4NEOA

Structure of blmi, a type-ii acyl-carrier-protein from streptomyces verticillus involved in bleomycin biosynthesis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
82
Chain Sequence
APRGERTRRRALERDIAAIWAETLGRDSVGPHEDFAALGGNSIHAIITNRVEELVDAELSIRVLLETRTVAGMTDHVHATLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of BlmI as a model for nonribosomal peptide synthetase peptidyl carrier proteins.
pubmed doi rcsb
source organism Streptomyces verticillus
molecule tags Ligase
molecule keywords Peptide synthetase NRPS type II-PCP
total genus 29
structure length 82
sequence length 83
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4neoA00
1HQBA 3RG2A 2KGAA 2N5HA 3LMOA 1ACPA 5CZDB 2MY5A 2LMLA 4PXHB 2LTEA 2MVVA 2FHSC 5KP6B 2K0XA 1HY8A 2KOOA 1L0IA 2FQ1A 2GDXA 2KGEA 1T8KA 2K0YA 2KGCA 2FVEA 2EHTA 2LIUA 2PNGA 2LIWA 2KOPA 2N6ZA 2CQ8A 5KP7B 4IZ6A 5KP8B 5HVCA 4HKGA 2L9FA 2QNWA 2N50A 2L22A 4R0MA 2CG5B 2KORA 4DG9A 2FAEA 4PWVB 1OR5A 2KGDA 2K94A 2KOQA 2M5RA 2CGQA 2MVUA 2LPKA 5HV8A 2FACA 1DNYA 2AFDA 4MRTC 1DV5A 2GDYA 2ROQA 2N98A 2N6YA 4H2YC 2K92A 2LKIA 4BPGA 5EJDA 2AFEA 4BPFA 2XZ0D 2KG9A 2LL8A 2FADA 3EJDA 2AF8A 3EJBA 2GDWA 2L0QA 1NQ4A 3GZMA 2MD9A 3GZLA 2DNWA 2MF4A 2X2BA 2MR7A 4H2WC 4NEOA 1VKUA 2JU2A 1KLPA 2MR8A 2FVAA 2AVAA 2XZ1C 2JU1A 2KR5A 2JQ4A 2KOSA 2K2QA 2KWLA 1F80D 3NY7B 2KG8A 2N5IA 1X3OA 2KW2A 1L0HA 2L4BA 1AF8A 2JGPA 2EHSA 4CA3A 2VSQA 4BPHA 3CE7A 2KG6A 3EJEA 2K93A 2FQ2A 4H2XC 2FQ0A 2LOLA 2FVFA 2CNRA
chains in the Genus database with same CATH superfamily
1UNKA 2KGAA 4GR2A 4XROA 2WPTA 4PXHB 1MZ8A 3M1MA 2PEIA 2FHSC 1BAJA 2L6EA 2FQ1A 1VQPP 3CPWO 1T8KA 3CCMP 3GJNA 3CXCO 1Q7YQ 3G6EP 2EHTA 2EIAA 4IZ6A 2L9FA 2M8NA 2KORA 2FAEA 2KGDA 3CCSP 3DS1A 4PH0A 1S72P 2MVUA 2LPKA 2JB0A 3G21A 5HV8A 1K9MQ 3HYBA 3DS3A 1E6JP 2VLPA 3E2DA 3NTEA 1KQSO 1M74A 3G29A 4F37A 5HGMA 4XFZA 7CEIA 3GKLC 1ZMBA 2LKIA 2AFEA 2JAZA 1M6NA 1E0HA 1VQKP 2DGYA 2FADA 2AF8A 2XT1A 1NQ4A 3GZMA 2MD9A 1QVGO 2MF4A 3CC7P 2MR8A 2FVAA 1K73Q 1AYIA 1VQ7P 3H0DA 1F80D 2KG8A 2N5IA 1L0HA 3H47A 4BPHA 2FQ2A 4H2XC 1M6EX 4U0EA 1HQBA 2JBGA 3RG2A 2PEQA 