3EJEA

Crystal structure of p450bioi in complex with octadec-9z-enoic acid ligated acyl carrier protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
78
structure length
78
Chain Sequence
SHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/lipid transport
total genus 22
structure length 78
sequence length 78
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3ejeA00
2AFEA 2FQ1A 4R0MA 4PXHB 5KP8B 1OR5A 2AVAA 5EJDA 2GDYA 4HKGA 4PWVB 4CA3A 1L0IA 2L0QA 5HV8A 2KG6A 2CQ8A 2FQ0A 2M5RA 2KOQA 2KOPA 2K94A 2VSQA 1KLPA 2KGEA 2MD9A 2FAEA 2N5HA 2KORA 2N98A 3LMOA 2K2QA 1VKUA 2N6YA 2LPKA 1NQ4A 2DNWA 2PNGA 4H2WC 2LIWA 1ACPA 1HQBA 2MR7A 2MF4A 4H2XC 2LL8A 1DNYA 2CGQA 3RG2A 1T8KA 5KP7B 2JGPA 2L9FA 2CG5B 2FHSC 2XZ0D 2LKIA 1L0HA 2X2BA 4IZ6A 2FVFA 2KW2A 2N50A 2KOSA 2L22A 1AF8A 2CNRA 1F80D 2LIUA 2LTEA 3EJDA 5HVCA 3EJBA 2MR8A 2KR5A 2MY5A 4BPFA 2QNWA 2N5IA 2FADA 2LOLA 2KWLA 2JQ4A 2MVVA 2GDXA 2FQ2A 4H2YC 2ROQA 2JU1A 2JU2A 5KP6B 2K0XA 3GZMA 2K0YA 2KOOA 2KG9A 2AF8A 2KG8A 4BPHA 2FACA 4DG9A 2KGDA 2K92A 2FVAA 2KGAA 2LMLA 1DV5A 1HY8A 4NEOA 5CZDB 2N6ZA 1X3OA 2GDWA 2KGCA 2K93A 2XZ1C 2AFDA 3CE7A 2FVEA 2L4BA 4BPGA 2EHSA 4MRTC 2MVUA 3GZLA 2EHTA 3EJEA 3NY7B
chains in the Genus database with same CATH superfamily
1M6NA 2AFEA 1ZNVA 2FQ1A 4R0MA 4PH0A 1K73Q 5KP8B 1OR5A 2VLPA 1GXGA 2GDYA 4PWVB 4CA3A 2DGYA 2L0QA 4QNBA 2QA4P 2M8LA 4IPYA 1KLPA 1UNKA 2KGEA 2MD9A 2KORA 2NO8A 1AUMA 4H2WC 2MR7A 1DNYA 2PEOA 1Q82Q 3HYBA 2CG5B 2GZFA 1VQKP 2JAZA 2LKIA 3B5IA 4U0EA 3Q20A 3I56P 3G0VA 1A8OA 2XXMA 2PEMA 2JYGA 2GYKA 1AF8A 2PEQA 1F80D 2LTEA 3EJDA 2E1MA 3B4QA 3CC7P 2GZJA 2KR5A 1A43A 4BPFA 2N5IA 2OARA 1E0HA 2MVVA 4H2YC 3CPWO 1Q81Q 1IUQA 2JU2A 3GZMA 2KOOA 1VQ4P 2KG8A 1YJ9P 2LF4A 3G1IA 2FVAA 2LMLA 5F2OA 1HY8A 2N6ZA 1D1DA 3OW2O 4WYMA 2XZ1C 3DTJA 2OTJP 1IMPA 4MRTC 2MVUA 2M8PA 3NY7B 3DPHA 4PXHB 5EJDA 2GZGA 3CCVP 4XFZA 2M8NA 2FQ0A 2M5RA 2KOQA 4PH1A 4COPA 2KOPA 2GZIA 3G21A 1N8RQ 2N98A 5HGLA 1NQ4A 1ACPA 2Z45A 2LIWA 1HQBA 4H2XC 4U0BA 2K5XA 3G4SP 2CGQA 3RG2A 1T8KA 2P9XA 3G1GA 1JJ2O 3G26A 3DS5A 