4NEOA

Structure of blmi, a type-ii acyl-carrier-protein from streptomyces verticillus involved in bleomycin biosynthesis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
82
Chain Sequence
APRGERTRRRALERDIAAIWAETLGRDSVGPHEDFAALGGNSIHAIITNRVEELVDAELSIRVLLETRTVAGMTDHVHATLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Peptide synthetase NRPS type II-PCP
publication title The crystal structure of BlmI as a model for nonribosomal peptide synthetase peptidyl carrier proteins.
pubmed doi rcsb
source organism Streptomyces verticillus
total genus 29
structure length 82
sequence length 83
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4neoA00
2L4BA 2MF4A 2KORA 2L22A 2CGQA 3GZMA 2PNGA 2JQ4A 1KLPA 2GDXA 1DNYA 2JGPA 4BPHA 2FADA 2FQ2A 2LIWA 2KR5A 4H2WC 2KGAA 1HQBA 2KG8A 1HY8A 3EJBA 3EJEA 2KG6A 2KGDA 2MD9A 2AVAA 2N6YA 4HKGA 2KG9A 3LMOA 3RG2A 2MR8A 3CE7A 1OR5A 2CG5B 2XZ0D 2FQ1A 1L0IA 1L0HA 2N98A 1NQ4A 2L0QA 4MRTC 4H2YC 2CNRA 1T8KA 2X2BA 2K93A 2N5HA 2CQ8A 2FQ0A 4NEOA 4DG9A 2LKIA 2KGCA 2DNWA 2GDWA 5EJDA 4CA3A 1ACPA 2LL8A 3NY7B 5KP8B 2KOQA 2K2QA 4BPGA 2KW2A 4PXHB 2ROQA 1X3OA 1VKUA 1DV5A 2K94A 2MR7A 3EJDA 2AF8A 5KP7B 2MY5A 2N6ZA 2AFDA 2KOOA 5HVCA 4R0MA 2FVEA 2LPKA 2QNWA 2LIUA 4H2XC 2FVAA 2MVVA 2LOLA 2FAEA 1F80D 2JU2A 2FACA 2KGEA 2FHSC 2LMLA 4PWVB 2K0XA 2KWLA 2EHTA 2AFEA 2GDYA 5HV8A 2N5IA 2XZ1C 1AF8A 2KOSA 2MVUA 2EHSA 5KP6B 2K0YA 3GZLA 2L9FA 2LTEA 2KOPA 2VSQA 2FVFA 2JU1A 4BPFA 2N50A 2M5RA 2K92A 4IZ6A 5CZDB
chains in the Genus database with same CATH superfamily
1VQLP 3DS3A 2MF4A 2CGQA 1KLPA 3H47A 1VQ9P 2JGPA 2FADA 2LIWA 2KR5A 1VHNA 3CPWO 2KODA 4H2WC 2KGAA 3EJBA 2KG6A 2MD9A 1Q81Q 2WPTA 1EIAA 1VQ4P 2QEXP 1VQOP 1L0IA 3DS2A 4MRTC 2CNRA 1T8KA 1M74A 2K93A 1N8RQ 3NTEA 4DG9A 1GPJA 3G26A 1AUMA 2DNWA 4XROA 1YJ9P 1YI2P 4CA3A 1FR2A 1ACPA 1YJNP 3NY7B 3DS0A 2EFJA 3I55P 2DGYA 2MR7A 5HGMA 2MY5A 2N6ZA 5HVCA 2FVEA 3MGEA 2EIAA 2FAEA 3CC2P 2M8NA 2XT1A 2KGEA 1IMPA 2VLPA 5BS1A 3HZQA 2PEOA 1E0HA 3OW2O 2GYKA 2ERHA 2OTJP 3B4QA 2KOSA 2BHVA 1KD1Q 3G1GA 4U0CA 2JO0A 2L9FA 1VQ8P 2N50A 3DTJA 1EMVA 4GR6A 3E2DA 2KORA 2L22A 