5EW5E 3CD6P 3CMAP 3CCEP 1RO2A 2P9XA 5CZDB 2MY5A 4U0BA 2PEMA 1VQ9P 4U0CA 2Z44A 2LTEA 5KP6B 3HZQA 2K0XA 2KODA 1L0IA 1GXGA 5HGOA 3G71P 2K0YA 4U0FA 3G1GA 1M90Q 5HGLA 3CCRP 2N6ZA 3B5IA 5KP7B 5KP8B 2JYGA 4HKGA 2QNWA 3I55P 2L22A 3CMEP 5F2NA 2GYKA 2PEKA 1OR5A 2K0DX 2E1MA 3MGEA 1VHNA 2PY8A 4COCA 2AFDA 2OTLP 4MRTC 1DV5A 4GR6A 1QRJA 3G0VA 3CCQP 2XZ0D 4IPYA 2GDWA 1EIAA 1K8AQ 1QVFO 2DNWA 2X2BA 2M8PA 4QNBA 4H2WC 2PEOA 2VLQA 3DS4A 2KR5A 1VQ4P 2K5XA 4COPA 1YI2P 2QA4P 2KOSA 3NY7B 3OW2O 1A8OA 1ZNVA 1X3OA 2VLOA 4WYMA 1GXHA 1AF8A 2JGPA 4CA3A 3G4SP 1VQLP 4XFXA 5BS1A 2NO8A 1UJZA 2N5HA 1ACPA 2LMLA 4XFYA 1IMQA 5F2OA 1IUQA 2KGCA 2FVEA 1CEIA 1NJIQ 2PENA 4R0MA 1K30A 2CG5B 1RNIA 5F2KA 2M8LA 1BXIA 2VLNA 2CGQA 1Q81Q 2BUOA 2FACA 1DNYA 3DPHA 2GZFA 3RG6C 1GPJA 2PEJA 1VQOP 4U0DA 1M1KQ 2N6YA 2K92A 4BPGA 1Z6MA 5EJDA 1D1DA 3Q20A 2Z46A 2KG9A 2LL8A 3EJDA 1KD1Q 3U43A 5JPAA 3EJBA 2EFJA 1EMVA 1FR2A 2MR7A 4NEOA 2JU2A 1KLPA 2AVAA 3DS2A 5DCKA 2JQ4A 2KWLA 1VQ6P 2KW2A 2OARA 4QKOA 3CCLP 2EHSA 3WBHA 2VSQA 1W2BO 4XRQA 2JO0A 2FQ0A 2LOLA 2FVFA 5HGNA 2CNRA 2OTJP 4PH1A 3LMOA 2GZEA 1JJ2O 2ONTA 3B4QA 2EG5A 2JYLA 5BS2A 3G28A 2XV6A 2MVVA 2QEXP 1VQNP 1HY8A 1RO0A 2KOOA 4U0AA 3LRYA 2GDXA 1EOQA 2BHVA 2KGEA 2LIUA 2PNGA 2LIWA 2KOPA 2CQ8A 3CCJP 3CCVP 5HVCA 2N50A 3P05A 1N8RQ 4DG9A 5I4TG 1VQ5P 3CCUP 4PWVB 1VQMP 2K94A 2KOQA 3CC2P 3VRLC 2XXMA 2M5RA 1IMPA 1A43A 2ERHA 2CWOA 1VQ8P 3DTJA 1Q86Q 1YIJP 2GDYA 2ROQA 1YJWP 2N98A 1AUMA 4H2YC 2GZGA 2GZIA 4BPFA 4M0IA 3G1IA 3H4EA 1YITP 4UHPB 1YHQP 2L0QA 3CC4P 3GZLA 2LF4A 1YJ9P 1KC8Q 2Z45A 1VKUA 3I56P 3G26A 2XZ1C 2JU1A 2K2QA 2L4BA 1YJNP 3DS0A 3DS5A 1Q82Q 3CE7A 2KG6A 3EJEA 2K93A 2GZJA
chains in the Genus database with same CATH topology
1HQBA 3RG2A 2KGAA 2N5HA 3LMOA 1ACPA 5CZDB 2MY5A 2LMLA 4PXHB 2LTEA 2MVVA 2FHSC 5KP6B 2K0XA 1HY8A 2KOOA 1L0IA 2FQ1A 2GDXA 2KGEA 1T8KA 2K0YA 2KGCA 2FVEA 2EHTA 2LIUA 2PNGA 2LIWA 2KOPA 2N6ZA 2CQ8A 5KP7B 4IZ6A 5KP8B 5HVCA 4HKGA 2L9FA 2QNWA 2N50A 2L22A 4R0MA 2CG5B 2KORA 4DG9A 2FAEA 4PWVB 1OR5A 2KGDA 2K94A 2KOQA 2M5RA 2CGQA 2MVUA 2LPKA 5HV8A 2FACA 1DNYA 2AFDA 4MRTC 1DV5A 2GDYA 2ROQA 2N98A 2N6YA 