1L0HA 2PEIA 4IZ6A 3CCRP 2XV6A 3I55P 2KW2A 3G71P 1GPJA 1YJWP 1EOQA 5F2KA 5HVCA 3H0DA 1K9MQ 2ONTA 2QEXP 1VQNP 2LOLA 2EG5A 3GKLC 2FQ2A 2ROQA 3H47A 2JYLA 1BXIA 2JU1A 2VLQA 3CCJP 3GJNA 5HGMA 2FACA 2K92A 2Z46A 1DV5A 1UJZA 2ERHA 1Z6MA 4XROA 2FVEA 1KD1Q 4XFYA 1M74A 3GZLA 2EHTA 3EJEA 1KQSO 2CWOA 1KC8Q 1CEIA 4U0CA 2JB0A 5HV8A 1VQ9P 3CCUP 3HZQA 2K94A 2VSQA 3CC4P 2N5HA 3DS3A 1YIJP 1M90Q 1Q7YQ 1VKUA 1VQMP 2DNWA 2PNGA 3U43A 2MF4A 2LL8A 1VQ7P 1EMVA 3CC2P 2FHSC 1K8AQ 2L6EA 2VLNA 5F2NA 2PEKA 4U0AA 4QKOA 2X2BA 1Q86Q 1MZ8A 1ZMBA 1YITP 2FVFA 2N50A 2L22A 3M1MA 3G28A 2Z44A 3CMEP 3LRYA 2LIUA 4XRQA 1VQPP 1W2BO 5HGOA 3DS0A 2MY5A 2BHVA 2QNWA 2FADA 4U0DA 2WPTA 7CEIA 2KWLA 3WBHA 1BAJA 3VRLC 3CMAP 1NJIQ 5HGNA 1M6EX 2KG9A 3CCEP 2AF8A 4DG9A 2PY8A 1K30A 1AYIA 4NEOA 5CZDB 2BUOA 1S72P 1X3OA 2GDWA 2KGCA 2PENA 2L4BA 4BPGA 4GR6A 4UHPB 1FR2A 5I4TG 2OTLP 2AVAA 4HKGA 1L0IA 5EW5E 3CXCO 3CCQP 3CCSP 2KG6A 1RNIA 2CQ8A 3MGEA 1IMQA 1QVGO 1VHNA 2EFJA 4COCA 2FAEA 3LMOA 1EIAA 2K2QA 2KODA 2N6YA 1YJNP 2LPKA 5BS2A 4M0IA 3DS1A 5KP7B 2EIAA 2JGPA 2L9FA 2XZ0D 2VLOA 3H4EA 2XT1A 3NTEA 3CD6P 2JBGA 4XFXA 1M1KQ 2KOSA 2PEJA 4F37A 2CNRA 3P05A 1VQOP 2JO0A 3CCMP 3RG6C 3G6EP 3EJBA 3CCLP 2MR8A 1VQ5P 1RO0A 5BS1A 2JQ4A 1QVFO 2GDXA 1GXHA 3DS4A 5KP6B 3G29A 1YI2P 5DCKA 2K0XA 2K0YA 4U0FA 1E6JP 4BPHA 5JPAA 2KGDA 1VQ6P 2K0DX 1VQLP 1QRJA 2KGAA 3E2DA 1VQ8P 2K93A 2AFDA 3CE7A 2GZEA 3DS2A 4GR2A 2EHSA 1RO2A 1YHQP
chains in the Genus database with same CATH topology
2AFEA 2FQ1A 4R0MA 4PXHB 5KP8B 1OR5A 2AVAA 5EJDA 2GDYA 4HKGA 4PWVB 4CA3A 1L0IA 2L0QA 5HV8A 2KG6A 2CQ8A 2FQ0A 2M5RA 2KOQA 2KOPA 2K94A 2VSQA 1KLPA 2KGEA 2MD9A 2FAEA 2N5HA 2KORA 2N98A 3LMOA 2K2QA 1VKUA 2N6YA 2LPKA 1NQ4A 2DNWA 2PNGA 4H2WC 2LIWA 1ACPA 1HQBA 2MR7A 2MF4A 4H2XC 2LL8A 1DNYA 2CGQA 3RG2A 1T8KA 5KP7B 2JGPA 2L9FA 2CG5B 2FHSC 2XZ0D 2LKIA 1L0HA 2X2BA 4IZ6A 2FVFA 2KW2A 2N50A 2KOSA 2L22A 1AF8A 2CNRA 1F80D 2LIUA 2LTEA 3EJDA 5HVCA 3EJBA 2MR8A 2KR5A 2MY5A 4BPFA 2QNWA 2N5IA 2FADA 2LOLA 2KWLA 2JQ4A 2MVVA 2GDXA 2FQ2A 4H2YC 2ROQA 2JU1A 2JU2A 5KP6B 2K0XA 3GZMA 