4NEOA

Structure of blmi, a type-ii acyl-carrier-protein from streptomyces verticillus involved in bleomycin biosynthesis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
82
Chain Sequence
b'APRGERTRRRALERDIAAIWAETLGRDSVGPHEDFAALGGNSIHAIITNRVEELVDAELSIRVLLETRTVAGMTDHVHATLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide synthetase NRPS type II-PCP
publication title The crystal structure of BlmI as a model for nonribosomal peptide synthetase peptidyl carrier proteins.
pubmed doi rcsb
source organism Streptomyces verticillus
molecule tags Ligase
total genus 29
structure length 82
sequence length 83
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4neoA00
2KG6A 2FQ0A 5EJDA 1HY8A 2KG8A 2KOPA 2KGEA 2L4BA 2N98A 2XZ1C 2CG5B 4HKGA 2KWLA 3CE7A 4PXHB 4BPGA 2LIWA 2EHSA 4CA3A 2AFDA 2EHTA 5CZDB 2KGAA 2KR5A 2MF4A 2X2BA 4R0MA 2MR7A 2N5HA 5KP7B 1L0IA 5HV8A 2ROQA 1L0HA 2KORA 2FQ2A 5KP8B 4H2XC 2GDXA 5KP6B 2KOSA 2N50A 1NQ4A 2FADA 2JQ4A 2FVFA 2LMLA 4H2WC 3RG2A 2N5IA 1X3OA 4NEOA 1DNYA 5HVCA 4DG9A 2FAEA 1AF8A 2JGPA 2MVUA 1HQBA 2AFEA 1F80D 1T8KA 3EJBA 3NY7B 2QNWA 2FHSC 2KGCA 2VSQA 2CGQA 2MD9A 3GZMA 2FVEA 2KOOA 2CQ8A 2N6ZA 2LL8A 3EJDA 1KLPA 2FVAA 4H2YC 2CNRA 3LMOA 2MR8A 2JU2A 2KG9A 2FACA 2L0QA 2L9FA 3GZLA 2K93A 4BPHA 2GDYA 2LIUA 2AVAA 2AF8A 4IZ6A 4MRTC 2MVVA 4BPFA 1ACPA 2K2QA 2LOLA 2K92A 2K94A 2PNGA 3EJEA 2DNWA 2KOQA 1VKUA 2JU1A 2FQ1A 2M5RA 2L22A 2N6YA 4PWVB 2GDWA 2LTEA 1DV5A 2K0XA 2LKIA 2KW2A 2XZ0D 1OR5A 2K0YA 2KGDA 2LPKA 2MY5A
chains in the Genus database with same CATH superfamily
2EG5A 2CWOA 3H47A 5EJDA 3CCLP 3CMEP 2N98A 1D1DA 3I56P 4BPGA 3CCSP 2LIWA 4U0EA 2PEQA 1Q82Q 4XROA 2ONTA 2WPTA 1VQKP 1S72P 5JPAA 3G0VA 5KP7B 1L0HA 4U0FA 2XT1A 1A8OA 2GZGA 2FADA 3CCRP 2JQ4A 2FVFA 2LMLA 4H2WC 1X3OA 3DS3A 1VQNP 4DG9A 1AF8A 2JAZA 2KGCA 2CGQA 2OARA 2MD9A 1K30A 3G28A 2FVEA 2KOOA 2EFJA 4XRQA 2FVAA 4XFZA 4H2YC 1VQMP 2L9FA 1IMQA 3GZLA 3CCJP 1VHNA 4MRTC 4IZ6A 1Z6MA 4BPFA 1YIJP 2JO0A 2K2QA 2GZEA 1GPJA 3G21A 1EOQA 2M8PA 1VKUA 2JU1A 4U0CA 2L22A 3CCQP 1QVFO 3G6EP 2MY5A 3I55P 1Q7YQ 2KGEA 2L4BA 2XZ1C 2QA4P 5F2KA 4HKGA 1KQSO 