1NQ4A

Solution structure of oxytetracycline acyl carrier protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
95
structure length
95
Chain Sequence
MTLLTLSDLLTLLRECAGEEESIDLGGDVEDVAFDALGYDSLALLNTVGRIERDYGVQLGDDAVEKATTPRALIEMTNASLTGASPSAGGAARDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxytetracycline polyketide synthase acyl carrier protein
publication title Solution structure and dynamics of oxytetracycline polyketide synthase acyl carrier protein from Streptomyces rimosus
pubmed doi rcsb
source organism Streptomyces rimosus
molecule tags Biosynthetic protein
total genus 21
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1nq4A00
2AF8A 2FACA 2L22A 2K93A 2LIUA 2K92A 4HKGA 3GZLA 2KOQA 4BPHA 2K94A 2KOOA 2FVFA 3EJDA 2JU1A 3EJBA 2FQ2A 2N5IA 2CNRA 2X2BA 1HY8A 1T8KA 2KGAA 2XZ1C 2PNGA 3CE7A 1DNYA 2KG6A 2MY5A 5EJDA 4H2XC 2JGPA 2KGDA 2KGCA 2LOLA 2N5HA 1X3OA 2MF4A 2FVAA 2LMLA 5HV8A 4MRTC 2KWLA 1HQBA 2XZ0D 2CG5B 2KG9A 2CQ8A 2FHSC 1NQ4A 2AFDA 2DNWA 2LKIA 4NEOA 2KW2A 2N6ZA 2VSQA 2FQ0A 1KLPA 2GDYA 2KOPA 2KOSA 4DG9A 1ACPA 2N6YA 2MD9A 2AVAA 2LL8A 2L0QA 2FAEA 5CZDB 2CGQA 2M5RA 4PWVB 2JU2A 3NY7B 4PXHB 2GDXA 1OR5A 4BPGA 4R0MA 2KORA 1AF8A 4H2YC 2MR8A 4H2WC 3EJEA 3RG2A 4IZ6A 2MVVA 3LMOA 2FVEA 2ROQA 2KR5A 2LPKA 2K0YA 1VKUA 2GDWA 5KP6B 2EHTA 2N98A 1L0IA 2KGEA 2LIWA 2FQ1A 5KP8B 2L4BA 2QNWA 3GZMA 2EHSA 2KG8A 2LTEA 2MR7A 1F80D 5HVCA 2MVUA 2AFEA 2JQ4A 2N50A 1DV5A 2K2QA 4BPFA 5KP7B 2K0XA 2FADA 1L0HA 2L9FA 4CA3A
chains in the Genus database with same CATH superfamily
2FACA 2K92A 4PH1A 2KOQA 3DTJA 2PEJA 2ONTA 1N8RQ 1VQ5P 2N5IA 2CNRA 2KGAA 3CC4P 2PNGA 3CE7A 5EJDA 2LOLA 2MF4A 2FVAA 2LMLA 2PENA 1KQSO 1M74A 1QVFO 1K8AQ 2AFDA 2LKIA 1KC8Q 1K73Q 5HGNA 4U0CA 1YITP 2N6YA 1EOQA 2MD9A 2EFJA 2FAEA 2VLPA 2M5RA 4PWVB 4COCA 1NJIQ 2GDXA 4COPA 3GKLC 2PEKA 5EW5E 2MR8A 2NO8A 3CC2P 3EJEA 2K5XA 2EIAA 4IZ6A 2KODA 2ROQA 2GDWA 7CEIA 2EHTA 2N98A 2ERHA 2GYKA 3CD6P 2OARA 5HGMA 3E2DA 4XFXA 1M1KQ 2LTEA 1VQNP 1CEIA 1M6EX 4BPFA 2EG5A 2K0XA 2VLQA 2L6EA 3CCJP 3CC7P 2AF8A 3I56P 2L22A 3H47A 2LIUA 3GJNA 3CCUP 4BPHA 3CCLP 2PEOA 2K94A 