3EJEA

Crystal structure of p450bioi in complex with octadec-9z-enoic acid ligated acyl carrier protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
78
structure length
78
Chain Sequence
SHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/lipid transport
total genus 22
structure length 78
sequence length 78
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3ejeA00
2K93A 5HVCA 4CA3A 2AVAA 2XZ1C 2L0QA 3LMOA 5CZDB 1L0HA 2MVUA 3NY7B 4H2WC 4PWVB 4DG9A 2MVVA 2N5IA 2N98A 3GZMA 1ACPA 2FHSC 2KG6A 2L4BA 4IZ6A 2KOPA 2KGEA 2KW2A 2KORA 5HV8A 1DV5A 2MY5A 2N6ZA 2FACA 2JU1A 2LMLA 1L0IA 2CGQA 3EJDA 2K2QA 2LIUA 5EJDA 3CE7A 2KGAA 2FVEA 2VSQA 4BPGA 2AF8A 2X2BA 1T8KA 2LIWA 4BPHA 2DNWA 2FQ2A 3EJBA 3EJEA 1HY8A 3GZLA 4HKGA 4NEOA 2CG5B 2FVAA 2FQ0A 2PNGA 2JGPA 4H2XC 4H2YC 2CQ8A 2K92A 2AFDA 1VKUA 2KG9A 4PXHB 2K0YA 2FVFA 2LOLA 2N5HA 1HQBA 2L9FA 4R0MA 2MD9A 2CNRA 1X3OA 2GDWA 2K0XA 2FAEA 2GDYA 2MR8A 2XZ0D 2ROQA 2EHSA 2LTEA 1AF8A 2LL8A 3RG2A 2K94A 2KGCA 2KOSA 2N50A 1NQ4A 2QNWA 1DNYA 4BPFA 2MR7A 2KOQA 1KLPA 2L22A 5KP8B 2KGDA 4MRTC 2LKIA 2KR5A 2FADA 2JQ4A 1F80D 5KP7B 1OR5A 5KP6B 2GDXA 2N6YA 2FQ1A 2AFEA 2KOOA 2KG8A 2LPKA 2JU2A 2MF4A 2KWLA 2M5RA 2EHTA
chains in the Genus database with same CATH superfamily
2K93A 4XFXA 4XFZA 4U0EA 3CCMP 1ZNVA 4XFYA 2VLQA 2AVAA 3G1IA 2CWOA 2PEJA 4H2WC 2JYLA 1A8OA 3WBHA 2KG6A 1VQ6P 5HGLA 4F37A 1VQLP 4U0AA 2MY5A 3CCUP 3B5IA 2FACA 1L0IA 1GPJA 2K2QA 2LIUA 1QRJA 4U0BA 2OTLP 1UJZA 2VSQA 2P9XA 2AF8A 2ONTA 2LIWA 3GJNA 2PY8A 4BPHA 2EIAA 2FQ2A 1VQKP 2K5XA 4NEOA 2FVAA 1EMVA 3LRYA 1Q7YQ 1VKUA 1VQNP 3DTJA 2LOLA 1YJ9P 2MD9A 2GDWA 1X3OA 3H47A 2FAEA 2GDYA 4XROA 2XZ0D 1EIAA 2EHSA 1CEIA 1AF8A 2PENA 4UHPB 3HZQA 3M1MA 3CC2P 3CCRP 2KGCA 1NQ4A 2GZEA 1S72P 2L22A 1YI2P 2XT1A 5BS1A 2OTJP 2BHVA 4COPA 2GDXA 1FR2A 3CCVP 4QNBA 2QEXP 2AFEA 2KOOA 2JU2A 4U0DA 4PH1A 5HVCA 2XZ1C 2PEMA 2L0QA 1L0HA 3H0DA 4DG9A 1K73Q 2N5IA 3GZMA 1ACPA 3U43A 1N8RQ 1VQ8P 1A43A 2L4BA 5F2OA 1YJWP 3CCEP 2M8PA 1GXGA 3B4QA 2M8NA 1DV5A 2OARA 1KQSO 1VQ5P 1VQ4P 2JU1A 1VQOP 5EJDA 3Q20A 