1M6EX 1MZ8A 3G71P 4CA3A 5HGOA 3E2DA 1IUQA 2JBGA 2GYKA 1EMVA 7CEIA 2KGAA 2X2BA 1VQ4P 2MR7A 1K9MQ 3G1IA 2FQ2A 3DTJA 3HZQA 5KP8B 2GDXA 3GJNA 1NQ4A 3GKLC 3CCUP 3LRYA 2M8NA 1M90Q 1VQ8P 1M1KQ 4NEOA 2MVUA 2PY8A 1W2BO 1HQBA 2PEOA 2KODA 4U0AA 2VLOA 2FHSC 2VSQA 3MGEA 4UHPB 3GZMA 2CQ8A 1YJNP 2JYLA 3G29A 3LMOA 2K5XA 2MR8A 1VQLP 2JU2A 4BPHA 3CC2P 2L0QA 3CMAP 1N8RQ 1NJIQ 2AVAA 2AF8A 4GR6A 1ACPA 2DGYA 4QNBA 2LOLA 2Z46A 1VQ7P 2P9XA 1ZMBA 2PEIA 3CC4P 2K94A 4WYMA 3CC7P 5I4TG 2M5RA 2LTEA 2K0XA 1IMPA 2XZ0D 3G26A 1OR5A 2K0YA 2QEXP 5HGNA 1VQ9P 3DS2A 2FQ0A 5F2NA 1UJZA 2NO8A 2KG8A 2KOPA 1GXGA 1YI2P 2CG5B 2KWLA 2BUOA 4COPA 2VLQA 4PH1A 2GZJA 4M0IA 1VQPP 2GZIA 3DPHA 2EHTA 5CZDB 1RO0A 2Z45A 4R0MA 1QRJA 1AUMA 1YHQP 5HV8A 3DS5A 3NTEA 2KORA 4H2XC 1K8AQ 5KP6B 1Q86Q 4QKOA 1BXIA 4XFXA 1QVGO 3RG2A 2LF4A 3M1MA 1VQ6P 1M74A 2JB0A 2FAEA 2JGPA 2K0DX 2OTLP 1F80D 1T8KA 1ZNVA 3B4QA 3EJBA 3NY7B 2QNWA 1Q81Q 2ERHA 1RO2A 2N6ZA 2XV6A 4GR2A 3EJDA 1EIAA 3G4SP 1YJ9P 2CNRA 3CD6P 2GDYA 2VLNA 1AYIA 2PNGA 3WBHA 3EJEA 2KOQA 1JJ2O 3CCMP 1DV5A 2FQ1A 1BAJA 1VQ5P 1K73Q 2KW2A 2KGDA 2LPKA 5F2OA 1FR2A 2KG6A 3B5IA 1HY8A 3DS4A 2E1MA 3CE7A 4PXHB 2L6EA 3VRLC 2EHSA 4PH0A 3CCVP 2AFDA 3DS1A 2PEMA 5EW5E 2PEKA 2Z44A 2KR5A 2MF4A 2N5HA 1L0IA 2ROQA 4IPYA 3CPWO 4XFYA 2KOSA 1YJWP 2N50A 3OW2O 4U0BA 3DS0A 2M8LA 2XXMA 3G1GA 2BHVA 2N5IA 1A43A 1GXHA 1RNIA 3RG6C 3Q20A 1DNYA 5HVCA 2AFEA 2GZFA 3P05A 3U43A 2PEJA 1KC8Q 2VLPA 3H0DA 1E6JP 1VQOP 2LL8A 1M6NA 2OTJP 1YITP 1KLPA 1E0HA 1UNKA 2KG9A 2FACA 4COCA 2K93A 1KD1Q 2LIUA 5BS1A 5HGLA 2MVVA 5BS2A 1CEIA 2K92A 3H4EA 2PENA 4F37A 3CCEP 2DNWA 2N6YA 5DCKA 4PWVB 2GDWA 3CXCO 2JYGA 2LKIA 5HGMA 3HYBA 2EIAA 4U0DA
chains in the Genus database with same CATH topology
2KG6A 2FQ0A 5EJDA 1HY8A 2KG8A 2KOPA 2KGEA 2L4BA 2N98A 2XZ1C 2CG5B 4HKGA 2KWLA 3CE7A 4PXHB 4BPGA 2LIWA 2EHSA 4CA3A 2AFDA 2EHTA 5CZDB 2KGAA 2KR5A 2MF4A 2X2BA 4R0MA 2MR7A 2N5HA 5KP7B 1L0IA 5HV8A 2ROQA 1L0HA 2KORA 2FQ2A 5KP8B 4H2XC 2GDXA 5KP6B 2KOSA 2N50A 1NQ4A 2FADA 2JQ4A 2FVFA 2LMLA 4H2WC 3RG2A 2N5IA 1X3OA 4NEOA 1DNYA 5HVCA 4DG9A 2FAEA 1AF8A 2JGPA 2MVUA 1HQBA 2AFEA 1F80D 1T8KA 