2L4B A;  2N6Z A;  2K92 A;  4BPG A;  2N5I A;  2L9F A;  2KG9 A;  5EJD A;  2FAD A;  2KOO A;  2XZ0 D;  1ACP A;  1KLP A;  1OR5 A;  1F80 D;  2FVF A;  2XZ1 C;  2LKI A;  2MVU A;  2KGA A;  2QNW A;  5KP7 B;  2X2B A;  2LML A;  3GZM A;  2MR8 A;  2MY5 A;  4PWV B;  2KGC A;  2KWL A;  5CZD B;  2K0X A;  2EHT A;  2FVA A;  2GDW A;  1HQB A;  4HKG A;  4BPH A;  2AFE A;  2KG8 A;  2KGE A;  1DNY A;  2LIU A;  2MR7 A;  5HV8 A;  3LMO A;  2AVA A;  2M5R A;  2JU2 A;  5KP8 B;  2FVE A;  2LL8 A;  2ROQ A;  2KR5 A;  3RG2 A;  2FQ2 A;  4DG9 A;  1AF8 A;  2L0Q A;  2FQ1 A;  2KOQ A;  2LOL A;  2MVV A;  3EJB A;  2CNR A;  2KGD A;  2N50 A;  1T8K A;  1VKU A;  2FHS C;  3NY7 B;  2FAC A;  2KOP A;  2K0Y A;  2KOS A;  4R0M A;  2GDY A;  2L22 A;  2CQ8 A;  2K94 A;  1L0I A;  2FAE A;  3EJE A;  2K2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...