4NEOA

Structure of blmi, a type-ii acyl-carrier-protein from streptomyces verticillus involved in bleomycin biosynthesis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
82
Chain Sequence
APRGERTRRRALERDIAAIWAETLGRDSVGPHEDFAALGGNSIHAIITNRVEELVDAELSIRVLLETRTVAGMTDHVHATLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide synthetase NRPS type II-PCP
publication title The crystal structure of BlmI as a model for nonribosomal peptide synthetase peptidyl carrier proteins.
pubmed doi rcsb
source organism Streptomyces verticillus
molecule tags Ligase
total genus 29
structure length 82
sequence length 83
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4neoA00
2LPKA 2L9FA 2LIUA 2QNWA 2CQ8A 2LKIA 2EHTA 2KWLA 2LIWA 2K94A 2PNGA 4H2WC 1DNYA 1VKUA 2L22A 2K93A 2MR7A 4IZ6A 2FAEA 2LL8A 5CZDB 2GDYA 1OR5A 2LTEA 3EJEA 5HV8A 2JQ4A 2FADA 2KOPA 2MF4A 3EJDA 2CNRA 2GDWA 4BPFA 4PXHB 2KG9A 2KOQA 2N5HA 5EJDA 5KP6B 2KG8A 3EJBA 2AFEA 2KORA 2XZ1C 2K92A 2FQ1A 1L0HA 2MVVA 1KLPA 2KGCA 2KGEA 1ACPA 3GZLA 4BPHA 2FHSC 1DV5A 4DG9A 2KOSA 2MD9A 1NQ4A 3LMOA 2MY5A 1HY8A 2KGDA 2LOLA 2VSQA 2AFDA 4BPGA 2L0QA 4PWVB 2KGAA 2GDXA 2L4BA 1L0IA 2JU2A 2K0XA 2LMLA 4HKGA 4NEOA 2JGPA 2JU1A 1X3OA 2KG6A 4R0MA 2N6ZA 2EHSA 2FVFA 5HVCA 5KP7B 2FQ0A 1F80D 2AVAA 2MVUA 4H2YC 2X2BA 2K2QA 2ROQA 2N5IA 5KP8B 3CE7A 1HQBA 3NY7B 2FVEA 2N98A 2XZ0D 2KOOA 2MR8A 2K0YA 1AF8A 4MRTC 2M5RA 2N50A 1T8KA 2FQ2A 2DNWA 2N6YA 2AF8A 2FVAA 2KR5A 3GZMA 2KW2A 4H2XC 4CA3A 3RG2A 2CGQA 2CG5B 2FACA
chains in the Genus database with same CATH superfamily
2LIUA 2CQ8A 1VQ5P 5JPAA 2LIWA 2PNGA 5I4TG 4H2WC 2KODA 5BS2A 2LL8A 5CZDB 2VLPA 1A8OA 2QEXP 1OR5A 1VQNP 2M8PA 3EJEA 5HV8A 2FADA 2CNRA 2OARA 5DCKA 3CCLP 2LF4A 1VQPP 3DS5A 2PEIA 3GJNA 3EJBA 2K5XA 1QVFO 2K92A 2FQ1A 4F37A 1EOQA 2MVVA 1KLPA 1YI2P 3Q20A 1IMPA 2CWOA 2KOSA 2MD9A 4COCA 1QVGO 3CCMP 1HY8A 3I55P 1Q7YQ 4U0AA 2KGAA 2JO0A 2JU2A 4IPYA 1YHQP 4HKGA 4XFYA 3P05A 1X3OA 1EIAA 4R0MA 5HGMA 2ONTA 2N6ZA 3G71P 3OW2O 5KP7B 2BUOA 3M1MA 2FQ0A 1M1KQ 2AVAA 2X2BA 2EG5A 3DS1A 5KP8B 1HQBA 3CCSP 1AF8A 3CCVP 1RO0A 1T8KA 2FQ2A 2N6YA 3DS0A 1EMVA 