3EJBA 3NY7B 2QNWA 2FHSC 2KGCA 2VSQA 2CGQA 2MD9A 3GZMA 2FVEA 2KOOA 2CQ8A 2N6ZA 2LL8A 3EJDA 1KLPA 2FVAA 4H2YC 2CNRA 3LMOA 2MR8A 2JU2A 2KG9A 2FACA 2L0QA 2L9FA 3GZLA 2K93A 4BPHA 2GDYA 2LIUA 2AVAA 2AF8A 4IZ6A 4MRTC 2MVVA 4BPFA 1ACPA 2K2QA 2LOLA 2K92A 2K94A 2PNGA 3EJEA 2DNWA 2KOQA 1VKUA 2JU1A 2FQ1A 2M5RA 2L22A 2N6YA 4PWVB 2GDWA 2LTEA 1DV5A 2K0XA 2LKIA 2KW2A 2XZ0D 1OR5A 2K0YA 2KGDA 2LPKA 2MY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG6 A;  2FQ0 A;  5EJD A;  1HY8 A;  2KG8 A;  2KOP A;  2KGE A;  2L4B A;  2N98 A;  2XZ1 C;  2CG5 B;  4HKG A;  2KWL A;  3CE7 A;  4PXH B;  4BPG A;  2LIW A;  2EHS A;  4CA3 A;  2AFD A;  2EHT A;  5CZD B;  2KGA A;  2KR5 A;  2MF4 A;  2X2B A;  4R0M A;  2MR7 A;  2N5H A;  5KP7 B;  1L0I A;  5HV8 A;  2ROQ A;  1L0H A;  2KOR A;  2FQ2 A;  5KP8 B;  4H2X C;  2GDX A;  5KP6 B;  2KOS A;  2N50 A;  1NQ4 A;  2FAD A;  2JQ4 A;  2FVF A;  2LML A;  4H2W C;  3RG2 A;  2N5I A;  1X3O A;  4NEO A;  1DNY A;  5HVC A;  4DG9 A;  2FAE A;  1AF8 A;  2JGP A;  2MVU A;  1HQB A;  2AFE A;  1F80 D;  1T8K A;  3EJB A;  3NY7 B;  2QNW A;  2FHS C;  2KGC A;  2VSQ A;  2CGQ A;  2MD9 A;  3GZM A;  2FVE A;  2KOO A;  2CQ8 A;  2N6Z A;  2LL8 A;  3EJD A;  1KLP A;  2FVA A;  4H2Y C;  2CNR A;  3LMO A;  2MR8 A;  2JU2 A;  2KG9 A;  2FAC A;  2L0Q A;  2L9F A;  3GZL A;  2K93 A;  4BPH A;  2GDY A;  2LIU A;  2AVA A;  2AF8 A;  4IZ6 A;  4MRT C;  2MVV A;  4BPF A;  1ACP A;  2K2Q A;  2LOL A;  2K92 A;  2K94 A;  2PNG A;  3EJE A;  2DNW A;  2KOQ A;  1VKU A;  2JU1 A;  2FQ1 A;  2M5R A;  2L22 A;  2N6Y A;  4PWV B;  2GDW A;  2LTE A;  1DV5 A;  2K0X A;  2LKI A;  2KW2 A;  2XZ0 D;  1OR5 A;  2K0Y A;  2KGD A;  2LPK A;  2MY5 A; 
#chains in the Genus database with same CATH topology
 2EG5 A;  2CWO A;  3H47 A;  5EJD A;  3CCL P;  3CME P;  2N98 A;  1D1D A;  3I56 P;  4BPG A;  3CCS P;  2LIW A;  4U0E A;  2PEQ A;  1Q82 Q;  4XRO A;  2ONT A;  2WPT A;  1VQK P;  1S72 P;  5JPA A;  3G0V A;  5KP7 B;  1L0H A;  4U0F A;  2XT1 A;  1A8O A;  2GZG A;  2FAD A;  3CCR P;  2JQ4 A;  2FVF A;  2LML A;  4H2W C;  1X3O A;  3DS3 A;  1VQN P;  4DG9 A;  1AF8 A;  2JAZ A;  2KGC A;  2CGQ A;  2OAR