3GZMA 1DNYA 5JPAA 4BPHA 3CCMP 2FQ2A 1HQBA 2PEQA 3EJEA 2KGDA 1YITP 2KG9A 1QVFO 3RG2A 1ZMBA 2MR8A 3CCEP 1GXGA 2XZ0D 1NQ4A 5F2NA 1NJIQ 2X2BA 1Q86Q 2OTLP 2N5HA 2CQ8A 4U0DA 1E6JP 1JJ2O 2GDWA 1W2BO 2JAZA 7CEIA 1QRJA 4PXHB 2ROQA 3G21A 3HYBA 2PEIA 3CCLP 1VKUA 1DV5A 1VQ5P 5KP7B 2VLOA 3DS5A 3CCQP 2BUOA 3B5IA 4XFYA 4R0MA 2QNWA 1A43A 1IUQA 2M8PA 2JU2A 2NO8A 4U0AA 2FACA 3VRLC 2FHSC 5HGNA 4PWVB 4QNBA 5DCKA 2AFEA 2GDYA 3G6EP 4XFXA 3Q20A 1BXIA 5HGOA 2Z45A 2VLQA 2PENA 2EHSA 5KP6B 2K0YA 2L6EA 1CEIA 2LTEA 3P05A 1K8AQ 5EW5E 3CC4P 1KQSO 2FVFA 4BPFA 1BAJA 3H4EA 4IZ6A 2XXMA 5CZDB 5BS2A 4U0EA 2PNGA 2JQ4A 2GDXA 2XV6A 4COPA 2OARA 2EG5A 2KG8A 3DS1A 1EOQA 1VQ6P 1OR5A 3RG6C 4U0FA 4WYMA 1YIJP 2FQ1A 1Q82Q 2L0QA 1UNKA 4H2YC 1VQKP 2ONTA 2FQ0A 2JYLA 2LKIA 4UHPB 3M1MA 3H0DA 1RO2A 2KGCA 1Q7YQ 3G28A 5EJDA 5HGLA 5KP8B 5I4TG 2K2QA 4BPGA 1A8OA 3CD6P 1X3OA 2LF4A 1M6EX 2K94A 2GZGA 2GZIA 2AF8A 1D1DA 2Z46A 2AFDA 2E1MA 4IPYA 1K9MQ 3DS4A 2LPKA 4U0BA 2LIUA 4H2XC 2MVVA 1GXHA 3G1IA 4XRQA 1F80D 3G0VA 3G4SP 2PEMA 1IMQA 2K0XA 2KWLA 3CCUP 3G29A 1AYIA 4QKOA 4M0IA 2QA4P 2VLNA 4PH0A 2EHTA 2CWOA 2PEKA 5HV8A 2N5IA 3G71P 1M1KQ 1VQMP 3GJNA 2XZ1C 3CCSP 1YHQP 2MVUA 1YJWP 3GZLA 2KOPA 1ZNVA 2JU1A 3DPHA 1S72P 2JYGA 2K92A 3LRYA 2GZEA 2L4BA 2JB0A 1QVGO 3GKLC 1M6NA 3CCJP 1HY8A 1RNIA 4PH1A 2AVAA 2N6YA 4HKGA 4COCA 2M8LA 3LMOA 3CE7A 1VQNP 2CG5B 3CMEP 2K0DX 2Z44A 4GR2A 1L0HA 2N98A 4F37A 1MZ8A 1K30A 4NEOA 2GZFA 5F2OA 2LL8A 2KOQA 5F2KA 1K73Q 2KW2A 3CC7P 2JBGA 3CXCO 3CCVP 2P9XA 3EJDA 2PY8A 2KOOA 2K5XA 2FVAA 2LOLA 1RO0A 3WBHA 1VQ7P 2LMLA 4XFZA 3CMAP 3U43A 2GZJA 1Z6MA 1VQPP 1AF8A 2PEJA 2VSQA 3CCRP 1KC8Q 1UJZA 2M5RA 1M90Q 3I56P
chains in the Genus database with same CATH topology
2L4BA 2MF4A 2KORA 2L22A 2CGQA 3GZMA 2PNGA 2JQ4A 1KLPA 2GDXA 1DNYA 2JGPA 4BPHA 2FADA 2FQ2A 2LIWA 2KR5A 4H2WC 2KGAA 1HQBA 2KG8A 1HY8A 3EJBA 3EJEA 2KG6A 2KGDA 2MD9A 2AVAA 2N6YA 4HKGA 2KG9A 3LMOA 3RG2A 2MR8A 3CE7A 1OR5A 2CG5B 2XZ0D 2FQ1A 1L0IA 1L0HA 2N98A 1NQ4A 2L0QA 4MRTC 4H2YC 2CNRA 1T8KA 2X2BA 2K93A 2N5HA 2CQ8A 2FQ0A 4NEOA 4DG9A 2LKIA 2KGCA 2DNWA 2GDWA 5EJDA 4CA3A 1ACPA 2LL8A 3NY7B 5KP8B 