2KGAA 3DS5A 1KD1Q 5DCKA 2X2BA 3G4SP 3G1GA 1AYIA 1YITP 3CCJP 2DNWA 3P05A 3EJBA 2EFJA 2EG5A 3EJEA 1YIJP 3DS4A 1E0HA 1Q82Q 1M74A 1RO2A 3VRLC 4H2XC 1W2BO 4M0IA 2L6EA 2L9FA 2JAZA 2CNRA 2MR8A 3RG6C 1K8AQ 1VQ7P 2LL8A 3RG2A 1QVGO 2KOSA 2QNWA 4MRTC 2LKIA 2FADA 2JQ4A 1VQMP 5KP6B 2Z46A 1K9MQ 2FQ1A 4XRQA 3CD6P 2LPKA 2MF4A 2JB0A 3CCSP 1D1DA 1VQPP 1GXHA 2GYKA 4CA3A 5F2KA 2JYGA 2PEOA 2Z45A 3LMOA 5CZDB 2PEIA 3NY7B 2ERHA 1IMQA 3I56P 2N98A 2XV6A 2E1MA 3G71P 4IZ6A 1K30A 3CXCO 2KOPA 3GKLC 5EW5E 2JBGA 1M1KQ 3EJDA 1EOQA 4WYMA 3DS3A 3CC4P 3G6EP 2FVEA 1AUMA 4BPGA 4QKOA 1IUQA 1KC8Q 5HGOA 3OW2O 3GZLA 1HY8A 3G29A 4HKGA 3CC7P 1M6NA 2PEKA 2JGPA 2K92A 4U0CA 3MGEA 2KG9A 1JJ2O 3G28A 2N5HA 2K0XA 3DS0A 2ROQA 4COCA 2LTEA 1ZMBA 2M8LA 1IMPA 2VLNA 2K94A 3DPHA 2PEQA 1DNYA 2NO8A 2MR7A 4BPFA 2KOQA 5KP8B 3I55P 2KR5A 2BUOA 1Q81Q 1F80D 3NTEA 1OR5A 7CEIA 2N6YA 2QA4P 1QVFO 2WPTA 2EHTA 3G21A 3H4EA 2VLPA 1YHQP 4U0FA 2MVUA 3CCLP 1E6JP 4PWVB 1M6EX 2XXMA 2MVVA 1VQ9P 4PH0A 2GZGA 2FHSC 3CCQP 1VHNA 3HYBA 2KGEA 4IPYA 2KW2A 2KORA 5HV8A 3G0VA 4GR6A 2JO0A 2DGYA 1YJNP 4GR2A 2KODA 2N6ZA 2LMLA 2GZJA 2CGQA 2VLOA 2K0DX 3CE7A 5HGMA 2LF4A 1T8KA 1M90Q 3CMEP 1MZ8A 2CG5B 3CPWO 2FQ0A 2PNGA 1BXIA 4H2YC 2CQ8A 1NJIQ 3DS1A 2AFDA 1RNIA 2K0YA 2FVFA 3DS2A 1HQBA 5BS2A 5HGNA 4R0MA 1BAJA 5F2NA 5I4TG 1Q86Q 1RO0A 1Z6MA 2N50A 5JPAA 1KLPA 2KGDA 1UNKA 5KP7B 2GZFA 2KG8A 2Z44A 3G26A 2GZIA 3E2DA 3CMAP 2KWLA 2M5RA 4PXHB
chains in the Genus database with same CATH topology
2K93A 5HVCA 4CA3A 2AVAA 2XZ1C 2L0QA 3LMOA 5CZDB 1L0HA 2MVUA 3NY7B 4H2WC 4PWVB 4DG9A 2MVVA 2N5IA 2N98A 3GZMA 1ACPA 2FHSC 2KG6A 2L4BA 4IZ6A 2KOPA 2KGEA 2KW2A 2KORA 5HV8A 1DV5A 2MY5A 2N6ZA 2FACA 2JU1A 2LMLA 1L0IA 2CGQA 3EJDA 2K2QA 2LIUA 5EJDA 3CE7A 2KGAA 2FVEA 2VSQA 4BPGA 2AF8A 2X2BA 1T8KA 2LIWA 4BPHA 2DNWA 2FQ2A 3EJBA 3EJEA 1HY8A 3GZLA 4HKGA 4NEOA 2CG5B 2FVAA 2FQ0A 2PNGA 2JGPA 4H2XC 4H2YC 2CQ8A 2K92A 2AFDA 1VKUA 2KG9A 4PXHB 2K0YA 2FVFA 2LOLA 2N5HA 1HQBA 2L9FA 4R0MA 2MD9A 2CNRA 1X3OA 2GDWA 2K0XA 2FAEA 2GDYA 2MR8A 2XZ0D 2ROQA 2EHSA 2LTEA 1AF8A 2LL8A 3RG2A 