A;  2MD9 A;  1K30 A;  3G28 A;  2FVE A;  2KOO A;  2EFJ A;  4XRQ A;  2FVA A;  4XFZ A;  4H2Y C;  1VQM P;  2L9F A;  1IMQ A;  3GZL A;  3CCJ P;  1VHN A;  4MRT C;  4IZ6 A;  1Z6M A;  4BPF A;  1YIJ P;  2JO0 A;  2K2Q A;  2GZE A;  1GPJ A;  3G21 A;  1EOQ A;  2M8P A;  1VKU A;  2JU1 A;  4U0C A;  2L22 A;  3CCQ P;  1QVF O;  3G6E P;  2MY5 A;  3I55 P;  1Q7Y Q;  2KGE A;  2L4B A;  2XZ1 C;  2QA4 P;  5F2K A;  4HKG A;  1KQS O;  1M6E X;  1MZ8 A;  3G71 P;  4CA3 A;  5HGO A;  3E2D A;  1IUQ A;  2JBG A;  2GYK A;  1EMV A;  7CEI A;  2KGA A;  2X2B A;  1VQ4 P;  2MR7 A;  1K9M Q;  3G1I A;  2FQ2 A;  3DTJ A;  3HZQ A;  5KP8 B;  2GDX A;  3GJN A;  1NQ4 A;  3GKL C;  3CCU P;  3LRY A;  2M8N A;  1M90 Q;  1VQ8 P;  1M1K Q;  4NEO A;  2MVU A;  2PY8 A;  1W2B O;  1HQB A;  2PEO A;  2KOD A;  4U0A A;  2VLO A;  2FHS C;  2VSQ A;  3MGE A;  4UHP B;  3GZM A;  2CQ8 A;  1YJN P;  2JYL A;  3G29 A;  3LMO A;  2K5X A;  2MR8 A;  1VQL P;  2JU2 A;  4BPH A;  3CC2 P;  2L0Q A;  3CMA P;  1N8R Q;  1NJI Q;  2AVA A;  2AF8 A;  4GR6 A;  1ACP A;  2DGY A;  4QNB A;  2LOL A;  2Z46 A;  1VQ7 P;  2P9X A;  1ZMB A;  2PEI A;  3CC4 P;  2K94 A;  4WYM A;  3CC7 P;  5I4T G;  2M5R A;  2LTE A;  2K0X A;  1IMP A;  2XZ0 D;  3G26 A;  1OR5 A;  2K0Y A;  2QEX P;  5HGN A;  1VQ9 P;  3DS2 A;  2FQ0 A;  5F2N A;  1UJZ A;  2NO8 A;  2KG8 A;  2KOP A;  1GXG A;  1YI2 P;  2CG5 B;  2KWL A;  2BUO A;  4COP A;  2VLQ A;  4PH1 A;  2GZJ A;  4M0I A;  1VQP P;  2GZI A;  3DPH A;  2EHT A;  5CZD B;  1RO0 A;  2Z45 A;  4R0M A;  1QRJ A;  1AUM A;  1YHQ P;  5HV8 A;  3DS5 A;  3NTE A;  2KOR A;  4H2X C;  1K8A Q;  5KP6 B;  1Q86 Q;  4QKO A;  1BXI A;  4XFX A;  1QVG O;  3RG2 A;  2LF4 A;  3M1M A;  1VQ6 P;  1M74 A;  2JB0 A;  2FAE A;  2JGP A;  2K0D X;  2OTL P;  1F80 D;  1T8K A;  1ZNV A;  3B4Q A;  3EJB A;  3NY7 B;  2QNW A;  1Q81 Q;  2ERH A;  1RO2 A;  2N6Z A;  2XV6 A;  4GR2 A;  3EJD A;  1EIA A;  3G4S P;  1YJ9 P;  2CNR A;  3CD6 P;  2GDY A;  2VLN A;  1AYI A;  2PNG A;  3WBH A;  3EJE A;  2KOQ A;  1JJ2 O;  3CCM P;  1DV5 A;  2FQ1 A;  1BAJ A;  1VQ5 P;  1K73 Q;  2KW2 A;  2KGD A;  2LPK A;  5F2O A;  1FR2 A;  2KG6 A;  3B5I A;  1HY8 A;  3DS4 