4NEOA

Structure of blmi, a type-ii acyl-carrier-protein from streptomyces verticillus involved in bleomycin biosynthesis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
82
Chain Sequence
APRGERTRRRALERDIAAIWAETLGRDSVGPHEDFAALGGNSIHAIITNRVEELVDAELSIRVLLETRTVAGMTDHVHATLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of BlmI as a model for nonribosomal peptide synthetase peptidyl carrier proteins.
pubmed doi rcsb
source organism Streptomyces verticillus
molecule tags Ligase
molecule keywords Peptide synthetase NRPS type II-PCP
total genus 29
structure length 82
sequence length 83
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4neoA00
5HVCA 3NY7B 4PWVB 1F80D 2LOLA 1VKUA 2KGDA 2EHSA 2L0QA 3EJDA 2AF8A 5HV8A 4H2YC 2K93A 2LL8A 2CGQA 2XZ0D 2FHSC 2EHTA 2K92A 1AF8A 2K94A 1L0IA 1ACPA 1DNYA 2MF4A 5KP8B 2N50A 2FQ1A 5KP6B 2CQ8A 2GDXA 2LMLA 2AVAA 2FQ2A 2FADA 2LPKA 2L9FA 4DG9A 2XZ1C 5EJDA 4CA3A 3LMOA 3RG2A 2N6YA 3GZLA 2FQ0A 2KGCA 2KGAA 1KLPA 2KG6A 1HQBA 2M5RA 4PXHB 2PNGA 4BPGA 2GDYA 3CE7A 2KW2A 2AFEA 2N6ZA 2CNRA 4H2WC 2K0XA 2N98A 2JU1A 2KGEA 2X2BA 2FVEA 2L22A 1X3OA 3EJEA 2KOPA 2K0YA 2AFDA 3GZMA 2JGPA 2FAEA 5KP7B 2MD9A 4BPFA 2KG8A 2KR5A 4BPHA 5CZDB 4IZ6A 2MR8A 1OR5A 2FVFA 2CG5B 2K2QA 2LTEA 2FACA 2LIWA 1L0HA 2L4BA 2JU2A 2LIUA 2MY5A 4NEOA 2KOQA 1HY8A 2DNWA 2KOSA 3EJBA 4HKGA 2FVAA 2MR7A 1DV5A 2VSQA 4R0MA 2KG9A 2KWLA 2QNWA 2KORA 2KOOA 2MVUA 2GDWA 4H2XC 2JQ4A 2ROQA 2N5IA 4MRTC 1T8KA 2LKIA 2MVVA 1NQ4A 2N5HA
chains in the Genus database with same CATH superfamily
5HVCA 3DS1A 3CPWO 4PWVB 2PENA 2XT1A 2LOLA 2KGDA 4PH0A 5HV8A 2EFJA 3DS5A 1YHQP 2LL8A 3RG6C 1IMQA 1M6EX 2XV6A 4U0BA 3G71P 1K8AQ 2N50A 1M74A 1YI2P 2JAZA 1BAJA 2LPKA 3H4EA 2JBGA 2L9FA 3CCLP 1QRJA 5I4TG 2XZ1C 1M90Q 5F2OA 2KODA 2M8PA 1S72P 4PH1A 1HQBA 2PEKA 4M0IA 2Z44A 4H2WC 4U0CA 4XFXA 2K0DX 1UNKA 4UHPB 3CD6P 1X3OA 3OW2O 2M8LA 5KP7B 4BPFA 2KG8A 1Z6MA 2MR8A 2CG5B 1Q86Q 2EIAA 1L0HA 2VLQA 2N5HA 1YJWP 3EJBA 3CC2P 4U0EA 2BHVA 1M1KQ 2K5XA 2QNWA 2GDWA 3H47A 2LKIA 3G6EP 2MVVA 2VLPA 3DS3A 3CCJP 3B5IA 1VKUA 1YJNP 2BUOA 1VQ7P 2XZ0D 2FHSC 1QVGO 4GR2A 