2Z44A 1GPJA 3H4EA 3G28A 3RG2A 2CG5B 4WYMA 2LPKA 2L9FA 4GR2A 2QNWA 3DS4A 3G4SP 1E6JP 3CCEP 2LKIA 3MGEA 4XROA 3LRYA 1DNYA 1VQ6P 1VKUA 1VQLP 1ZNVA 2K0DX 3RG6C 2Z45A 4U0DA 4XRQA 2KOPA 3B5IA 3EJDA 1D1DA 1Z6MA 3CC2P 4PXHB 4QNBA 4XFXA 2KOQA 2N5HA 5HGNA 2AFEA 2KORA 1K30A 2XZ1C 1L0HA 2KGEA 2FHSC 1M6EX 2JBGA 3LMOA 2MY5A 2PEOA 2LOLA 3DS2A 3HZQA 2AFDA 1S72P 1GXHA 2L6EA 2L4BA 1L0IA 3H47A 5F2OA 2K0XA 4NEOA 2VLQA 2VLNA 3G26A 1KC8Q 1MZ8A 3DPHA 2XT1A 5HVCA 3G1IA 1UNKA 1F80D 1A43A 2PEQA 3NTEA 2WPTA 3G21A 2VLOA 2FVEA 3U43A 2MR8A 2K0YA 1JJ2O 3DS3A 1BXIA 1VHNA 1E0HA 1VQ9P 1IUQA 2FVAA 3CCQP 3CXCO 1Q82Q 1GXGA 2E1MA 1YJ9P 2PEKA 3CCUP 2PEJA 5BS1A 1BAJA 2K94A 4IZ6A 2GDYA 1VQ8P 2LTEA 4QKOA 2JQ4A 2NO8A 2MF4A 1NJIQ 3CPWO 5HGLA 1YJWP 3G29A 1YITP 4PH0A 3CD6P 5EJDA 1YJNP 1IMQA 4BPHA 1DV5A 5F2NA 5EW5E 1NQ4A 2PENA 2EIAA 2KGDA 3WBHA 2GZIA 5HGOA 2JYGA 2PEMA 4U0EA 1ZMBA 2JU1A 2JAZA 3CMAP 1M6NA 2EHSA 2FVFA 1M74A 1KD1Q 2GZJA 2MVUA 4H2YC 2K2QA 4PH1A 3CE7A 3NY7B 1UJZA 2N98A 2M8LA 2XV6A 2XZ0D 2KOOA 2P9XA 2OTJP 4MRTC 2OTLP 1VQ4P 2N50A 1M90Q 2BHVA 1K9MQ 2KR5A 3GZMA 2KW2A 1N8RQ 4CA3A 4XFZA 2QA4P 3DTJA 2GZGA 2CGQA 4U0BA 2EHTA 2KWLA 2L22A 2K93A 2MR7A 4GR6A 2M8NA 1RNIA 2FAEA 4COPA 3VRLC 3CCJP 3I56P 1YIJP 2GDWA 4BPFA 5F2KA 1Q81Q 3G6EP 2KG9A 4U0CA 3G1GA 5KP6B 2KG8A 2GYKA 1CEIA 2PY8A 4UHPB 2KGCA 1ACPA 3GZLA 2ERHA 3CC7P 4DG9A 1W2BO 1VQKP 2JYLA 3CC4P 2VSQA 1VQMP 4BPGA 1VQ7P 2L0QA 4PWVB 2GDXA 1K73Q 3E2DA 3HYBA 2LMLA 1AUMA 2GZEA 3CMEP 2JGPA 2KG6A 2GZFA 2DGYA 1QRJA 3H0DA 1VQOP 1AYIA 1KQSO 1FR2A 2ROQA 2N5IA 1Q86Q 1K8AQ 3G0VA 7CEIA 3GKLC 2EFJA 2M5RA 2DNWA 4M0IA 4U0FA 2AF8A 2Z46A 2XXMA 4H2XC 3CCRP 1RO2A 3B4QA 2JB0A 2FACA
chains in the Genus database with same CATH topology
2LPKA 2L9FA 2LIUA 2QNWA 2CQ8A 2LKIA 2EHTA 2KWLA 2LIWA 2K94A 2PNGA 4H2WC 1DNYA 1VKUA 2L22A 2K93A 2MR7A 4IZ6A 2FAEA 2LL8A 5CZDB 2GDYA 1OR5A 2LTEA 3EJEA 5HV8A 2JQ4A 2FADA 2KOPA 2MF4A 3EJDA 2CNRA 2GDWA 4BPFA 4PXHB 2KG9A 2KOQA 2N5HA 5EJDA 5KP6B 2KG8A 3EJBA 2AFEA 2KORA 2XZ1C 2K92A 2FQ1A 1L0HA 2MVVA 1KLPA 2KGCA 2KGEA 1ACPA 3GZLA 4BPHA 2FHSC 1DV5A 4DG9A 2KOSA 2MD9A 1NQ4A 3LMOA 2MY5A 1HY8A 