2KOQA 2K2QA 4BPGA 2KW2A 4PXHB 2ROQA 1X3OA 1VKUA 1DV5A 2K94A 2MR7A 3EJDA 2AF8A 5KP7B 2MY5A 2N6ZA 2AFDA 2KOOA 5HVCA 4R0MA 2FVEA 2LPKA 2QNWA 2LIUA 4H2XC 2FVAA 2MVVA 2LOLA 2FAEA 1F80D 2JU2A 2FACA 2KGEA 2FHSC 2LMLA 4PWVB 2K0XA 2KWLA 2EHTA 2AFEA 2GDYA 5HV8A 2N5IA 2XZ1C 1AF8A 2KOSA 2MVUA 2EHSA 5KP6B 2K0YA 3GZLA 2L9FA 2LTEA 2KOPA 2VSQA 2FVFA 2JU1A 4BPFA 2N50A 2M5RA 2K92A 4IZ6A 5CZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4B A;  2MF4 A;  2KOR A;  2L22 A;  2CGQ A;  3GZM A;  2PNG A;  2JQ4 A;  1KLP A;  2GDX A;  1DNY A;  2JGP A;  4BPH A;  2FAD A;  2FQ2 A;  2LIW A;  2KR5 A;  4H2W C;  2KGA A;  1HQB A;  2KG8 A;  1HY8 A;  3EJB A;  3EJE A;  2KG6 A;  2KGD A;  2MD9 A;  2AVA A;  2N6Y A;  4HKG A;  2KG9 A;  3LMO A;  3RG2 A;  2MR8 A;  3CE7 A;  1OR5 A;  2CG5 B;  2XZ0 D;  2FQ1 A;  1L0I A;  1L0H A;  2N98 A;  1NQ4 A;  2L0Q A;  4MRT C;  4H2Y C;  2CNR A;  1T8K A;  2X2B A;  2K93 A;  2N5H A;  2CQ8 A;  2FQ0 A;  4NEO A;  4DG9 A;  2LKI A;  2KGC A;  2DNW A;  2GDW A;  5EJD A;  4CA3 A;  1ACP A;  2LL8 A;  3NY7 B;  5KP8 B;  2KOQ A;  2K2Q A;  4BPG A;  2KW2 A;  4PXH B;  2ROQ A;  1X3O A;  1VKU A;  1DV5 A;  2K94 A;  2MR7 A;  3EJD A;  2AF8 A;  5KP7 B;  2MY5 A;  2N6Z A;  2AFD A;  2KOO A;  5HVC A;  4R0M A;  2FVE A;  2LPK A;  2QNW A;  2LIU A;  4H2X C;  2FVA A;  2MVV A;  2LOL A;  2FAE A;  1F80 D;  2JU2 A;  2FAC A;  2KGE A;  2FHS C;  2LML A;  4PWV B;  2K0X A;  2KWL A;  2EHT A;  2AFE A;  2GDY A;  5HV8 A;  2N5I A;  2XZ1 C;  1AF8 A;  2KOS A;  2MVU A;  2EHS A;  5KP6 B;  2K0Y A;  3GZL A;  2L9F A;  2LTE A;  2KOP A;  2VSQ A;  2FVF A;  2JU1 A;  4BPF A;  2N50 A;  2M5R A;  2K92 A;  4IZ6 A;  5CZD B; 
#chains in the Genus database with same CATH topology
 1VQL P;  3DS3 A;  2MF4 A;  2CGQ A;  1KLP A;  3H47 A;  1VQ9 P;  2JGP A;  2FAD A;  2LIW A;  2KR5 A;  1VHN A;  3CPW O;  2KOD A;  4H2W C;  2KGA A;  3EJB A;  2KG6 A;  2MD9 A;  1Q81 Q;  2WPT A;  1EIA A;  1VQ4 P;  2QEX P;  1VQO P;  1L0I A;  3DS2 A;  4MRT C;  2CNR A;  1T8K A;  1M74 A;  2K93 A;  1N8R Q;  3NTE A;  4DG9 A;  1GPJ A;  3G26 A;  1AUM A;  2DNW A;  4XRO A;  1YJ9 P;  1YI2 P;  4CA3 A;  1FR2 