4H2YC 2K92A 2LKIA 4BPGA 5EJDA 2AFEA 4BPFA 2XZ0D 2KG9A 2LL8A 2FADA 3EJDA 2AF8A 3EJBA 2GDWA 2L0QA 1NQ4A 3GZMA 2MD9A 3GZLA 2DNWA 2MF4A 2X2BA 2MR7A 4H2WC 4NEOA 1VKUA 2JU2A 1KLPA 2MR8A 2FVAA 2AVAA 2XZ1C 2JU1A 2KR5A 2JQ4A 2KOSA 2K2QA 2KWLA 1F80D 3NY7B 2KG8A 2N5IA 1X3OA 2KW2A 1L0HA 2L4BA 1AF8A 2JGPA 2EHSA 4CA3A 2VSQA 4BPHA 3CE7A 2KG6A 3EJEA 2K93A 2FQ2A 4H2XC 2FQ0A 2LOLA 2FVFA 2CNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQB A;  3RG2 A;  2KGA A;  2N5H A;  3LMO A;  1ACP A;  5CZD B;  2MY5 A;  2LML A;  4PXH B;  2LTE A;  2MVV A;  2FHS C;  5KP6 B;  2K0X A;  1HY8 A;  2KOO A;  1L0I A;  2FQ1 A;  2GDX A;  2KGE A;  1T8K A;  2K0Y A;  2KGC A;  2FVE A;  2EHT A;  2LIU A;  2PNG A;  2LIW A;  2KOP A;  2N6Z A;  2CQ8 A;  5KP7 B;  4IZ6 A;  5KP8 B;  5HVC A;  4HKG A;  2L9F A;  2QNW A;  2N50 A;  2L22 A;  4R0M A;  2CG5 B;  2KOR A;  4DG9 A;  2FAE A;  4PWV B;  1OR5 A;  2KGD A;  2K94 A;  2KOQ A;  2M5R A;  2CGQ A;  2MVU A;  2LPK A;  5HV8 A;  2FAC A;  1DNY A;  2AFD A;  4MRT C;  1DV5 A;  2GDY A;  2ROQ A;  2N98 A;  2N6Y A;  4H2Y C;  2K92 A;  2LKI A;  4BPG A;  5EJD A;  2AFE A;  4BPF A;  2XZ0 D;  2KG9 A;  2LL8 A;  2FAD A;  3EJD A;  2AF8 A;  3EJB A;  2GDW A;  2L0Q A;  1NQ4 A;  3GZM A;  2MD9 A;  3GZL A;  2DNW A;  2MF4 A;  2X2B A;  2MR7 A;  4H2W C;  4NEO A;  1VKU A;  2JU2 A;  1KLP A;  2MR8 A;  2FVA A;  2AVA A;  2XZ1 C;  2JU1 A;  2KR5 A;  2JQ4 A;  2KOS A;  2K2Q A;  2KWL A;  1F80 D;  3NY7 B;  2KG8 A;  2N5I A;  1X3O A;  2KW2 A;  1L0H A;  2L4B A;  1AF8 A;  2JGP A;  2EHS A;  4CA3 A;  2VSQ A;  4BPH A;  3CE7 A;  2KG6 A;  3EJE A;  2K93 A;  2FQ2 A;  4H2X C;  2FQ0 A;  2LOL A;  2FVF A;  2CNR A; 
#chains in the Genus database with same CATH topology
 1UNK A;  2KGA A;  4GR2 A;  4XRO A;  2WPT A;  4PXH B;  1MZ8 A;  3M1M A;  2PEI A;  2FHS C;  1BAJ A;  2L6E A;  2FQ1 A;  1VQP P;  3CPW O;  1T8K A;  3CCM P;  3GJN A;  3CXC O;  1Q7Y Q;  3G6E P;  2EHT A;  2EIA A;  4IZ6 A;  2L9F A;  2M8N A;  2KOR A;  2FAE A;  2KGD A;  3CCS P;  3DS1 A;  4PH0 A;  1S72 P;  2MVU A;  2LPK A;  2JB0 A;  3G21 A;  5HV8 A;  1K9M Q;  3HYB A;  3DS3 A;  1E6J P;  2VLP A;  3E2D