1NQ4A

Solution structure of oxytetracycline acyl carrier protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
95
structure length
95
Chain Sequence
MTLLTLSDLLTLLRECAGEEESIDLGGDVEDVAFDALGYDSLALLNTVGRIERDYGVQLGDDAVEKATTPRALIEMTNASLTGASPSAGGAARDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Oxytetracycline polyketide synthase acyl carrier protein
publication title Solution structure and dynamics of oxytetracycline polyketide synthase acyl carrier protein from Streptomyces rimosus
pubmed doi rcsb
source organism Streptomyces rimosus
total genus 21
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1nq4A00
2GDYA 2ROQA 1VKUA 3CE7A 2FVAA 4PWVB 2FADA 4R0MA 2FQ2A 1NQ4A 2K94A 4BPGA 2MR7A 2CQ8A 4H2WC 2KR5A 1OR5A 2MVVA 2KORA 2DNWA 4DG9A 4NEOA 2MD9A 3LMOA 1X3OA 1AF8A 5KP6B 2FQ1A 2EHTA 2N50A 1F80D 2MY5A 2MF4A 1HY8A 2L22A 2KG6A 3EJBA 4BPFA 1T8KA 2AFDA 2KGEA 5KP8B 2XZ0D 1ACPA 4H2YC 2CNRA 2MR8A 2LPKA 2N6YA 2JQ4A 5EJDA 1L0HA 2JU1A 2AF8A 5HVCA 4CA3A 2FQ0A 2KG9A 1DV5A 1DNYA 2JGPA 2AFEA 2CG5B 1L0IA 2KOQA 2PNGA 3GZMA 2N6ZA 2KGAA 4MRTC 2AVAA 2LKIA 2X2BA 4HKGA 2GDWA 3RG2A 4IZ6A 5KP7B 2EHSA 2CGQA 2FVEA 2FACA 2K0XA 2N5HA 4H2XC 2KGCA 2VSQA 2KOPA 3GZLA 4PXHB 2KGDA 2L0QA 2LMLA 2FAEA 5CZDB 2KWLA 2K92A 2LIUA 2N5IA 5HV8A 2KW2A 3NY7B 2FVFA 2XZ1C 2LL8A 2LIWA 2LTEA 2QNWA 2JU2A 3EJEA 1HQBA 2GDXA 2MVUA 2L9FA 2KOSA 2M5RA 2N98A 2L4BA 3EJDA 2FHSC 2K0YA 4BPHA 2KG8A 1KLPA 2KOOA 2K93A 2LOLA 2K2QA
chains in the Genus database with same CATH superfamily
5HGLA 4F37A 1A43A 2CQ8A 3E2DA 3P05A 2GYKA 1EOQA 2KR5A 3CCJP 2LF4A 2XV6A 4IPYA 4DG9A 1YJWP 2M8NA 1EIAA 1F80D 1YJ9P 2PEKA 2KG6A 3EJBA 4BPFA 2M8LA 2KGEA 1ACPA 2VLNA 3G71P 3CD6P 1NJIQ 2CNRA 2MR8A 2JAZA 1ZNVA 2LPKA 5DCKA 2JU1A 2FQ0A 3G26A 2KG9A 2JGPA 1RO0A 4QKOA 2GDWA 4PH0A 1GPJA 4IZ6A 1N8RQ 3CCMP 3G21A 1IUQA 4PXHB 2CWOA 1QRJA 2GZJA 3H47A 4WYMA 2FAEA 2JYLA 3CMAP 1BXIA 2LIUA 2KW2A 2QEXP 1D1DA 5BS2A 3NY7B 2FVFA 2LL8A 1Q7YQ 5F2OA 1VQLP 2GDXA 3DPHA 2E1MA 2Z46A 1JJ2O 4U0DA 2EFJA 4COPA 4GR6A 1ZMBA 3CPWO 3CE7A 4PWVB 2FADA 2DGYA 5HGNA 4H2WC 3CCSP 2GZGA 1VQ5P 3DS2A 2MVVA 2OARA 