3E2DA 1DNYA 2MF4A 1YIJP 2GZIA 3DS2A 2XXMA 5KP6B 2Z45A 3CC7P 2FQ2A 1Q81Q 1VQ4P 1W2BO 2WPTA 3LMOA 3DS0A 2GYKA 1KLPA 1QVFO 3WBHA 1IUQA 2L6EA 4PXHB 3G1IA 2EG5A 1JJ2O 2PEMA 3G0VA 2N6ZA 1ZNVA 2N98A 2JU1A 3CMEP 2KGEA 2L22A 2GZFA 1AUMA 1EMVA 2KOPA 3DTJA 2PEJA 5EW5E 2GZGA 4BPHA 1GXGA 5CZDB 1MZ8A 4IZ6A 2OTJP 2PEOA 3CCMP 2MY5A 1EIAA 1HY8A 4XFYA 4HKGA 2FVAA 1VQOP 2MR7A 2GZJA 1FR2A 2QEXP 2KG9A 3HZQA 3CCQP 4XFZA 2KORA 3Q20A 2MVUA 1VQPP 4XRQA 2N5IA 4MRTC 3CCUP 3CC4P 3LRYA 1ZMBA 1K30A 7CEIA 2L0QA 3EJDA 1IMPA 4COCA 2K93A 2CGQA 2K92A 1L0IA 2LF4A 4XROA 1D1DA 2OTLP 3G29A 2VLOA 2FQ1A 2LMLA 2FADA 1BXIA 3DS4A 3P05A 1KQSO 4QKOA 1KD1Q 3G4SP 2N6YA 1VQ9P 2KGAA 2KG6A 1VQMP 2M5RA 2PNGA 3G21A 2GDYA 3CE7A 5JPAA 2ONTA 2AFEA 2CNRA 2K0XA 2M8NA 2X2BA 1YJ9P 1CEIA 3G26A 3GZMA 1K73Q 1KC8Q 1VQNP 2KR5A 3I56P 2PEQA 3DPHA 2JB0A 2K2QA 4WYMA 1N8RQ 4IPYA 1VQLP 2NO8A 2L4BA 2JU2A 2QA4P 2LIUA 3B4QA 3CXCO 2GZEA 2Z46A 1AYIA 2DNWA 2KOSA 5BS2A 1E0HA 3CCVP 3U43A 4R0MA 3VRLC 3MGEA 1UJZA 2KWLA 2JO0A 4H2XC 4U0DA 2JQ4A 3HYBA 3GJNA 1T8KA 3CMAP 1NQ4A 4GR6A 3NY7B 2OARA 1F80D 5DCKA 1RNIA 2EHSA 3CCSP 2AF8A 4H2YC 2EHTA 1AF8A 2K94A 2JYGA 1ACPA 5KP8B 1VQ5P 1GXHA 2DGYA 2CQ8A 2GDXA 2PY8A 2AVAA 1Q82Q 5EJDA 1RO0A 4CA3A 3RG2A 1EOQA 3GZLA 2FQ0A 2KGCA 3H0DA 1VHNA 4BPGA 3GKLC 5HGMA 2KW2A 3NTEA 5HGOA 5HGNA 1E6JP 1RO2A 2FVEA 2CWOA 1A8OA 3EJEA 2ERHA 1GPJA 2K0YA 2AFDA 2JGPA 2FAEA 2VLNA 5HGLA 2MD9A 3G1GA 1VQKP 4COPA 3I55P 5F2KA 1OR5A 2FVFA 1K9MQ 2LTEA 2FACA 2PEIA 2LIWA 5F2NA 3CCRP 4U0FA 4NEOA 2KOQA 4QNBA 1NJIQ 1Q7YQ 1DV5A 2VSQA 1YITP 2P9XA 3CCEP 3M1MA 1A43A 1VQ6P 2KOOA 4F37A 1VQ8P 2ROQA 5BS1A 2E1MA 1M6NA 2JYLA 4U0AA 3G28A 4DG9A
chains in the Genus database with same CATH topology
5HVCA 3NY7B 4PWVB 1F80D 2LOLA 1VKUA 2KGDA 2EHSA 2L0QA 3EJDA 2AF8A 5HV8A 4H2YC 2K93A 2LL8A 2CGQA 2XZ0D 2FHSC 2EHTA 2K92A 1AF8A 2K94A 1L0IA 1ACPA 1DNYA 2MF4A 5KP8B 2N50A 2FQ1A 5KP6B 2CQ8A 2GDXA 2LMLA 2AVAA 2FQ2A 2FADA 2LPKA 2L9FA 4DG9A 2XZ1C 5EJDA 4CA3A 3LMOA 3RG2A 2N6YA 3GZLA 2FQ0A 2KGCA 2KGAA 1KLPA 2KG6A 1HQBA 2M5RA 4PXHB 2PNGA 4BPGA 2GDYA 3CE7A 2KW2A 2AFEA 2N6ZA 2CNRA 4H2WC 2K0XA 2N98A 2JU1A 2KGEA 2X2BA 2FVEA 2L22A 1X3OA 3EJEA 2KOPA 2K0YA 2AFDA 3GZMA 2JGPA 2FAEA 5KP7B 2MD9A 4BPFA 2KG8A 2KR5A 4BPHA 5CZDB 4IZ6A 2MR8A 1OR5A 2FVFA 2CG5B 2K2QA 2LTEA 2FACA 2LIWA 1L0HA 2L4BA 2JU2A 2LIUA 2MY5A 4NEOA 2KOQA 1HY8A 2DNWA 2KOSA 3EJBA 4HKGA 2FVAA 2MR7A 1DV5A 2VSQA 4R0MA 2KG9A 2KWLA 2QNWA 2KORA 2KOOA 2MVUA 2GDWA 4H2XC 2JQ4A 2ROQA 2N5IA 4MRTC 1T8KA 2LKIA 2MVVA 1NQ4A 2N5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HVC A;  3NY7 B;  4PWV B;  1F80 D;  2LOL A;  1VKU A;  2KGD A;  2EHS A;  2L0Q A;  3EJD A;  2AF8 A;  5HV8 A;  4H2Y C;  2K93 A;  2LL8 A;  2CGQ A;  2XZ0 D;  2FHS C;  2EHT A;  2K92 A;  1AF8 A;  2K94 A;  1L0I A;  1ACP A;  1DNY A;  2MF4 A;  5KP8 B;  2N50 A;  2FQ1 A;  5KP6 B;  2CQ8 A;  2GDX A;  2LML A;  2AVA A;  2FQ2 A;  2FAD A;  2LPK A;  2L9F A;  4DG9 A;  2XZ1 C;  5EJD A;  4CA3 A;  3LMO A;  3RG2 A;  2N6Y A;  3GZL A;  2FQ0 A;  2KGC A;  2KGA A;  1KLP A;  2KG6 A;  1HQB A;  2M5R A;  4PXH B;  2PNG A;  4BPG A;  2GDY A;  3CE7 A;  2KW2 A;  2AFE A;  2N6Z A;  2CNR A;  4H2W C;  2K0X A;  2N98 A;  2JU1 A;  2KGE A;  2X2B A;  2FVE A;  2L22 A;  1X3O A;  3EJE A;  2KOP A;  2K0Y A;  2AFD A;  3GZM A;  2JGP A;  2FAE A;  5KP7 B;  2MD9 A;  4BPF A;  2KG8 A;  2KR5 A;  4BPH A;  5CZD B;  4IZ6 A;  2MR8 A;  1OR5 A;  2FVF A;  2CG5 B;  2K2Q A;  2LTE A;  2FAC A;  2LIW A;  1L0H A;  2L4B A;  2JU2 A;  2LIU A;  2MY5 A;  4NEO A;  2KOQ A;  1HY8 A;  2DNW A;  2KOS A;  3EJB A;  4HKG A;  2FVA A;  2MR7 A;  1DV5 A;  2VSQ A;  4R0M A;  2KG9 A;  2KWL A;  2QNW A;  2KOR A;  2KOO A;  2MVU A;  2GDW A;  4H2X C;  2JQ4 A;  2ROQ A;  2N5I A;  4MRT C;  1T8K A;  2LKI A;  2MVV A;  1NQ4 A;  2N5H A; 
#chains in the Genus database with same CATH topology
 5HVC A;  3DS1 A;  3CPW O;  4PWV B;  2PEN A;  2XT1 A;  2LOL A;  2KGD A;  4PH0 A;  5HV8 A;  2EFJ A;  3DS5 A;  1YHQ P;  2LL8 A;  3RG6 C;  1IMQ A;  1M6E X;  2XV6 A;  4U0B A;  3G71 P;  1K8A Q;  2N50 A;  1M74 A;  1YI2 P;  2JAZ A;  1BAJ A;  2LPK A;  3H4E A;  2JBG A;  2L9F A;  3CCL P;  1QRJ A;  5I4T G;  2XZ1 C;  1M90 Q;  5F2O A;  2KOD A;  2M8P A;  1S72 P;  4PH1 A;  1HQB A;  2PEK A;  4M0I A;  2Z44 