2FVFA 3EJDA 3P05A 2Z44A 2JAZA 2K0DX 2X2BA 1VQ7P 4M0IA 2JB0A 1YJNP 1DNYA 2PEMA 1E0HA 2DGYA 4IPYA 2M8LA 3WBHA 3MGEA 2CG5B 3RG6C 2CQ8A 3G1GA 4XFZA 2VLOA 4NEOA 2Z46A 3G4SP 2FQ0A 3HZQA 3CMAP 3B5IA 1D1DA 1BAJA 2JU2A 3NY7B 3CCQP 4BPGA 4UHPB 4H2YC 1VQ4P 2VLNA 1W2BO 3Q20A 1YIJP 3CXCO 2LPKA 1K9MQ 2JBGA 1IMPA 5KP6B 2LIWA 2FQ1A 2L4BA 3GZMA 1IUQA 5BS2A 1MZ8A 1RO2A 1DV5A 2K2QA 5KP7B 2PEQA 4U0AA 2K93A 4HKGA 3CCRP 4XRQA 3G6EP 3M1MA 2PEIA 2KOOA 1AUMA 3G28A 3EJBA 2FQ2A 1HY8A 1VHNA 3G26A 2P9XA 4XFYA 1VQMP 1GPJA 1JJ2O 2KG6A 2MY5A 5F2NA 4H2XC 3DS4A 3CCVP 2JGPA 3DS0A 2N5HA 1X3OA 3DS2A 4U0BA 4F37A 1YI2P 2BUOA 5HV8A 1FR2A 2KWLA 2XZ0D 4WYMA 3OW2O 2FHSC 5HGLA 2DNWA 3G29A 2N6ZA 2VSQA 2GZIA 3NTEA 4U0EA 4U0DA 3VRLC 1KLPA 1M6NA 1M90Q 2KOSA 1YHQP 1ACPA 3CPWO 2AVAA 3CCEP 2L0QA 4PXHB 4R0MA 2KORA 1S72P 4GR6A 1QVGO 2JYGA 1AF8A 1VQKP 1E6JP 3RG2A 2GZEA 2GZJA 1EMVA 2FVEA 2KR5A 1UJZA 2K0YA 2QEXP 1VKUA 1VQOP 3B4QA 1Q86Q 2JYLA 2KGEA 2XXMA 5KP8B 1ZNVA 2QNWA 1Z6MA 3DS1A 2OTJP 1A43A 3G1IA 3HYBA 1F80D 3G21A 5HVCA 3G71P 5I4TG 1Q81Q 3LRYA 3DPHA 1AYIA 1BXIA 2FADA 3CCSP 4CA3A 3DS3A 1A8OA 2OTLP 3G0VA 2E1MA 3GZLA 5HGOA 5DCKA 1Q82Q 2JU1A 4GR2A 1T8KA 2WPTA 2XZ1C 5F2OA 1GXGA 2KGDA 2KGCA 1VQPP 1QRJA 2JO0A 4MRTC 5BS1A 5JPAA 1HQBA 2KG9A 1UNKA 1NQ4A 3U43A 2KW2A 1VQ9P 4U0FA 4QNBA 1RO0A 2XT1A 2GDYA 2KOPA 4DG9A 2CWOA 1EIAA 1KD1Q 2LL8A 3DS5A 2PY8A 1VQ8P 5CZDB 2CGQA 1K30A 1OR5A 2BHVA 5F2KA 3CCMP 1ZMBA 3I55P 2GZFA 2M8PA 4H2WC 2XV6A 4QKOA 2MVVA 3LMOA 1GXHA 1L0IA 2LF4A 1Q7YQ 2EHSA 3CMEP 2KG8A 1VQLP 2MR7A 2Z45A 3H4EA 2MVUA 4XROA 2AFEA 2JQ4A 2GZGA 2N50A 1VQ6P 1IMQA 3H0DA 2M8NA 1YJWP 1RNIA 4PH0A 2QA4P 1L0HA 2L9FA 1YJ9P
chains in the Genus database with same CATH topology
2AF8A 2FACA 2L22A 2K93A 2LIUA 2K92A 4HKGA 3GZLA 2KOQA 4BPHA 2K94A 2KOOA 2FVFA 3EJDA 2JU1A 3EJBA 2FQ2A 2N5IA 2CNRA 2X2BA 1HY8A 1T8KA 2KGAA 2XZ1C 2PNGA 3CE7A 1DNYA 2KG6A 2MY5A 5EJDA 4H2XC 2JGPA 2KGDA 2KGCA 2LOLA 2N5HA 1X3OA 2MF4A 2FVAA 2LMLA 5HV8A 4MRTC 2KWLA 1HQBA 2XZ0D 2CG5B 2KG9A 2CQ8A 2FHSC 1NQ4A 2AFDA 2DNWA 2LKIA 4NEOA 2KW2A 2N6ZA 2VSQA 2FQ0A 1KLPA 2GDYA 2KOPA 2KOSA 4DG9A 1ACPA 2N6YA 