2KGDA 2LOLA 2VSQA 2AFDA 4BPGA 2L0QA 4PWVB 2KGAA 2GDXA 2L4BA 1L0IA 2JU2A 2K0XA 2LMLA 4HKGA 4NEOA 2JGPA 2JU1A 1X3OA 2KG6A 4R0MA 2N6ZA 2EHSA 2FVFA 5HVCA 5KP7B 2FQ0A 1F80D 2AVAA 2MVUA 4H2YC 2X2BA 2K2QA 2ROQA 2N5IA 5KP8B 3CE7A 1HQBA 3NY7B 2FVEA 2N98A 2XZ0D 2KOOA 2MR8A 2K0YA 1AF8A 4MRTC 2M5RA 2N50A 1T8KA 2FQ2A 2DNWA 2N6YA 2AF8A 2FVAA 2KR5A 3GZMA 2KW2A 4H2XC 4CA3A 3RG2A 2CGQA 2CG5B 2FACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPK A;  2L9F A;  2LIU A;  2QNW A;  2CQ8 A;  2LKI A;  2EHT A;  2KWL A;  2LIW A;  2K94 A;  2PNG A;  4H2W C;  1DNY A;  1VKU A;  2L22 A;  2K93 A;  2MR7 A;  4IZ6 A;  2FAE A;  2LL8 A;  5CZD B;  2GDY A;  1OR5 A;  2LTE A;  3EJE A;  5HV8 A;  2JQ4 A;  2FAD A;  2KOP A;  2MF4 A;  3EJD A;  2CNR A;  2GDW A;  4BPF A;  4PXH B;  2KG9 A;  2KOQ A;  2N5H A;  5EJD A;  5KP6 B;  2KG8 A;  3EJB A;  2AFE A;  2KOR A;  2XZ1 C;  2K92 A;  2FQ1 A;  1L0H A;  2MVV A;  1KLP A;  2KGC A;  2KGE A;  1ACP A;  3GZL A;  4BPH A;  2FHS C;  1DV5 A;  4DG9 A;  2KOS A;  2MD9 A;  1NQ4 A;  3LMO A;  2MY5 A;  1HY8 A;  2KGD A;  2LOL A;  2VSQ A;  2AFD A;  4BPG A;  2L0Q A;  4PWV B;  2KGA A;  2GDX A;  2L4B A;  1L0I A;  2JU2 A;  2K0X A;  2LML A;  4HKG A;  4NEO A;  2JGP A;  2JU1 A;  1X3O A;  2KG6 A;  4R0M A;  2N6Z A;  2EHS A;  2FVF A;  5HVC A;  5KP7 B;  2FQ0 A;  1F80 D;  2AVA A;  2MVU A;  4H2Y C;  2X2B A;  2K2Q A;  2ROQ A;  2N5I A;  5KP8 B;  3CE7 A;  1HQB A;  3NY7 B;  2FVE A;  2N98 A;  2XZ0 D;  2KOO A;  2MR8 A;  2K0Y A;  1AF8 A;  4MRT C;  2M5R A;  2N50 A;  1T8K A;  2FQ2 A;  2DNW A;  2N6Y A;  2AF8 A;  2FVA A;  2KR5 A;  3GZM A;  2KW2 A;  4H2X C;  4CA3 A;  3RG2 A;  2CGQ A;  2CG5 B;  2FAC A; 
#chains in the Genus database with same CATH topology
 2LIU A;  2CQ8 A;  1VQ5 P;  5JPA A;  2LIW A;  2PNG A;  5I4T G;  4H2W C;  2KOD A;  5BS2 A;  2LL8 A;  5CZD B;  2VLP A;  1A8O A;  2QEX P;  1OR5 A;  1VQN P;  2M8P A;  3EJE A;  5HV8 A;  2FAD A;  2CNR A;  2OAR A;  5DCK A;  3CCL P;  2LF4 A;  1VQP P;  3DS5 A;  2PEI A;  3GJN A;  3EJB A;  2K5X A;  1QVF O;  2K92 A;  2FQ1 A;  4F37 A;  1EOQ A;  2MVV A;  1KLP A;  1YI2 P;  3Q20 A;  1IMP A;  2CWO