2K0YA 2KOOA 2KG9A 2AF8A 2KG8A 4BPHA 2FACA 4DG9A 2KGDA 2K92A 2FVAA 2KGAA 2LMLA 1DV5A 1HY8A 4NEOA 5CZDB 2N6ZA 1X3OA 2GDWA 2KGCA 2K93A 2XZ1C 2AFDA 3CE7A 2FVEA 2L4BA 4BPGA 2EHSA 4MRTC 2MVUA 3GZLA 2EHTA 3EJEA 3NY7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFE A;  2FQ1 A;  4R0M A;  4PXH B;  5KP8 B;  1OR5 A;  2AVA A;  5EJD A;  2GDY A;  4HKG A;  4PWV B;  4CA3 A;  1L0I A;  2L0Q A;  5HV8 A;  2KG6 A;  2CQ8 A;  2FQ0 A;  2M5R A;  2KOQ A;  2KOP A;  2K94 A;  2VSQ A;  1KLP A;  2KGE A;  2MD9 A;  2FAE A;  2N5H A;  2KOR A;  2N98 A;  3LMO A;  2K2Q A;  1VKU A;  2N6Y A;  2LPK A;  1NQ4 A;  2DNW A;  2PNG A;  4H2W C;  2LIW A;  1ACP A;  1HQB A;  2MR7 A;  2MF4 A;  4H2X C;  2LL8 A;  1DNY A;  2CGQ A;  3RG2 A;  1T8K A;  5KP7 B;  2JGP A;  2L9F A;  2CG5 B;  2FHS C;  2XZ0 D;  2LKI A;  1L0H A;  2X2B A;  4IZ6 A;  2FVF A;  2KW2 A;  2N50 A;  2KOS A;  2L22 A;  1AF8 A;  2CNR A;  1F80 D;  2LIU A;  2LTE A;  3EJD A;  5HVC A;  3EJB A;  2MR8 A;  2KR5 A;  2MY5 A;  4BPF A;  2QNW A;  2N5I A;  2FAD A;  2LOL A;  2KWL A;  2JQ4 A;  2MVV A;  2GDX A;  2FQ2 A;  4H2Y C;  2ROQ A;  2JU1 A;  2JU2 A;  5KP6 B;  2K0X A;  3GZM A;  2K0Y A;  2KOO A;  2KG9 A;  2AF8 A;  2KG8 A;  4BPH A;  2FAC A;  4DG9 A;  2KGD A;  2K92 A;  2FVA A;  2KGA A;  2LML A;  1DV5 A;  1HY8 A;  4NEO A;  5CZD B;  2N6Z A;  1X3O A;  2GDW A;  2KGC A;  2K93 A;  2XZ1 C;  2AFD A;  3CE7 A;  2FVE A;  2L4B A;  4BPG A;  2EHS A;  4MRT C;  2MVU A;  3GZL A;  2EHT A;  3EJE A;  3NY7 B; 
#chains in the Genus database with same CATH topology
 1M6N A;  2AFE A;  1ZNV A;  2FQ1 A;  4R0M A;  4PH0 A;  1K73 Q;  5KP8 B;  1OR5 A;  2VLP A;  1GXG A;  2GDY A;  4PWV B;  4CA3 A;  2DGY A;  2L0Q A;  4QNB A;  2QA4 P;  2M8L A;  4IPY A;  1KLP A;  1UNK A;  2KGE A;  2MD9 A;  2KOR A;  2NO8 A;  1AUM A;  4H2W C;  2MR7 A;  1DNY A;  2PEO A;  1Q82 Q;  3HYB A;  2CG5 B;  2GZF A;  1VQK P;  2JAZ A;  2LKI A;  3B5I A;  4U0E A;  3Q20 A;  3I56 P;  3G0V A;  1A8O A;  2XXM A;  2PEM A;  2JYG A;  2GYK A;  1AF8 A;  2PEQ A;  1F80 D;  2LTE A;  3EJD A;  2E1M A;  3B4Q A;  3CC7 