A;  3NTE A;  1KQS O;  1M74 A;  3G29 A;  4F37 A;  5HGM A;  4XFZ A;  7CEI A;  3GKL C;  1ZMB A;  2LKI A;  2AFE A;  2JAZ A;  1M6N A;  1E0H A;  1VQK P;  2DGY A;  2FAD A;  2AF8 A;  2XT1 A;  1NQ4 A;  3GZM A;  2MD9 A;  1QVG O;  2MF4 A;  3CC7 P;  2MR8 A;  2FVA A;  1K73 Q;  1AYI A;  1VQ7 P;  3H0D A;  1F80 D;  2KG8 A;  2N5I A;  1L0H A;  3H47 A;  4BPH A;  2FQ2 A;  4H2X C;  1M6E X;  4U0E A;  1HQB A;  2JBG A;  3RG2 A;  2PEQ A;  5EW5 E;  3CD6 P;  3CMA P;  3CCE P;  1RO2 A;  2P9X A;  5CZD B;  2MY5 A;  4U0B A;  2PEM A;  1VQ9 P;  4U0C A;  2Z44 A;  2LTE A;  5KP6 B;  3HZQ A;  2K0X A;  2KOD A;  1L0I A;  1GXG A;  5HGO A;  3G71 P;  2K0Y A;  4U0F A;  3G1G A;  1M90 Q;  5HGL A;  3CCR P;  2N6Z A;  3B5I A;  5KP7 B;  5KP8 B;  2JYG A;  4HKG A;  2QNW A;  3I55 P;  2L22 A;  3CME P;  5F2N A;  2GYK A;  2PEK A;  1OR5 A;  2K0D X;  2E1M A;  3MGE A;  1VHN A;  2PY8 A;  4COC A;  2AFD A;  2OTL P;  4MRT C;  1DV5 A;  4GR6 A;  1QRJ A;  3G0V A;  3CCQ P;  2XZ0 D;  4IPY A;  2GDW A;  1EIA A;  1K8A Q;  1QVF O;  2DNW A;  2X2B A;  2M8P A;  4QNB A;  4H2W C;  2PEO A;  2VLQ A;  3DS4 A;  2KR5 A;  1VQ4 P;  2K5X A;  4COP A;  1YI2 P;  2QA4 P;  2KOS A;  3NY7 B;  3OW2 O;  1A8O A;  1ZNV A;  1X3O A;  2VLO A;  4WYM A;  1GXH A;  1AF8 A;  2JGP A;  4CA3 A;  3G4S P;  1VQL P;  4XFX A;  5BS1 A;  2NO8 A;  1UJZ A;  2N5H A;  1ACP A;  2LML A;  4XFY A;  1IMQ A;  5F2O A;  1IUQ A;  2KGC A;  2FVE A;  1CEI A;  1NJI Q;  2PEN A;  4R0M A;  1K30 A;  2CG5 B;  1RNI A;  5F2K A;  2M8L A;  1BXI A;  2VLN A;  2CGQ A;  1Q81 Q;  2BUO A;  2FAC A;  1DNY A;  3DPH A;  2GZF A;  3RG6 C;  1GPJ A;  2PEJ A;  1VQO P;  4U0D A;  1M1K Q;  2N6Y A;  2K92 A;  4BPG A;  1Z6M A;  5EJD A;  1D1D A;  3Q20 A;  2Z46 A;  2KG9 A;  2LL8 A;  3EJD A;  1KD1 Q;  3U43 A;  5JPA A;  3EJB A;  2EFJ A;  1EMV A;  1FR2 A;  2MR7 A;  4NEO A;  2JU2 A;  1KLP A;  2AVA A;  3DS2 A;  5DCK A;  2JQ4 A;  2KWL A;  1VQ6 P;  2KW2 A;  2OAR A;  4QKO A;  3CCL P;  2EHS A;  3WBH A;  2VSQ A;  1W2B O;  4XRQ A;  2JO0 A;  2FQ0 A;  2LOL A;  2FVF A;  5HGN A;  2CNR A;  2OTJ P;  4PH1 A;  3LMO A;  2GZE A;  1JJ2 O;  2ONT A;  3B4Q A;  2EG5 A;  