1X3OA 5KP6B 1Q82Q 2EHTA 2N50A 2EIAA 2L22A 3DS1A 1GXGA 2AFDA 3MGEA 5EW5E 4H2YC 3CC7P 2N6YA 2JQ4A 3I56P 2BHVA 5HVCA 4CA3A 3DTJA 1BAJA 4XFXA 2QA4P 1DV5A 3HZQA 3WBHA 2CG5B 3CXCO 3DS4A 1L0IA 5HGMA 2N6ZA 2KGAA 1A8OA 2LKIA 4MRTC 3CCRP 4HKGA 4XFYA 2GZEA 2EHSA 2FVEA 2VSQA 2KOPA 3GZLA 1K9MQ 2Z45A 2K92A 3G0VA 2KODA 1VQ9P 1QVGO 3G6EP 3LRYA 2JYGA 1KQSO 5I4TG 3EJEA 2MVUA 1M74A 3DS3A 1VHNA 4BPHA 2P9XA 3CCUP 2OTJP 3GKLC 2K2QA 2NO8A 2FVAA 1Q86Q 2FQ2A 1NQ4A 2K94A 4GR2A 1YI2P 3G28A 1OR5A 2KORA 2DNWA 2PEOA 2JO0A 2MD9A 3LMOA 1AF8A 3CCLP 1AYIA 5F2NA 3G1GA 3G29A 1E6JP 2MY5A 4U0AA 5BS1A 2EG5A 1T8KA 1EMVA 1YIJP 1UNKA 2VLQA 3G4SP 5EJDA 1L0HA 1K73Q 3U43A 2AF8A 3CC2P 4XROA 1DNYA 1KD1Q 7CEIA 3H0DA 2AVAA 2JB0A 2XT1A 3B4QA 4PH1A 5KP7B 3M1MA 1RNIA 4XFZA 1VQ4P 2K0DX 2CGQA 1YHQP 2K0XA 1M6NA 2PEMA 1M1KQ 2N5HA 1CEIA 1Z6MA 2KGCA 1Q81Q 2KGDA 1FR2A 2L0QA 2ONTA 1MZ8A 3CC4P 1UJZA 5HGOA 2LMLA 4U0EA 1QVFO 2KWLA 1M6EX 2PY8A 1VQKP 2LIWA 2QNWA 1HQBA 4COCA 4U0BA 2L9FA 2M5RA 2Z44A 3NTEA 1RO2A 1VQPP 3H4EA 4U0FA 3CCVP 2K93A 3OW2O 2LOLA 3CMEP 2BUOA 3DS0A 2K5XA 1K8AQ 2GDYA 2ROQA 1VKUA 2VLOA 4QNBA 4M0IA 4BPGA 4R0MA 2MR7A 4UHPB 2PEJA 4NEOA 1KC8Q 2FQ1A 4XRQA 3CCQP 5JPAA 2PENA 2L6EA 2MF4A 1HY8A 5F2KA 2M8PA 3G1IA 5KP8B 2XZ0D 1YITP 2OTLP 3VRLC 3GJNA 1IMPA 1W2BO 3Q20A 2GZFA 2AFEA 2KOQA 2PNGA 2PEQA 3GZMA 1K30A 1VQ7P 2X2BA 1VQ6P 1AUMA 3RG2A 2JBGA 3CCEP 3DS5A 1IMQA 3RG6C 2PEIA 2FACA 4U0CA 4H2XC 2GZIA 1S72P 1GXHA 1VQ8P 1E0HA 1VQOP 1YJNP 2ERHA 5CZDB 1M90Q 2N5IA 2XXMA 5HV8A 1VQNP 2XZ1C 2WPTA 2LTEA 2JU2A 2KOSA 1VQMP 2N98A 2L4BA 3EJDA 2FHSC 2K0YA 3B5IA 2KG8A 1KLPA 2KOOA 2VLPA 3HYBA 3I55P
chains in the Genus database with same CATH topology
2GDYA 2ROQA 1VKUA 3CE7A 2FVAA 4PWVB 2FADA 4R0MA 2FQ2A 1NQ4A 2K94A 4BPGA 2MR7A 2CQ8A 4H2WC 2KR5A 1OR5A 2MVVA 2KORA 2DNWA 4DG9A 4NEOA 2MD9A 3LMOA 1X3OA 1AF8A 5KP6B 2FQ1A 2EHTA 2N50A 1F80D 2MY5A 2MF4A 1HY8A 2L22A 2KG6A 3EJBA 4BPFA 1T8KA 2AFDA 2KGEA 5KP8B 2XZ0D 1ACPA 4H2YC 2CNRA 2MR8A 2LPKA 2N6YA 2JQ4A 5EJDA 1L0HA 2JU1A 2AF8A 5HVCA 4CA3A 2FQ0A 2KG9A 1DV5A 1DNYA 2JGPA 2AFEA 2CG5B 1L0IA 2KOQA 2PNGA 3GZMA 2N6ZA 2KGAA 