2MD9A 2AVAA 2LL8A 2L0QA 2FAEA 5CZDB 2CGQA 2M5RA 4PWVB 2JU2A 3NY7B 4PXHB 2GDXA 1OR5A 4BPGA 4R0MA 2KORA 1AF8A 4H2YC 2MR8A 4H2WC 3EJEA 3RG2A 4IZ6A 2MVVA 3LMOA 2FVEA 2ROQA 2KR5A 2LPKA 2K0YA 1VKUA 2GDWA 5KP6B 2EHTA 2N98A 1L0IA 2KGEA 2LIWA 2FQ1A 5KP8B 2L4BA 2QNWA 3GZMA 2EHSA 2KG8A 2LTEA 2MR7A 1F80D 5HVCA 2MVUA 2AFEA 2JQ4A 2N50A 1DV5A 2K2QA 4BPFA 5KP7B 2K0XA 2FADA 1L0HA 2L9FA 4CA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AF8 A;  2FAC A;  2L22 A;  2K93 A;  2LIU A;  2K92 A;  4HKG A;  3GZL A;  2KOQ A;  4BPH A;  2K94 A;  2KOO A;  2FVF A;  3EJD A;  2JU1 A;  3EJB A;  2FQ2 A;  2N5I A;  2CNR A;  2X2B A;  1HY8 A;  1T8K A;  2KGA A;  2XZ1 C;  2PNG A;  3CE7 A;  1DNY A;  2KG6 A;  2MY5 A;  5EJD A;  4H2X C;  2JGP A;  2KGD A;  2KGC A;  2LOL A;  2N5H A;  1X3O A;  2MF4 A;  2FVA A;  2LML A;  5HV8 A;  4MRT C;  2KWL A;  1HQB A;  2XZ0 D;  2CG5 B;  2KG9 A;  2CQ8 A;  2FHS C;  1NQ4 A;  2AFD A;  2DNW A;  2LKI A;  4NEO A;  2KW2 A;  2N6Z A;  2VSQ A;  2FQ0 A;  1KLP A;  2GDY A;  2KOP A;  2KOS A;  4DG9 A;  1ACP A;  2N6Y A;  2MD9 A;  2AVA A;  2LL8 A;  2L0Q A;  2FAE A;  5CZD B;  2CGQ A;  2M5R A;  4PWV B;  2JU2 A;  3NY7 B;  4PXH B;  2GDX A;  1OR5 A;  4BPG A;  4R0M A;  2KOR A;  1AF8 A;  4H2Y C;  2MR8 A;  4H2W C;  3EJE A;  3RG2 A;  4IZ6 A;  2MVV A;  3LMO A;  2FVE A;  2ROQ A;  2KR5 A;  2LPK A;  2K0Y A;  1VKU A;  2GDW A;  5KP6 B;  2EHT A;  2N98 A;  1L0I A;  2KGE A;  2LIW A;  2FQ1 A;  5KP8 B;  2L4B A;  2QNW A;  3GZM A;  2EHS A;  2KG8 A;  2LTE A;  2MR7 A;  1F80 D;  5HVC A;  2MVU A;  2AFE A;  2JQ4 A;  2N50 A;  1DV5 A;  2K2Q A;  4BPF A;  5KP7 B;  2K0X A;  2FAD A;  1L0H A;  2L9F A;  4CA3 A; 
#chains in the Genus database with same CATH topology
 2FAC A;  2K92 A;  4PH1 A;  2KOQ A;  3DTJ A;  2PEJ A;  2ONT A;  1N8R Q;  1VQ5 P;  2N5I A;  2CNR A;  2KGA A;  3CC4 P;  2PNG A;  3CE7 A;  5EJD A;  2LOL A;  2MF4 A;  2FVA A;  2LML A;  2PEN A;  1KQS O;  1M74 A;  1QVF O;  1K8A Q;  2AFD A;  2LKI A;  1KC8 Q;  1K73 Q;  5HGN A;  4U0C A;  1YIT P;  2N6Y A;  1EOQ A;  2MD9 A;  2EFJ A;  2FAE A;  2VLP A;  2M5R A;  4PWV B;  4COC A;  1NJI Q;  2GDX A;  4COP