P;  2GZJ A;  2KR5 A;  1A43 A;  4BPF A;  2N5I A;  2OAR A;  1E0H A;  2MVV A;  4H2Y C;  3CPW O;  1Q81 Q;  1IUQ A;  2JU2 A;  3GZM A;  2KOO A;  1VQ4 P;  2KG8 A;  1YJ9 P;  2LF4 A;  3G1I A;  2FVA A;  2LML A;  5F2O A;  1HY8 A;  2N6Z A;  1D1D A;  3OW2 O;  4WYM A;  2XZ1 C;  3DTJ A;  2OTJ P;  1IMP A;  4MRT C;  2MVU A;  2M8P A;  3NY7 B;  3DPH A;  4PXH B;  5EJD A;  2GZG A;  3CCV P;  4XFZ A;  2M8N A;  2FQ0 A;  2M5R A;  2KOQ A;  4PH1 A;  4COP A;  2KOP A;  2GZI A;  3G21 A;  1N8R Q;  2N98 A;  5HGL A;  1NQ4 A;  1ACP A;  2Z45 A;  2LIW A;  1HQB A;  4H2X C;  4U0B A;  2K5X A;  3G4S P;  2CGQ A;  3RG2 A;  1T8K A;  2P9X A;  3G1G A;  1JJ2 O;  3G26 A;  3DS5 A;  1L0H A;  2PEI A;  4IZ6 A;  3CCR P;  2XV6 A;  3I55 P;  2KW2 A;  3G71 P;  1GPJ A;  1YJW P;  1EOQ A;  5F2K A;  5HVC A;  3H0D A;  1K9M Q;  2ONT A;  2QEX P;  1VQN P;  2LOL A;  2EG5 A;  3GKL C;  2FQ2 A;  2ROQ A;  3H47 A;  2JYL A;  1BXI A;  2JU1 A;  2VLQ A;  3CCJ P;  3GJN A;  5HGM A;  2FAC A;  2K92 A;  2Z46 A;  1DV5 A;  1UJZ A;  2ERH A;  1Z6M A;  4XRO A;  2FVE A;  1KD1 Q;  4XFY A;  1M74 A;  3GZL A;  2EHT A;  3EJE A;  1KQS O;  2CWO A;  1KC8 Q;  1CEI A;  4U0C A;  2JB0 A;  5HV8 A;  1VQ9 P;  3CCU P;  3HZQ A;  2K94 A;  2VSQ A;  3CC4 P;  2N5H A;  3DS3 A;  1YIJ P;  1M90 Q;  1Q7Y Q;  1VKU A;  1VQM P;  2DNW A;  2PNG A;  3U43 A;  2MF4 A;  2LL8 A;  1VQ7 P;  1EMV A;  3CC2 P;  2FHS C;  1K8A Q;  2L6E A;  2VLN A;  5F2N A;  2PEK A;  4U0A A;  4QKO A;  2X2B A;  1Q86 Q;  1MZ8 A;  1ZMB A;  1YIT P;  2FVF A;  2N50 A;  2L22 A;  3M1M A;  3G28 A;  2Z44 A;  3CME P;  3LRY A;  2LIU A;  4XRQ A;  1VQP P;  1W2B O;  5HGO A;  3DS0 A;  2MY5 A;  2BHV A;  2QNW A;  2FAD A;  4U0D A;  2WPT A;  7CEI A;  2KWL A;  3WBH A;  1BAJ A;  3VRL C;  3CMA P;  1NJI Q;  5HGN A;  1M6E X;  2KG9 A;  3CCE P;  2AF8 A;  4DG9 A;  2PY8 A;  1K30 A;  1AYI A;  4NEO A;  5CZD B;  2BUO A;  1S72 P;  1X3O A;  2GDW A;  2KGC A;  2PEN A;  2L4B A;  4BPG A;  4GR6 A;  4UHP B;  1FR2 A;  5I4T G;  2OTL P;  2AVA A;  4HKG A;  1L0I A;  5EW5 E;  3CXC O;  3CCQ P;  3CCS P;  2KG6 A;  1RNI A;  