A;  2KOS A;  2MD9 A;  4COC A;  1QVG O;  3CCM P;  1HY8 A;  3I55 P;  1Q7Y Q;  4U0A A;  2KGA A;  2JO0 A;  2JU2 A;  4IPY A;  1YHQ P;  4HKG A;  4XFY A;  3P05 A;  1X3O A;  1EIA A;  4R0M A;  5HGM A;  2ONT A;  2N6Z A;  3G71 P;  3OW2 O;  5KP7 B;  2BUO A;  3M1M A;  2FQ0 A;  1M1K Q;  2AVA A;  2X2B A;  2EG5 A;  3DS1 A;  5KP8 B;  1HQB A;  3CCS P;  1AF8 A;  3CCV P;  1RO0 A;  1T8K A;  2FQ2 A;  2N6Y A;  3DS0 A;  1EMV A;  2Z44 A;  1GPJ A;  3H4E A;  3G28 A;  3RG2 A;  2CG5 B;  4WYM A;  2LPK A;  2L9F A;  4GR2 A;  2QNW A;  3DS4 A;  3G4S P;  1E6J P;  3CCE P;  2LKI A;  3MGE A;  4XRO A;  3LRY A;  1DNY A;  1VQ6 P;  1VKU A;  1VQL P;  1ZNV A;  2K0D X;  3RG6 C;  2Z45 A;  4U0D A;  4XRQ A;  2KOP A;  3B5I A;  3EJD A;  1D1D A;  1Z6M A;  3CC2 P;  4PXH B;  4QNB A;  4XFX A;  2KOQ A;  2N5H A;  5HGN A;  2AFE A;  2KOR A;  1K30 A;  2XZ1 C;  1L0H A;  2KGE A;  2FHS C;  1M6E X;  2JBG A;  3LMO A;  2MY5 A;  2PEO A;  2LOL A;  3DS2 A;  3HZQ A;  2AFD A;  1S72 P;  1GXH A;  2L6E A;  2L4B A;  1L0I A;  3H47 A;  5F2O A;  2K0X A;  4NEO A;  2VLQ A;  2VLN A;  3G26 A;  1KC8 Q;  1MZ8 A;  3DPH A;  2XT1 A;  5HVC A;  3G1I A;  1UNK A;  1F80 D;  1A43 A;  2PEQ A;  3NTE A;  2WPT A;  3G21 A;  2VLO A;  2FVE A;  3U43 A;  2MR8 A;  2K0Y A;  1JJ2 O;  3DS3 A;  1BXI A;  1VHN A;  1E0H A;  1VQ9 P;  1IUQ A;  2FVA A;  3CCQ P;  3CXC O;  1Q82 Q;  1GXG A;  2E1M A;  1YJ9 P;  2PEK A;  3CCU P;  2PEJ A;  5BS1 A;  1BAJ A;  2K94 A;  4IZ6 A;  2GDY A;  1VQ8 P;  2LTE A;  4QKO A;  2JQ4 A;  2NO8 A;  2MF4 A;  1NJI Q;  3CPW O;  5HGL A;  1YJW P;  3G29 A;  1YIT P;  4PH0 A;  3CD6 P;  5EJD A;  1YJN P;  1IMQ A;  4BPH A;  1DV5 A;  5F2N A;  5EW5 E;  1NQ4 A;  2PEN A;  2EIA A;  2KGD A;  3WBH A;  2GZI A;  5HGO A;  2JYG A;  2PEM A;  4U0E A;  1ZMB A;  2JU1 A;  2JAZ A;  3CMA P;  1M6N A;  2EHS A;  2FVF A;  1M74 A;  1KD1 Q;  2GZJ A;  2MVU A;  4H2Y C;  2K2Q A;  4PH1 A;  3CE7 A;  3NY7 B;  1UJZ A;  2N98 A;  2M8L A;  2XV6 A;  2XZ0 D;  2KOO A;  2P9X A;  2OTJ P;  4MRT C;  2OTL P;  1VQ4 P;  2N50 A;  1M90 Q;  2BHV A;  1K9M Q;  2KR5 A;  3GZM A;  2KW2 A;  1N8R Q;  4CA3 A;  4XFZ A;  2QA4 P;  3DTJ A;  2GZG