4MRTC 2AVAA 2LKIA 2X2BA 4HKGA 2GDWA 3RG2A 4IZ6A 5KP7B 2EHSA 2CGQA 2FVEA 2FACA 2K0XA 2N5HA 4H2XC 2KGCA 2VSQA 2KOPA 3GZLA 4PXHB 2KGDA 2L0QA 2LMLA 2FAEA 5CZDB 2KWLA 2K92A 2LIUA 2N5IA 5HV8A 2KW2A 3NY7B 2FVFA 2XZ1C 2LL8A 2LIWA 2LTEA 2QNWA 2JU2A 3EJEA 1HQBA 2GDXA 2MVUA 2L9FA 2KOSA 2M5RA 2N98A 2L4BA 3EJDA 2FHSC 2K0YA 4BPHA 2KG8A 1KLPA 2KOOA 2K93A 2LOLA 2K2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDY A;  2ROQ A;  1VKU A;  3CE7 A;  2FVA A;  4PWV B;  2FAD A;  4R0M A;  2FQ2 A;  1NQ4 A;  2K94 A;  4BPG A;  2MR7 A;  2CQ8 A;  4H2W C;  2KR5 A;  1OR5 A;  2MVV A;  2KOR A;  2DNW A;  4DG9 A;  4NEO A;  2MD9 A;  3LMO A;  1X3O A;  1AF8 A;  5KP6 B;  2FQ1 A;  2EHT A;  2N50 A;  1F80 D;  2MY5 A;  2MF4 A;  1HY8 A;  2L22 A;  2KG6 A;  3EJB A;  4BPF A;  1T8K A;  2AFD A;  2KGE A;  5KP8 B;  2XZ0 D;  1ACP A;  4H2Y C;  2CNR A;  2MR8 A;  2LPK A;  2N6Y A;  2JQ4 A;  5EJD A;  1L0H A;  2JU1 A;  2AF8 A;  5HVC A;  4CA3 A;  2FQ0 A;  2KG9 A;  1DV5 A;  1DNY A;  2JGP A;  2AFE A;  2CG5 B;  1L0I A;  2KOQ A;  2PNG A;  3GZM A;  2N6Z A;  2KGA A;  4MRT C;  2AVA A;  2LKI A;  2X2B A;  4HKG A;  2GDW A;  3RG2 A;  4IZ6 A;  5KP7 B;  2EHS A;  2CGQ A;  2FVE A;  2FAC A;  2K0X A;  2N5H A;  4H2X C;  2KGC A;  2VSQ A;  2KOP A;  3GZL A;  4PXH B;  2KGD A;  2L0Q A;  2LML A;  2FAE A;  5CZD B;  2KWL A;  2K92 A;  2LIU A;  2N5I A;  5HV8 A;  2KW2 A;  3NY7 B;  2FVF A;  2XZ1 C;  2LL8 A;  2LIW A;  2LTE A;  2QNW A;  2JU2 A;  3EJE A;  1HQB A;  2GDX A;  2MVU A;  2L9F A;  2KOS A;  2M5R A;  2N98 A;  2L4B A;  3EJD A;  2FHS C;  2K0Y A;  4BPH A;  2KG8 A;  1KLP A;  2KOO A;  2K93 A;  2LOL A;  2K2Q A; 
#chains in the Genus database with same CATH topology
 5HGL A;  4F37 A;  1A43 A;  2CQ8 A;  3E2D A;  3P05 A;  2GYK A;  1EOQ A;  2KR5 A;  3CCJ P;  2LF4 A;  2XV6 A;  4IPY A;  4DG9 A;  1YJW P;  2M8N A;  1EIA A;  1F80 D;  1YJ9 P;  2PEK A;  2KG6 A;  3EJB A;  4BPF A;  2M8L A;  2KGE A;  1ACP A;  2VLN A;  3G71 P;  3CD6 P;  1NJI Q;  2CNR A;  2MR8 A;  2JAZ A;  1ZNV A;  2LPK A;  5DCK A;  2JU1 A;  2FQ0 A;  3G26 A;  2KG9 A;  2JGP A;  1RO0 A;  4QKO A;  2GDW A;  4PH0 A;  