A;  3GKL C;  2PEK A;  5EW5 E;  2MR8 A;  2NO8 A;  3CC2 P;  3EJE A;  2K5X A;  2EIA A;  4IZ6 A;  2KOD A;  2ROQ A;  2GDW A;  7CEI A;  2EHT A;  2N98 A;  2ERH A;  2GYK A;  3CD6 P;  2OAR A;  5HGM A;  3E2D A;  4XFX A;  1M1K Q;  2LTE A;  1VQN P;  1CEI A;  1M6E X;  4BPF A;  2EG5 A;  2K0X A;  2VLQ A;  2L6E A;  3CCJ P;  3CC7 P;  2AF8 A;  3I56 P;  2L22 A;  3H47 A;  2LIU A;  3GJN A;  3CCU P;  4BPH A;  3CCL P;  2PEO A;  2K94 A;  2FVF A;  3EJD A;  3P05 A;  2Z44 A;  2JAZ A;  2K0D X;  2X2B A;  1VQ7 P;  4M0I A;  2JB0 A;  1YJN P;  1DNY A;  2PEM A;  1E0H A;  2DGY A;  4IPY A;  2M8L A;  3WBH A;  3MGE A;  2CG5 B;  3RG6 C;  2CQ8 A;  3G1G A;  4XFZ A;  2VLO A;  4NEO A;  2Z46 A;  3G4S P;  2FQ0 A;  3HZQ A;  3CMA P;  3B5I A;  1D1D A;  1BAJ A;  2JU2 A;  3NY7 B;  3CCQ P;  4BPG A;  4UHP B;  4H2Y C;  1VQ4 P;  2VLN A;  1W2B O;  3Q20 A;  1YIJ P;  3CXC O;  2LPK A;  1K9M Q;  2JBG A;  1IMP A;  5KP6 B;  2LIW A;  2FQ1 A;  2L4B A;  3GZM A;  1IUQ A;  5BS2 A;  1MZ8 A;  1RO2 A;  1DV5 A;  2K2Q A;  5KP7 B;  2PEQ A;  4U0A A;  2K93 A;  4HKG A;  3CCR P;  4XRQ A;  3G6E P;  3M1M A;  2PEI A;  2KOO A;  1AUM A;  3G28 A;  3EJB A;  2FQ2 A;  1HY8 A;  1VHN A;  3G26 A;  2P9X A;  4XFY A;  1VQM P;  1GPJ A;  1JJ2 O;  2KG6 A;  2MY5 A;  5F2N A;  4H2X C;  3DS4 A;  3CCV P;  2JGP A;  3DS0 A;  2N5H A;  1X3O A;  3DS2 A;  4U0B A;  4F37 A;  1YI2 P;  2BUO A;  5HV8 A;  1FR2 A;  2KWL A;  2XZ0 D;  4WYM A;  3OW2 O;  2FHS C;  5HGL A;  2DNW A;  3G29 A;  2N6Z A;  2VSQ A;  2GZI A;  3NTE A;  4U0E A;  4U0D A;  3VRL C;  1KLP A;  1M6N A;  1M90 Q;  2KOS A;  1YHQ P;  1ACP A;  3CPW O;  2AVA A;  3CCE P;  2L0Q A;  4PXH B;  4R0M A;  2KOR A;  1S72 P;  4GR6 A;  1QVG O;  2JYG A;  1AF8 A;  1VQK P;  1E6J P;  3RG2 A;  2GZE A;  2GZJ A;  1EMV A;  2FVE A;  2KR5 A;  1UJZ A;  2K0Y A;  2QEX P;  1VKU A;  1VQO P;  3B4Q A;  1Q86 Q;  2JYL A;  2KGE A;  2XXM A;  5KP8 B;  1ZNV A;  2QNW A;  1Z6M A;  3DS1 A;  2OTJ P;  1A43 A;  3G1I A;  3HYB A;  1F80 D;  3G21 A;  5HVC A;  3G71 P;  5I4T G;  1Q81 Q;  3LRY A;  3DPH A;  1AYI A;  1BXI A;  2FAD A;  3CCS P;  4CA3 A;  3DS3 A;  1A8O A;  2OTL P;  3G0V A;  