2CQ8 A;  3MGE A;  1IMQ A;  1QVG O;  1VHN A;  2EFJ A;  4COC A;  2FAE A;  3LMO A;  1EIA A;  2K2Q A;  2KOD A;  2N6Y A;  1YJN P;  2LPK A;  5BS2 A;  4M0I A;  3DS1 A;  5KP7 B;  2EIA A;  2JGP A;  2L9F A;  2XZ0 D;  2VLO A;  3H4E A;  2XT1 A;  3NTE A;  3CD6 P;  2JBG A;  4XFX A;  1M1K Q;  2KOS A;  2PEJ A;  4F37 A;  2CNR A;  3P05 A;  1VQO P;  2JO0 A;  3CCM P;  3RG6 C;  3G6E P;  3EJB A;  3CCL P;  2MR8 A;  1VQ5 P;  1RO0 A;  5BS1 A;  2JQ4 A;  1QVF O;  2GDX A;  1GXH A;  3DS4 A;  5KP6 B;  3G29 A;  1YI2 P;  5DCK A;  2K0X A;  2K0Y A;  4U0F A;  1E6J P;  4BPH A;  5JPA A;  2KGD A;  1VQ6 P;  2K0D X;  1VQL P;  1QRJ A;  2KGA A;  3E2D A;  1VQ8 P;  2K93 A;  2AFD A;  3CE7 A;  2GZE A;  3DS2 A;  4GR2 A;  2EHS A;  1RO2 A;  1YHQ P; 
#chains in the Genus database with same CATH homology
 2AFE A;  2FQ1 A;  4R0M A;  4PXH B;  5KP8 B;  1OR5 A;  2AVA A;  5EJD A;  2GDY A;  4HKG A;  4PWV B;  4CA3 A;  1L0I A;  2L0Q A;  5HV8 A;  2KG6 A;  2CQ8 A;  2FQ0 A;  2M5R A;  2KOQ A;  2KOP A;  2K94 A;  2VSQ A;  1KLP A;  2KGE A;  2MD9 A;  2FAE A;  2N5H A;  2KOR A;  2N98 A;  3LMO A;  2K2Q A;  1VKU A;  2N6Y A;  2LPK A;  1NQ4 A;  2DNW A;  2PNG A;  4H2W C;  2LIW A;  1ACP A;  1HQB A;  2MR7 A;  2MF4 A;  4H2X C;  2LL8 A;  1DNY A;  2CGQ A;  3RG2 A;  1T8K A;  5KP7 B;  2JGP A;  2L9F A;  2CG5 B;  2FHS C;  2XZ0 D;  2LKI A;  1L0H A;  2X2B A;  4IZ6 A;  2FVF A;  2KW2 A;  2N50 A;  2KOS A;  2L22 A;  1AF8 A;  2CNR A;  1F80 D;  2LIU A;  2LTE A;  3EJD A;  5HVC A;  3EJB A;  2MR8 A;  2KR5 A;  2MY5 A;  4BPF A;  2QNW A;  2N5I A;  2FAD A;  2LOL A;  2KWL A;  2JQ4 A;  2MVV A;  2GDX A;  2FQ2 A;  4H2Y C;  2ROQ A;  2JU1 A;  2JU2 A;  5KP6 B;  2K0X A;  3GZM A;  2K0Y A;  2KOO A;  2KG9 A;  2AF8 A;  2KG8 A;  4BPH A;  2FAC A;  4DG9 A;  2KGD A;  2K92 A;  2FVA A;  2KGA A;  2LML A;  1DV5 A;  1HY8 A;  4NEO A;  5CZD B;  2N6Z A;  1X3O A;  2GDW A;  2KGC A;  2K93 A;  2XZ1 C;  2AFD A;  3CE7 A;  2FVE A;  2L4B A;  4BPG A;  2EHS A;  4MRT C;  2MVU A;  3GZL A;  2EHT A;  3EJE A;  3NY7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...