A;  4H2W C;  4U0C A;  4XFX A;  2K0D X;  1UNK A;  4UHP B;  3CD6 P;  1X3O A;  3OW2 O;  2M8L A;  5KP7 B;  4BPF A;  2KG8 A;  1Z6M A;  2MR8 A;  2CG5 B;  1Q86 Q;  2EIA A;  1L0H A;  2VLQ A;  2N5H A;  1YJW P;  3EJB A;  3CC2 P;  4U0E A;  2BHV A;  1M1K Q;  2K5X A;  2QNW A;  2GDW A;  3H47 A;  2LKI A;  3G6E P;  2MVV A;  2VLP A;  3DS3 A;  3CCJ P;  3B5I A;  1VKU A;  1YJN P;  2BUO A;  1VQ7 P;  2XZ0 D;  2FHS C;  1QVG O;  4GR2 A;  3E2D A;  1DNY A;  2MF4 A;  1YIJ P;  2GZI A;  3DS2 A;  2XXM A;  5KP6 B;  2Z45 A;  3CC7 P;  2FQ2 A;  1Q81 Q;  1VQ4 P;  1W2B O;  2WPT A;  3LMO A;  3DS0 A;  2GYK A;  1KLP A;  1QVF O;  3WBH A;  1IUQ A;  2L6E A;  4PXH B;  3G1I A;  2EG5 A;  1JJ2 O;  2PEM A;  3G0V A;  2N6Z A;  1ZNV A;  2N98 A;  2JU1 A;  3CME P;  2KGE A;  2L22 A;  2GZF A;  1AUM A;  1EMV A;  2KOP A;  3DTJ A;  2PEJ A;  5EW5 E;  2GZG A;  4BPH A;  1GXG A;  5CZD B;  1MZ8 A;  4IZ6 A;  2OTJ P;  2PEO A;  3CCM P;  2MY5 A;  1EIA A;  1HY8 A;  4XFY A;  4HKG A;  2FVA A;  1VQO P;  2MR7 A;  2GZJ A;  1FR2 A;  2QEX P;  2KG9 A;  3HZQ A;  3CCQ P;  4XFZ A;  2KOR A;  3Q20 A;  2MVU A;  1VQP P;  4XRQ A;  2N5I A;  4MRT C;  3CCU P;  3CC4 P;  3LRY A;  1ZMB A;  1K30 A;  7CEI A;  2L0Q A;  3EJD A;  1IMP A;  4COC A;  2K93 A;  2CGQ A;  2K92 A;  1L0I A;  2LF4 A;  4XRO A;  1D1D A;  2OTL P;  3G29 A;  2VLO A;  2FQ1 A;  2LML A;  2FAD A;  1BXI A;  3DS4 A;  3P05 A;  1KQS O;  4QKO A;  1KD1 Q;  3G4S P;  2N6Y A;  1VQ9 P;  2KGA A;  2KG6 A;  1VQM P;  2M5R A;  2PNG A;  3G21 A;  2GDY A;  3CE7 A;  5JPA A;  2ONT A;  2AFE A;  2CNR A;  2K0X A;  2M8N A;  2X2B A;  1YJ9 P;  1CEI A;  3G26 A;  3GZM A;  1K73 Q;  1KC8 Q;  1VQN P;  2KR5 A;  3I56 P;  2PEQ A;  3DPH A;  2JB0 A;  2K2Q A;  4WYM A;  1N8R Q;  4IPY A;  1VQL P;  2NO8 A;  2L4B A;  2JU2 A;  2QA4 P;  2LIU A;  3B4Q A;  3CXC O;  2GZE A;  2Z46 A;  1AYI A;  2DNW A;  2KOS A;  5BS2 A;  1E0H A;  3CCV P;  3U43 A;  4R0M A;  3VRL C;  3MGE A;  1UJZ A;  2KWL A;  2JO0 A;  4H2X C;  4U0D A;  2JQ4 A;  3HYB A;  3GJN A;  1T8K A;  3CMA P;  1NQ4 A;  4GR6 A;  3NY7 B;  2OAR A;  1F80 D;  5DCK A;  1RNI A;  2EHS A;  3CCS P;  2AF8 A;  4H2Y C;  