2K94A 2KGCA 2KOSA 2N50A 1NQ4A 2QNWA 1DNYA 4BPFA 2MR7A 2KOQA 1KLPA 2L22A 5KP8B 2KGDA 4MRTC 2LKIA 2KR5A 2FADA 2JQ4A 1F80D 5KP7B 1OR5A 5KP6B 2GDXA 2N6YA 2FQ1A 2AFEA 2KOOA 2KG8A 2LPKA 2JU2A 2MF4A 2KWLA 2M5RA 2EHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K93 A;  5HVC A;  4CA3 A;  2AVA A;  2XZ1 C;  2L0Q A;  3LMO A;  5CZD B;  1L0H A;  2MVU A;  3NY7 B;  4H2W C;  4PWV B;  4DG9 A;  2MVV A;  2N5I A;  2N98 A;  3GZM A;  1ACP A;  2FHS C;  2KG6 A;  2L4B A;  4IZ6 A;  2KOP A;  2KGE A;  2KW2 A;  2KOR A;  5HV8 A;  1DV5 A;  2MY5 A;  2N6Z A;  2FAC A;  2JU1 A;  2LML A;  1L0I A;  2CGQ A;  3EJD A;  2K2Q A;  2LIU A;  5EJD A;  3CE7 A;  2KGA A;  2FVE A;  2VSQ A;  4BPG A;  2AF8 A;  2X2B A;  1T8K A;  2LIW A;  4BPH A;  2DNW A;  2FQ2 A;  3EJB A;  3EJE A;  1HY8 A;  3GZL A;  4HKG A;  4NEO A;  2CG5 B;  2FVA A;  2FQ0 A;  2PNG A;  2JGP A;  4H2X C;  4H2Y C;  2CQ8 A;  2K92 A;  2AFD A;  1VKU A;  2KG9 A;  4PXH B;  2K0Y A;  2FVF A;  2LOL A;  2N5H A;  1HQB A;  2L9F A;  4R0M A;  2MD9 A;  2CNR A;  1X3O A;  2GDW A;  2K0X A;  2FAE A;  2GDY A;  2MR8 A;  2XZ0 D;  2ROQ A;  2EHS A;  2LTE A;  1AF8 A;  2LL8 A;  3RG2 A;  2K94 A;  2KGC A;  2KOS A;  2N50 A;  1NQ4 A;  2QNW A;  1DNY A;  4BPF A;  2MR7 A;  2KOQ A;  1KLP A;  2L22 A;  5KP8 B;  2KGD A;  4MRT C;  2LKI A;  2KR5 A;  2FAD A;  2JQ4 A;  1F80 D;  5KP7 B;  1OR5 A;  5KP6 B;  2GDX A;  2N6Y A;  2FQ1 A;  2AFE A;  2KOO A;  2KG8 A;  2LPK A;  2JU2 A;  2MF4 A;  2KWL A;  2M5R A;  2EHT A; 
#chains in the Genus database with same CATH topology
 2K93 A;  4XFX A;  4XFZ A;  4U0E A;  3CCM P;  1ZNV A;  4XFY A;  2VLQ A;  2AVA A;  3G1I A;  2CWO A;  2PEJ A;  4H2W C;  2JYL A;  1A8O A;  3WBH A;  2KG6 A;  1VQ6 P;  5HGL A;  4F37 A;  1VQL P;  4U0A A;  2MY5 A;  3CCU P;  3B5I A;  2FAC A;  1L0I A;  1GPJ A;  2K2Q A;  2LIU A;  1QRJ A;  4U0B A;  2OTL P;  1UJZ A;  2VSQ A;  2P9X A;  2AF8 A;  2ONT A;  2LIW A;  3GJN A;  2PY8 A;  4BPH A;  2EIA A;  2FQ2 A;  1VQK P;  2K5X A;  4NEO A;  2FVA A;  1EMV A;  3LRY A;  1Q7Y Q;  1VKU A;  1VQN P;  3DTJ A;  2LOL A;  1YJ9 