A;  2CGQ A;  4U0B A;  2EHT A;  2KWL A;  2L22 A;  2K93 A;  2MR7 A;  4GR6 A;  2M8N A;  1RNI A;  2FAE A;  4COP A;  3VRL C;  3CCJ P;  3I56 P;  1YIJ P;  2GDW A;  4BPF A;  5F2K A;  1Q81 Q;  3G6E P;  2KG9 A;  4U0C A;  3G1G A;  5KP6 B;  2KG8 A;  2GYK A;  1CEI A;  2PY8 A;  4UHP B;  2KGC A;  1ACP A;  3GZL A;  2ERH A;  3CC7 P;  4DG9 A;  1W2B O;  1VQK P;  2JYL A;  3CC4 P;  2VSQ A;  1VQM P;  4BPG A;  1VQ7 P;  2L0Q A;  4PWV B;  2GDX A;  1K73 Q;  3E2D A;  3HYB A;  2LML A;  1AUM A;  2GZE A;  3CME P;  2JGP A;  2KG6 A;  2GZF A;  2DGY A;  1QRJ A;  3H0D A;  1VQO P;  1AYI A;  1KQS O;  1FR2 A;  2ROQ A;  2N5I A;  1Q86 Q;  1K8A Q;  3G0V A;  7CEI A;  3GKL C;  2EFJ A;  2M5R A;  2DNW A;  4M0I A;  4U0F A;  2AF8 A;  2Z46 A;  2XXM A;  4H2X C;  3CCR P;  1RO2 A;  3B4Q A;  2JB0 A;  2FAC A; 
#chains in the Genus database with same CATH homology
 2LPK A;  2L9F A;  2LIU A;  2QNW A;  2CQ8 A;  2LKI A;  2EHT A;  2KWL A;  2LIW A;  2K94 A;  2PNG A;  4H2W C;  1DNY A;  1VKU A;  2L22 A;  2K93 A;  2MR7 A;  4IZ6 A;  2FAE A;  2LL8 A;  5CZD B;  2GDY A;  1OR5 A;  2LTE A;  3EJE A;  5HV8 A;  2JQ4 A;  2FAD A;  2KOP A;  2MF4 A;  3EJD A;  2CNR A;  2GDW A;  4BPF A;  4PXH B;  2KG9 A;  2KOQ A;  2N5H A;  5EJD A;  5KP6 B;  2KG8 A;  3EJB A;  2AFE A;  2KOR A;  2XZ1 C;  2K92 A;  2FQ1 A;  1L0H A;  2MVV A;  1KLP A;  2KGC A;  2KGE A;  1ACP A;  3GZL A;  4BPH A;  2FHS C;  1DV5 A;  4DG9 A;  2KOS A;  2MD9 A;  1NQ4 A;  3LMO A;  2MY5 A;  1HY8 A;  2KGD A;  2LOL A;  2VSQ A;  2AFD A;  4BPG A;  2L0Q A;  4PWV B;  2KGA A;  2GDX A;  2L4B A;  1L0I A;  2JU2 A;  2K0X A;  2LML A;  4HKG A;  4NEO A;  2JGP A;  2JU1 A;  1X3O A;  2KG6 A;  4R0M A;  2N6Z A;  2EHS A;  2FVF A;  5HVC A;  5KP7 B;  2FQ0 A;  1F80 D;  2AVA A;  2MVU A;  4H2Y C;  2X2B A;  2K2Q A;  2ROQ A;  2N5I A;  5KP8 B;  3CE7 A;  1HQB A;  3NY7 B;  2FVE A;  2N98 A;  2XZ0 D;  2KOO A;  2MR8 A;  2K0Y A;  1AF8 A;  4MRT C;  2M5R A;  2N50 A;  1T8K A;  2FQ2 A;  2DNW A;  2N6Y A;  2AF8 A;  2FVA A;  2KR5 A;  3GZM A;  2KW2 A;  4H2X C;  4CA3 A;  3RG2 A;  2CGQ A;  2CG5 B;  2FAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...