2EHT A;  1AF8 A;  2K94 A;  2JYG A;  1ACP A;  5KP8 B;  1VQ5 P;  1GXH A;  2DGY A;  2CQ8 A;  2GDX A;  2PY8 A;  2AVA A;  1Q82 Q;  5EJD A;  1RO0 A;  4CA3 A;  3RG2 A;  1EOQ A;  3GZL A;  2FQ0 A;  2KGC A;  3H0D A;  1VHN A;  4BPG A;  3GKL C;  5HGM A;  2KW2 A;  3NTE A;  5HGO A;  5HGN A;  1E6J P;  1RO2 A;  2FVE A;  2CWO A;  1A8O A;  3EJE A;  2ERH A;  1GPJ A;  2K0Y A;  2AFD A;  2JGP A;  2FAE A;  2VLN A;  5HGL A;  2MD9 A;  3G1G A;  1VQK P;  4COP A;  3I55 P;  5F2K A;  1OR5 A;  2FVF A;  1K9M Q;  2LTE A;  2FAC A;  2PEI A;  2LIW A;  5F2N A;  3CCR P;  4U0F A;  4NEO A;  2KOQ A;  4QNB A;  1NJI Q;  1Q7Y Q;  1DV5 A;  2VSQ A;  1YIT P;  2P9X A;  3CCE P;  3M1M A;  1A43 A;  1VQ6 P;  2KOO A;  4F37 A;  1VQ8 P;  2ROQ A;  5BS1 A;  2E1M A;  1M6N A;  2JYL A;  4U0A A;  3G28 A;  4DG9 A; 
#chains in the Genus database with same CATH homology
 5HVC A;  3NY7 B;  4PWV B;  1F80 D;  2LOL A;  1VKU A;  2KGD A;  2EHS A;  2L0Q A;  3EJD A;  2AF8 A;  5HV8 A;  4H2Y C;  2K93 A;  2LL8 A;  2CGQ A;  2XZ0 D;  2FHS C;  2EHT A;  2K92 A;  1AF8 A;  2K94 A;  1L0I A;  1ACP A;  1DNY A;  2MF4 A;  5KP8 B;  2N50 A;  2FQ1 A;  5KP6 B;  2CQ8 A;  2GDX A;  2LML A;  2AVA A;  2FQ2 A;  2FAD A;  2LPK A;  2L9F A;  4DG9 A;  2XZ1 C;  5EJD A;  4CA3 A;  3LMO A;  3RG2 A;  2N6Y A;  3GZL A;  2FQ0 A;  2KGC A;  2KGA A;  1KLP A;  2KG6 A;  1HQB A;  2M5R A;  4PXH B;  2PNG A;  4BPG A;  2GDY A;  3CE7 A;  2KW2 A;  2AFE A;  2N6Z A;  2CNR A;  4H2W C;  2K0X A;  2N98 A;  2JU1 A;  2KGE A;  2X2B A;  2FVE A;  2L22 A;  1X3O A;  3EJE A;  2KOP A;  2K0Y A;  2AFD A;  3GZM A;  2JGP A;  2FAE A;  5KP7 B;  2MD9 A;  4BPF A;  2KG8 A;  2KR5 A;  4BPH A;  5CZD B;  4IZ6 A;  2MR8 A;  1OR5 A;  2FVF A;  2CG5 B;  2K2Q A;  2LTE A;  2FAC A;  2LIW A;  1L0H A;  2L4B A;  2JU2 A;  2LIU A;  2MY5 A;  4NEO A;  2KOQ A;  1HY8 A;  2DNW A;  2KOS A;  3EJB A;  4HKG A;  2FVA A;  2MR7 A;  1DV5 A;  2VSQ A;  4R0M A;  2KG9 A;  2KWL A;  2QNW A;  2KOR A;  2KOO A;  2MVU A;  2GDW A;  4H2X C;  2JQ4 A;  2ROQ A;  2N5I A;  4MRT C;  1T8K A;  2LKI A;  2MVV A;  1NQ4 A;  2N5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...