A;  1ACP A;  1YJN P;  3NY7 B;  3DS0 A;  2EFJ A;  3I55 P;  2DGY A;  2MR7 A;  5HGM A;  2MY5 A;  2N6Z A;  5HVC A;  2FVE A;  3MGE A;  2EIA A;  2FAE A;  3CC2 P;  2M8N A;  2XT1 A;  2KGE A;  1IMP A;  2VLP A;  5BS1 A;  3HZQ A;  2PEO A;  1E0H A;  3OW2 O;  2GYK A;  2ERH A;  2OTJ P;  3B4Q A;  2KOS A;  2BHV A;  1KD1 Q;  3G1G A;  4U0C A;  2JO0 A;  2L9F A;  1VQ8 P;  2N50 A;  3DTJ A;  1EMV A;  4GR6 A;  3E2D A;  2KOR A;  2L22 A;  3GZM A;  1DNY A;  5JPA A;  4BPH A;  3CCM P;  2FQ2 A;  1HQB A;  2PEQ A;  3EJE A;  2KGD A;  1YIT P;  2KG9 A;  1QVF O;  3RG2 A;  1ZMB A;  2MR8 A;  3CCE P;  1GXG A;  2XZ0 D;  1NQ4 A;  5F2N A;  1NJI Q;  2X2B A;  1Q86 Q;  2OTL P;  2N5H A;  2CQ8 A;  4U0D A;  1E6J P;  1JJ2 O;  2GDW A;  1W2B O;  2JAZ A;  7CEI A;  1QRJ A;  4PXH B;  2ROQ A;  3G21 A;  3HYB A;  2PEI A;  3CCL P;  1VKU A;  1DV5 A;  1VQ5 P;  5KP7 B;  2VLO A;  3DS5 A;  3CCQ P;  2BUO A;  3B5I A;  4XFY A;  4R0M A;  2QNW A;  1A43 A;  1IUQ A;  2M8P A;  2JU2 A;  2NO8 A;  4U0A A;  2FAC A;  3VRL C;  2FHS C;  5HGN A;  4PWV B;  4QNB A;  5DCK A;  2AFE A;  2GDY A;  3G6E P;  4XFX A;  3Q20 A;  1BXI A;  5HGO A;  2Z45 A;  2VLQ A;  2PEN A;  2EHS A;  5KP6 B;  2K0Y A;  2L6E A;  1CEI A;  2LTE A;  3P05 A;  1K8A Q;  5EW5 E;  3CC4 P;  1KQS O;  2FVF A;  4BPF A;  1BAJ A;  3H4E A;  4IZ6 A;  2XXM A;  5CZD B;  5BS2 A;  4U0E A;  2PNG A;  2JQ4 A;  2GDX A;  2XV6 A;  4COP A;  2OAR A;  2EG5 A;  2KG8 A;  3DS1 A;  1EOQ A;  1VQ6 P;  1OR5 A;  3RG6 C;  4U0F A;  4WYM A;  1YIJ P;  2FQ1 A;  1Q82 Q;  2L0Q A;  1UNK A;  4H2Y C;  1VQK P;  2ONT A;  2FQ0 A;  2JYL A;  2LKI A;  4UHP B;  3M1M A;  3H0D A;  1RO2 A;  2KGC A;  1Q7Y Q;  3G28 A;  5EJD A;  5HGL A;  5KP8 B;  5I4T G;  2K2Q A;  4BPG A;  1A8O A;  3CD6 P;  1X3O A;  2LF4 A;  1M6E X;  2K94 A;  2GZG A;  2GZI A;  2AF8 A;  1D1D A;  2Z46 A;  2AFD A;  2E1M A;  4IPY A;  1K9M Q;  3DS4 A;  2LPK A;  4U0B A;  2LIU A;  4H2X C;  2MVV A;  1GXH A;  3G1I A;  4XRQ A;  1F80 D;  3G0V A;  3G4S P;  2PEM A;  1IMQ A;  2K0X A;  2KWL A;  3CCU P;  3G29 A;  1AYI A;  4QKO A;  4M0I A;  2QA4 P;  2VLN A;  4PH0 A;  2EHT A;  2CWO A;  2PEK A;  5HV8 A;  