1GPJ A;  4IZ6 A;  1N8R Q;  3CCM P;  3G21 A;  1IUQ A;  4PXH B;  2CWO A;  1QRJ A;  2GZJ A;  3H47 A;  4WYM A;  2FAE A;  2JYL A;  3CMA P;  1BXI A;  2LIU A;  2KW2 A;  2QEX P;  1D1D A;  5BS2 A;  3NY7 B;  2FVF A;  2LL8 A;  1Q7Y Q;  5F2O A;  1VQL P;  2GDX A;  3DPH A;  2E1M A;  2Z46 A;  1JJ2 O;  4U0D A;  2EFJ A;  4COP A;  4GR6 A;  1ZMB A;  3CPW O;  3CE7 A;  4PWV B;  2FAD A;  2DGY A;  5HGN A;  4H2W C;  3CCS P;  2GZG A;  1VQ5 P;  3DS2 A;  2MVV A;  2OAR A;  1X3O A;  5KP6 B;  1Q82 Q;  2EHT A;  2N50 A;  2EIA A;  2L22 A;  3DS1 A;  1GXG A;  2AFD A;  3MGE A;  5EW5 E;  4H2Y C;  3CC7 P;  2N6Y A;  2JQ4 A;  3I56 P;  2BHV A;  5HVC A;  4CA3 A;  3DTJ A;  1BAJ A;  4XFX A;  2QA4 P;  1DV5 A;  3HZQ A;  3WBH A;  2CG5 B;  3CXC O;  3DS4 A;  1L0I A;  5HGM A;  2N6Z A;  2KGA A;  1A8O A;  2LKI A;  4MRT C;  3CCR P;  4HKG A;  4XFY A;  2GZE A;  2EHS A;  2FVE A;  2VSQ A;  2KOP A;  3GZL A;  1K9M Q;  2Z45 A;  2K92 A;  3G0V A;  2KOD A;  1VQ9 P;  1QVG O;  3G6E P;  3LRY A;  2JYG A;  1KQS O;  5I4T G;  3EJE A;  2MVU A;  1M74 A;  3DS3 A;  1VHN A;  4BPH A;  2P9X A;  3CCU P;  2OTJ P;  3GKL C;  2K2Q A;  2NO8 A;  2FVA A;  1Q86 Q;  2FQ2 A;  1NQ4 A;  2K94 A;  4GR2 A;  1YI2 P;  3G28 A;  1OR5 A;  2KOR A;  2DNW A;  2PEO A;  2JO0 A;  2MD9 A;  3LMO A;  1AF8 A;  3CCL P;  1AYI A;  5F2N A;  3G1G A;  3G29 A;  1E6J P;  2MY5 A;  4U0A A;  5BS1 A;  2EG5 A;  1T8K A;  1EMV A;  1YIJ P;  1UNK A;  2VLQ A;  3G4S P;  5EJD A;  1L0H A;  1K73 Q;  3U43 A;  2AF8 A;  3CC2 P;  4XRO A;  1DNY A;  1KD1 Q;  7CEI A;  3H0D A;  2AVA A;  2JB0 A;  2XT1 A;  3B4Q A;  4PH1 A;  5KP7 B;  3M1M A;  1RNI A;  4XFZ A;  1VQ4 P;  2K0D X;  2CGQ A;  1YHQ P;  2K0X A;  1M6N A;  2PEM A;  1M1K Q;  2N5H A;  1CEI A;  1Z6M A;  2KGC A;  1Q81 Q;  2KGD A;  1FR2 A;  2L0Q A;  2ONT A;  1MZ8 A;  3CC4 P;  1UJZ A;  5HGO A;  2LML A;  4U0E A;  1QVF O;  2KWL A;  1M6E X;  2PY8 A;  1VQK P;  2LIW A;  2QNW A;  1HQB A;  4COC A;  4U0B A;  2L9F A;  2M5R A;  2Z44 A;  3NTE A;  1RO2 A;  1VQP P;  3H4E A;  4U0F A;  3CCV P;  2K93 A;  3OW2 O;  2LOL A;  3CME P;  2BUO A;  3DS0 A;  2K5X A;  1K8A Q;  2GDY A;  2ROQ A;  1VKU A;  2VLO A;  4QNB A;  4M0I A;  4BPG A;  4R0M A;  2MR7 A;  4UHP B;  2PEJ A;  4NEO A;  1KC8 Q;  2FQ1 A;  4XRQ A;  3CCQ P;  5JPA A;  2PEN A;  2L6E A;  2MF4 A;  1HY8 A;  5F2K A;  2M8P A;  3G1I A;  5KP8 B;  2XZ0 D;  1YIT P;  2OTL P;  3VRL C;  3GJN A;  1IMP A;  1W2B O;  3Q20 A;  2GZF A;  2AFE A;  2KOQ A;  2PNG A;  2PEQ A;  3GZM A;  1K30 A;  1VQ7 P;  2X2B A;  1VQ6 P;  1AUM A;  3RG2 A;  2JBG A;  3CCE P;  3DS5 A;  1IMQ A;  3RG6 C;  2PEI A;  2FAC A;  4U0C A;  4H2X C;  2GZI A;  1S72 P;  1GXH A;  1VQ8 P;  1E0H A;  1VQO P;  1YJN P;  2ERH A;  5CZD B;  1M90 Q;  2N5I A;  2XXM A;  5HV8 A;  1VQN P;  2XZ1 C;  2WPT A;  2LTE A;  2JU2 A;  2KOS A;  1VQM P;  2N98 A;  2L4B A;  3EJD A;  2FHS C;  2K0Y A;  3B5I A;  2KG8 A;  1KLP A;  2KOO A;  2VLP A;  3HYB A;  3I55 P; 
#chains in the Genus database with same CATH homology
 2GDY A;  2ROQ A;  1VKU A;  3CE7 A;  2FVA A;  4PWV B;  2FAD A;  4R0M A;  2FQ2 A;  1NQ4 A;  2K94 A;  4BPG A;  2MR7 A;  2CQ8 A;  4H2W C;  2KR5 A;  1OR5 A;  2MVV A;  2KOR A;  2DNW A;  4DG9 A;  4NEO A;  2MD9 A;  3LMO A;  1X3O A;  1AF8 A;  5KP6 B;  2FQ1 A;  2EHT A;  2N50 A;  1F80 D;  2MY5 A;  2MF4 A;  1HY8 A;  2L22 A;  2KG6 A;  3EJB A;  4BPF A;  1T8K A;  2AFD A;  2KGE A;  5KP8 B;  2XZ0 D;  1ACP A;  4H2Y C;  2CNR A;  2MR8 A;  2LPK A;  2N6Y A;  2JQ4 A;  5EJD A;  1L0H A;  2JU1 A;  2AF8 A;  5HVC A;  4CA3 A;  2FQ0 A;  2KG9 A;  1DV5 A;  1DNY A;  2JGP A;  2AFE A;  2CG5 B;  1L0I A;  2KOQ A;  2PNG A;  3GZM A;  2N6Z A;  2KGA A;  4MRT C;  2AVA A;  2LKI A;  2X2B A;  4HKG A;  2GDW A;  3RG2 A;  4IZ6 A;  5KP7 B;  2EHS A;  2CGQ A;  2FVE A;  2FAC A;  2K0X A;  2N5H A;  4H2X C;  2KGC A;  2VSQ A;  2KOP A;  3GZL A;  4PXH B;  2KGD A;  2L0Q A;  2LML A;  2FAE A;  5CZD B;  2KWL A;  2K92 A;  2LIU A;  2N5I A;  5HV8 A;  2KW2 A;  3NY7 B;  2FVF A;  2XZ1 C;  2LL8 A;  2LIW A;  2LTE A;  2QNW A;  2JU2 A;  3EJE A;  1HQB A;  2GDX A;  2MVU A;  2L9F A;  2KOS A;  2M5R A;  2N98 A;  2L4B A;  3EJD A;  2FHS C;  2K0Y A;  4BPH A;  2KG8 A;  1KLP A;  2KOO A;  2K93 A;  2LOL A;  2K2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...