A;  2E1M A;  3CE7 A;  4PXH B;  2L6E A;  3VRL C;  2EHS A;  4PH0 A;  3CCV P;  2AFD A;  3DS1 A;  2PEM A;  5EW5 E;  2PEK A;  2Z44 A;  2KR5 A;  2MF4 A;  2N5H A;  1L0I A;  2ROQ A;  4IPY A;  3CPW O;  4XFY A;  2KOS A;  1YJW P;  2N50 A;  3OW2 O;  4U0B A;  3DS0 A;  2M8L A;  2XXM A;  3G1G A;  2BHV A;  2N5I A;  1A43 A;  1GXH A;  1RNI A;  3RG6 C;  3Q20 A;  1DNY A;  5HVC A;  2AFE A;  2GZF A;  3P05 A;  3U43 A;  2PEJ A;  1KC8 Q;  2VLP A;  3H0D A;  1E6J P;  1VQO P;  2LL8 A;  1M6N A;  2OTJ P;  1YIT P;  1KLP A;  1E0H A;  1UNK A;  2KG9 A;  2FAC A;  4COC A;  2K93 A;  1KD1 Q;  2LIU A;  5BS1 A;  5HGL A;  2MVV A;  5BS2 A;  1CEI A;  2K92 A;  3H4E A;  2PEN A;  4F37 A;  3CCE P;  2DNW A;  2N6Y A;  5DCK A;  4PWV B;  2GDW A;  3CXC O;  2JYG A;  2LKI A;  5HGM A;  3HYB A;  2EIA A;  4U0D A; 
#chains in the Genus database with same CATH homology
 2KG6 A;  2FQ0 A;  5EJD A;  1HY8 A;  2KG8 A;  2KOP A;  2KGE A;  2L4B A;  2N98 A;  2XZ1 C;  2CG5 B;  4HKG A;  2KWL A;  3CE7 A;  4PXH B;  4BPG A;  2LIW A;  2EHS A;  4CA3 A;  2AFD A;  2EHT A;  5CZD B;  2KGA A;  2KR5 A;  2MF4 A;  2X2B A;  4R0M A;  2MR7 A;  2N5H A;  5KP7 B;  1L0I A;  5HV8 A;  2ROQ A;  1L0H A;  2KOR A;  2FQ2 A;  5KP8 B;  4H2X C;  2GDX A;  5KP6 B;  2KOS A;  2N50 A;  1NQ4 A;  2FAD A;  2JQ4 A;  2FVF A;  2LML A;  4H2W C;  3RG2 A;  2N5I A;  1X3O A;  4NEO A;  1DNY A;  5HVC A;  4DG9 A;  2FAE A;  1AF8 A;  2JGP A;  2MVU A;  1HQB A;  2AFE A;  1F80 D;  1T8K A;  3EJB A;  3NY7 B;  2QNW A;  2FHS C;  2KGC A;  2VSQ A;  2CGQ A;  2MD9 A;  3GZM A;  2FVE A;  2KOO A;  2CQ8 A;  2N6Z A;  2LL8 A;  3EJD A;  1KLP A;  2FVA A;  4H2Y C;  2CNR A;  3LMO A;  2MR8 A;  2JU2 A;  2KG9 A;  2FAC A;  2L0Q A;  2L9F A;  3GZL A;  2K93 A;  4BPH A;  2GDY A;  2LIU A;  2AVA A;  2AF8 A;  4IZ6 A;  4MRT C;  2MVV A;  4BPF A;  1ACP A;  2K2Q A;  2LOL A;  2K92 A;  2K94 A;  2PNG A;  3EJE A;  2DNW A;  2KOQ A;  1VKU A;  2JU1 A;  2FQ1 A;  2M5R A;  2L22 A;  2N6Y A;  4PWV B;  2GDW A;  2LTE A;  1DV5 A;  2K0X A;  2LKI A;  2KW2 A;  2XZ0 D;  1OR5 A;  2K0Y A;  2KGD A;  2LPK A;  2MY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...