2N5I A;  3G71 P;  1M1K Q;  1VQM P;  3GJN A;  2XZ1 C;  3CCS P;  1YHQ P;  2MVU A;  1YJW P;  3GZL A;  2KOP A;  1ZNV A;  2JU1 A;  3DPH A;  1S72 P;  2JYG A;  2K92 A;  3LRY A;  2GZE A;  2L4B A;  2JB0 A;  1QVG O;  3GKL C;  1M6N A;  3CCJ P;  1HY8 A;  1RNI A;  4PH1 A;  2AVA A;  2N6Y A;  4HKG A;  4COC A;  2M8L A;  3LMO A;  3CE7 A;  1VQN P;  2CG5 B;  3CME P;  2K0D X;  2Z44 A;  4GR2 A;  1L0H A;  2N98 A;  4F37 A;  1MZ8 A;  1K30 A;  4NEO A;  2GZF A;  5F2O A;  2LL8 A;  2KOQ A;  5F2K A;  1K73 Q;  2KW2 A;  3CC7 P;  2JBG A;  3CXC O;  3CCV P;  2P9X A;  3EJD A;  2PY8 A;  2KOO A;  2K5X A;  2FVA A;  2LOL A;  1RO0 A;  3WBH A;  1VQ7 P;  2LML A;  4XFZ A;  3CMA P;  3U43 A;  2GZJ A;  1Z6M A;  1VQP P;  1AF8 A;  2PEJ A;  2VSQ A;  3CCR P;  1KC8 Q;  1UJZ A;  2M5R A;  1M90 Q;  3I56 P; 
#chains in the Genus database with same CATH homology
 2L4B A;  2MF4 A;  2KOR A;  2L22 A;  2CGQ A;  3GZM A;  2PNG A;  2JQ4 A;  1KLP A;  2GDX A;  1DNY A;  2JGP A;  4BPH A;  2FAD A;  2FQ2 A;  2LIW A;  2KR5 A;  4H2W C;  2KGA A;  1HQB A;  2KG8 A;  1HY8 A;  3EJB A;  3EJE A;  2KG6 A;  2KGD A;  2MD9 A;  2AVA A;  2N6Y A;  4HKG A;  2KG9 A;  3LMO A;  3RG2 A;  2MR8 A;  3CE7 A;  1OR5 A;  2CG5 B;  2XZ0 D;  2FQ1 A;  1L0I A;  1L0H A;  2N98 A;  1NQ4 A;  2L0Q A;  4MRT C;  4H2Y C;  2CNR A;  1T8K A;  2X2B A;  2K93 A;  2N5H A;  2CQ8 A;  2FQ0 A;  4NEO A;  4DG9 A;  2LKI A;  2KGC A;  2DNW A;  2GDW A;  5EJD A;  4CA3 A;  1ACP A;  2LL8 A;  3NY7 B;  5KP8 B;  2KOQ A;  2K2Q A;  4BPG A;  2KW2 A;  4PXH B;  2ROQ A;  1X3O A;  1VKU A;  1DV5 A;  2K94 A;  2MR7 A;  3EJD A;  2AF8 A;  5KP7 B;  2MY5 A;  2N6Z A;  2AFD A;  2KOO A;  5HVC A;  4R0M A;  2FVE A;  2LPK A;  2QNW A;  2LIU A;  4H2X C;  2FVA A;  2MVV A;  2LOL A;  2FAE A;  1F80 D;  2JU2 A;  2FAC A;  2KGE A;  2FHS C;  2LML A;  4PWV B;  2K0X A;  2KWL A;  2EHT A;  2AFE A;  2GDY A;  5HV8 A;  2N5I A;  2XZ1 C;  1AF8 A;  2KOS A;  2MVU A;  2EHS A;  5KP6 B;  2K0Y A;  3GZL A;  2L9F A;  2LTE A;  2KOP A;  2VSQ A;  2FVF A;  2JU1 A;  4BPF A;  2N50 A;  2M5R A;  2K92 A;  4IZ6 A;  5CZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...