P;  2MD9 A;  2GDW A;  1X3O A;  3H47 A;  2FAE A;  2GDY A;  4XRO A;  2XZ0 D;  1EIA A;  2EHS A;  1CEI A;  1AF8 A;  2PEN A;  4UHP B;  3HZQ A;  3M1M A;  3CC2 P;  3CCR P;  2KGC A;  1NQ4 A;  2GZE A;  1S72 P;  2L22 A;  1YI2 P;  2XT1 A;  5BS1 A;  2OTJ P;  2BHV A;  4COP A;  2GDX A;  1FR2 A;  3CCV P;  4QNB A;  2QEX P;  2AFE A;  2KOO A;  2JU2 A;  4U0D A;  4PH1 A;  5HVC A;  2XZ1 C;  2PEM A;  2L0Q A;  1L0H A;  3H0D A;  4DG9 A;  1K73 Q;  2N5I A;  3GZM A;  1ACP A;  3U43 A;  1N8R Q;  1VQ8 P;  1A43 A;  2L4B A;  5F2O A;  1YJW P;  3CCE P;  2M8P A;  1GXG A;  3B4Q A;  2M8N A;  1DV5 A;  2OAR A;  1KQS O;  1VQ5 P;  1VQ4 P;  2JU1 A;  1VQO P;  5EJD A;  3Q20 A;  2KGA A;  3DS5 A;  1KD1 Q;  5DCK A;  2X2B A;  3G4S P;  3G1G A;  1AYI A;  1YIT P;  3CCJ P;  2DNW A;  3P05 A;  3EJB A;  2EFJ A;  2EG5 A;  3EJE A;  1YIJ P;  3DS4 A;  1E0H A;  1Q82 Q;  1M74 A;  1RO2 A;  3VRL C;  4H2X C;  1W2B O;  4M0I A;  2L6E A;  2L9F A;  2JAZ A;  2CNR A;  2MR8 A;  3RG6 C;  1K8A Q;  1VQ7 P;  2LL8 A;  3RG2 A;  1QVG O;  2KOS A;  2QNW A;  4MRT C;  2LKI A;  2FAD A;  2JQ4 A;  1VQM P;  5KP6 B;  2Z46 A;  1K9M Q;  2FQ1 A;  4XRQ A;  3CD6 P;  2LPK A;  2MF4 A;  2JB0 A;  3CCS P;  1D1D A;  1VQP P;  1GXH A;  2GYK A;  4CA3 A;  5F2K A;  2JYG A;  2PEO A;  2Z45 A;  3LMO A;  5CZD B;  2PEI A;  3NY7 B;  2ERH A;  1IMQ A;  3I56 P;  2N98 A;  2XV6 A;  2E1M A;  3G71 P;  4IZ6 A;  1K30 A;  3CXC O;  2KOP A;  3GKL C;  5EW5 E;  2JBG A;  1M1K Q;  3EJD A;  1EOQ A;  4WYM A;  3DS3 A;  3CC4 P;  3G6E P;  2FVE A;  1AUM A;  4BPG A;  4QKO A;  1IUQ A;  1KC8 Q;  5HGO A;  3OW2 O;  3GZL A;  1HY8 A;  3G29 A;  4HKG A;  3CC7 P;  1M6N A;  2PEK A;  2JGP A;  2K92 A;  4U0C A;  3MGE A;  2KG9 A;  1JJ2 O;  3G28 A;  2N5H A;  2K0X A;  3DS0 A;  2ROQ A;  4COC A;  2LTE A;  1ZMB A;  2M8L A;  1IMP A;  2VLN A;  2K94 A;  3DPH A;  2PEQ A;  1DNY A;  2NO8 A;  2MR7 A;  4BPF A;  2KOQ A;  5KP8 B;  3I55 P;  2KR5 A;  2BUO A;  1Q81 Q;  1F80 D;  3NTE A;  1OR5 A;  7CEI A;  2N6Y A;  2QA4 P;  1QVF O;  2WPT A;  2EHT A;  3G21 A;  3H4E A;  2VLP A;  1YHQ P;  4U0F A;  