2E1M A;  3GZL A;  5HGO A;  5DCK A;  1Q82 Q;  2JU1 A;  4GR2 A;  1T8K A;  2WPT A;  2XZ1 C;  5F2O A;  1GXG A;  2KGD A;  2KGC A;  1VQP P;  1QRJ A;  2JO0 A;  4MRT C;  5BS1 A;  5JPA A;  1HQB A;  2KG9 A;  1UNK A;  1NQ4 A;  3U43 A;  2KW2 A;  1VQ9 P;  4U0F A;  4QNB A;  1RO0 A;  2XT1 A;  2GDY A;  2KOP A;  4DG9 A;  2CWO A;  1EIA A;  1KD1 Q;  2LL8 A;  3DS5 A;  2PY8 A;  1VQ8 P;  5CZD B;  2CGQ A;  1K30 A;  1OR5 A;  2BHV A;  5F2K A;  3CCM P;  1ZMB A;  3I55 P;  2GZF A;  2M8P A;  4H2W C;  2XV6 A;  4QKO A;  2MVV A;  3LMO A;  1GXH A;  1L0I A;  2LF4 A;  1Q7Y Q;  2EHS A;  3CME P;  2KG8 A;  1VQL P;  2MR7 A;  2Z45 A;  3H4E A;  2MVU A;  4XRO A;  2AFE A;  2JQ4 A;  2GZG A;  2N50 A;  1VQ6 P;  1IMQ A;  3H0D A;  2M8N A;  1YJW P;  1RNI A;  4PH0 A;  2QA4 P;  1L0H A;  2L9F A;  1YJ9 P; 
#chains in the Genus database with same CATH homology
 2AF8 A;  2FAC A;  2L22 A;  2K93 A;  2LIU A;  2K92 A;  4HKG A;  3GZL A;  2KOQ A;  4BPH A;  2K94 A;  2KOO A;  2FVF A;  3EJD A;  2JU1 A;  3EJB A;  2FQ2 A;  2N5I A;  2CNR A;  2X2B A;  1HY8 A;  1T8K A;  2KGA A;  2XZ1 C;  2PNG A;  3CE7 A;  1DNY A;  2KG6 A;  2MY5 A;  5EJD A;  4H2X C;  2JGP A;  2KGD A;  2KGC A;  2LOL A;  2N5H A;  1X3O A;  2MF4 A;  2FVA A;  2LML A;  5HV8 A;  4MRT C;  2KWL A;  1HQB A;  2XZ0 D;  2CG5 B;  2KG9 A;  2CQ8 A;  2FHS C;  1NQ4 A;  2AFD A;  2DNW A;  2LKI A;  4NEO A;  2KW2 A;  2N6Z A;  2VSQ A;  2FQ0 A;  1KLP A;  2GDY A;  2KOP A;  2KOS A;  4DG9 A;  1ACP A;  2N6Y A;  2MD9 A;  2AVA A;  2LL8 A;  2L0Q A;  2FAE A;  5CZD B;  2CGQ A;  2M5R A;  4PWV B;  2JU2 A;  3NY7 B;  4PXH B;  2GDX A;  1OR5 A;  4BPG A;  4R0M A;  2KOR A;  1AF8 A;  4H2Y C;  2MR8 A;  4H2W C;  3EJE A;  3RG2 A;  4IZ6 A;  2MVV A;  3LMO A;  2FVE A;  2ROQ A;  2KR5 A;  2LPK A;  2K0Y A;  1VKU A;  2GDW A;  5KP6 B;  2EHT A;  2N98 A;  1L0I A;  2KGE A;  2LIW A;  2FQ1 A;  5KP8 B;  2L4B A;  2QNW A;  3GZM A;  2EHS A;  2KG8 A;  2LTE A;  2MR7 A;  1F80 D;  5HVC A;  2MVU A;  2AFE A;  2JQ4 A;  2N50 A;  1DV5 A;  2K2Q A;  4BPF A;  5KP7 B;  2K0X A;  2FAD A;  1L0H A;  2L9F A;  4CA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...