2JYL A;  5BS2 A;  3G28 A;  2XV6 A;  2MVV A;  2QEX P;  1VQN P;  1HY8 A;  1RO0 A;  2KOO A;  4U0A A;  3LRY A;  2GDX A;  1EOQ A;  2BHV A;  2KGE A;  2LIU A;  2PNG A;  2LIW A;  2KOP A;  2CQ8 A;  3CCJ P;  3CCV P;  5HVC A;  2N50 A;  3P05 A;  1N8R Q;  4DG9 A;  5I4T G;  1VQ5 P;  3CCU P;  4PWV B;  1VQM P;  2K94 A;  2KOQ A;  3CC2 P;  3VRL C;  2XXM A;  2M5R A;  1IMP A;  1A43 A;  2ERH A;  2CWO A;  1VQ8 P;  3DTJ A;  1Q86 Q;  1YIJ P;  2GDY A;  2ROQ A;  1YJW P;  2N98 A;  1AUM A;  4H2Y C;  2GZG A;  2GZI A;  4BPF A;  4M0I A;  3G1I A;  3H4E A;  1YIT P;  4UHP B;  1YHQ P;  2L0Q A;  3CC4 P;  3GZL A;  2LF4 A;  1YJ9 P;  1KC8 Q;  2Z45 A;  1VKU A;  3I56 P;  3G26 A;  2XZ1 C;  2JU1 A;  2K2Q A;  2L4B A;  1YJN P;  3DS0 A;  3DS5 A;  1Q82 Q;  3CE7 A;  2KG6 A;  3EJE A;  2K93 A;  2GZJ A; 
#chains in the Genus database with same CATH homology
 1HQB A;  3RG2 A;  2KGA A;  2N5H A;  3LMO A;  1ACP A;  5CZD B;  2MY5 A;  2LML A;  4PXH B;  2LTE A;  2MVV A;  2FHS C;  5KP6 B;  2K0X A;  1HY8 A;  2KOO A;  1L0I A;  2FQ1 A;  2GDX A;  2KGE A;  1T8K A;  2K0Y A;  2KGC A;  2FVE A;  2EHT A;  2LIU A;  2PNG A;  2LIW A;  2KOP A;  2N6Z A;  2CQ8 A;  5KP7 B;  4IZ6 A;  5KP8 B;  5HVC A;  4HKG A;  2L9F A;  2QNW A;  2N50 A;  2L22 A;  4R0M A;  2CG5 B;  2KOR A;  4DG9 A;  2FAE A;  4PWV B;  1OR5 A;  2KGD A;  2K94 A;  2KOQ A;  2M5R A;  2CGQ A;  2MVU A;  2LPK A;  5HV8 A;  2FAC A;  1DNY A;  2AFD A;  4MRT C;  1DV5 A;  2GDY A;  2ROQ A;  2N98 A;  2N6Y A;  4H2Y C;  2K92 A;  2LKI A;  4BPG A;  5EJD A;  2AFE A;  4BPF A;  2XZ0 D;  2KG9 A;  2LL8 A;  2FAD A;  3EJD A;  2AF8 A;  3EJB A;  2GDW A;  2L0Q A;  1NQ4 A;  3GZM A;  2MD9 A;  3GZL A;  2DNW A;  2MF4 A;  2X2B A;  2MR7 A;  4H2W C;  4NEO A;  1VKU A;  2JU2 A;  1KLP A;  2MR8 A;  2FVA A;  2AVA A;  2XZ1 C;  2JU1 A;  2KR5 A;  2JQ4 A;  2KOS A;  2K2Q A;  2KWL A;  1F80 D;  3NY7 B;  2KG8 A;  2N5I A;  1X3O A;  2KW2 A;  1L0H A;  2L4B A;  1AF8 A;  2JGP A;  2EHS A;  4CA3 A;  2VSQ A;  4BPH A;  3CE7 A;  2KG6 A;  3EJE A;  2K93 A;  2FQ2 A;  4H2X C;  2FQ0 A;  2LOL A;  2FVF A;  2CNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...