2MVU A;  3CCL P;  1E6J P;  4PWV B;  1M6E X;  2XXM A;  2MVV A;  1VQ9 P;  4PH0 A;  2GZG A;  2FHS C;  3CCQ P;  1VHN A;  3HYB A;  2KGE A;  4IPY A;  2KW2 A;  2KOR A;  5HV8 A;  3G0V A;  4GR6 A;  2JO0 A;  2DGY A;  1YJN P;  4GR2 A;  2KOD A;  2N6Z A;  2LML A;  2GZJ A;  2CGQ A;  2VLO A;  2K0D X;  3CE7 A;  5HGM A;  2LF4 A;  1T8K A;  1M90 Q;  3CME P;  1MZ8 A;  2CG5 B;  3CPW O;  2FQ0 A;  2PNG A;  1BXI A;  4H2Y C;  2CQ8 A;  1NJI Q;  3DS1 A;  2AFD A;  1RNI A;  2K0Y A;  2FVF A;  3DS2 A;  1HQB A;  5BS2 A;  5HGN A;  4R0M A;  1BAJ A;  5F2N A;  5I4T G;  1Q86 Q;  1RO0 A;  1Z6M A;  2N50 A;  5JPA A;  1KLP A;  2KGD A;  1UNK A;  5KP7 B;  2GZF A;  2KG8 A;  2Z44 A;  3G26 A;  2GZI A;  3E2D A;  3CMA P;  2KWL A;  2M5R A;  4PXH B; 
#chains in the Genus database with same CATH homology
 2K93 A;  5HVC A;  4CA3 A;  2AVA A;  2XZ1 C;  2L0Q A;  3LMO A;  5CZD B;  1L0H A;  2MVU A;  3NY7 B;  4H2W C;  4PWV B;  4DG9 A;  2MVV A;  2N5I A;  2N98 A;  3GZM A;  1ACP A;  2FHS C;  2KG6 A;  2L4B A;  4IZ6 A;  2KOP A;  2KGE A;  2KW2 A;  2KOR A;  5HV8 A;  1DV5 A;  2MY5 A;  2N6Z A;  2FAC A;  2JU1 A;  2LML A;  1L0I A;  2CGQ A;  3EJD A;  2K2Q A;  2LIU A;  5EJD A;  3CE7 A;  2KGA A;  2FVE A;  2VSQ A;  4BPG A;  2AF8 A;  2X2B A;  1T8K A;  2LIW A;  4BPH A;  2DNW A;  2FQ2 A;  3EJB A;  3EJE A;  1HY8 A;  3GZL A;  4HKG A;  4NEO A;  2CG5 B;  2FVA A;  2FQ0 A;  2PNG A;  2JGP A;  4H2X C;  4H2Y C;  2CQ8 A;  2K92 A;  2AFD A;  1VKU A;  2KG9 A;  4PXH B;  2K0Y A;  2FVF A;  2LOL A;  2N5H A;  1HQB A;  2L9F A;  4R0M A;  2MD9 A;  2CNR A;  1X3O A;  2GDW A;  2K0X A;  2FAE A;  2GDY A;  2MR8 A;  2XZ0 D;  2ROQ A;  2EHS A;  2LTE A;  1AF8 A;  2LL8 A;  3RG2 A;  2K94 A;  2KGC A;  2KOS A;  2N50 A;  1NQ4 A;  2QNW A;  1DNY A;  4BPF A;  2MR7 A;  2KOQ A;  1KLP A;  2L22 A;  5KP8 B;  2KGD A;  4MRT C;  2LKI A;  2KR5 A;  2FAD A;  2JQ4 A;  1F80 D;  5KP7 B;  1OR5 A;  5KP6 B;  2GDX A;  2N6Y A;  2FQ1 A;  2AFE A;  2KOO A;  2KG8 A;  2LPK A;  2JU2 A;  2MF4 A;  2KWL A;  2M5R A;  2EHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...