4NEOA

Structure of blmi, a type-ii acyl-carrier-protein from streptomyces verticillus involved in bleomycin biosynthesis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
82
Chain Sequence
APRGERTRRRALERDIAAIWAETLGRDSVGPHEDFAALGGNSIHAIITNRVEELVDAELSIRVLLETRTVAGMTDHVHATLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of BlmI as a model for nonribosomal peptide synthetase peptidyl carrier proteins.
pubmed doi rcsb
source organism Streptomyces verticillus
molecule tags Ligase
molecule keywords Peptide synthetase NRPS type II-PCP
total genus 29
structure length 82
sequence length 83
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4neoA00
5KP8B 4H2XC 2LKIA 2GDWA 2LIWA 4R0MA 3EJDA 2KGAA 1HQBA 3RG2A 2N50A 1X3OA 2AFEA 2LL8A 3GZMA 2AF8A 1F80D 2KOQA 2MD9A 2XZ0D 2N5IA 2GDYA 2JU2A 4H2YC 4CA3A 2KG6A 5CZDB 2KG8A 2MVVA 2FACA 1ACPA 2L22A 2FHSC 2LTEA 2PNGA 4NEOA 2FVEA 2KORA 2N6YA 2N5HA 2AVAA 4MRTC 2JU1A 2FQ1A 4PWVB 2KR5A 5EJDA 4BPFA 1KLPA 2KOPA 1DV5A 1HY8A 3EJBA 2X2BA 2CGQA 3GZLA 2EHSA 2L4BA 2AFDA 2FVAA 2CNRA 2L9FA 2MR8A 2DNWA 1NQ4A 2N6ZA 2FQ2A 3LMOA 2MVUA 4H2WC 4HKGA 2FADA 2FAEA 2QNWA 1L0HA 2KGDA 1T8KA 1DNYA 5KP7B 2MR7A 2KG9A 5KP6B 2KOOA 2K93A 2FQ0A 3NY7B 1AF8A 2LPKA 2EHTA 5HVCA 2K94A 2MF4A 3EJEA 3CE7A 2FVFA 4DG9A 2LIUA 2K2QA 2VSQA 2L0QA 2LMLA 2GDXA 4BPHA 2LOLA 2K92A 2KOSA 2K0XA 5HV8A 2CQ8A 2KGCA 4PXHB 1L0IA 4IZ6A 2KGEA 2M5RA 2CG5B 2N98A 1OR5A 2MY5A 2KWLA 2K0YA 2JGPA 2JQ4A 2ROQA 2XZ1C 4BPGA 1VKUA 2KW2A
chains in the Genus database with same CATH superfamily
2VLNA 2P9XA 4H2XC 1VHNA 2KODA 1VQMP 2GYKA 3CXCO 1HQBA 4XROA 3RG6C 1X3OA 2AFEA 4COPA 4U0CA 3DTJA 3H4EA 3WBHA 1RO2A 2PEOA 1S72P 2PY8A 1VQ4P 5HGLA 1NJIQ 4CA3A 2KG6A 1K8AQ 2K5XA 2PENA 2FQ1A 5EJDA 2KOPA 4PH1A 3GZLA 2EHSA 2FVAA 3HYBA 1N8RQ 4HKGA 1IUQA 3G1IA 2GZEA 2KGDA 1T8KA 2K93A 1FR2A 3M1MA 3G26A 1AF8A 5F2NA 4U0DA 1BAJA 4PH0A 1YHQP 1YITP 2EG5A 2MF4A 2FVFA 4XFYA 5DCKA 3I55P 1QRJA 2KOSA 2CQ8A 2M5RA 1YI2P 1KC8Q 1W2BO 3P05A 3LRYA 2K0YA 2JGPA 5BS1A 4F37A 2VLQA 4BPGA 4QNBA 5KP8B 1VQ9P 1VQ7P 3CC4P 2NO8A 3G6EP 4XFXA 2JO0A 2M8PA 2LIWA 1MZ8A 2Z44A 2LF4A 3RG2A 2DGYA 2LL8A 3B5IA 1EIAA 1F80D 2JYLA 4U0EA 5BS2A 3DS5A 3DS0A 1Q86Q 3CMEP 2QA4P 2XZ0D 2OTJP 2N5IA 3Q20A 2GZFA 4COCA 5EW5E 3CCRP 2VLOA 2L22A 2LTEA 2PNGA 2FVEA 1VQ5P 2KORA 2GZIA 1VQOP 3DS4A 2OTLP 2AVAA 4MRTC 3CC2P 2M8NA 4PWVB 1JJ2O 4BPFA 2M8LA 4WYMA 2L6EA 1RNIA 2CGQA 3CCJP 2CNRA 2MR8A 1NQ4A 3G71P 3G0VA 2MVUA 1VQPP 2JBGA 2FAEA 1L0HA 4M0IA 1DNYA 1UJZA 2KG9A 5KP6B 1KD1Q 2PEMA 4XFZA 1Q7YQ 2FQ0A 1QVGO 2EHTA 3CD6P 2K2QA 2L0QA 2LMLA 4BPHA 3MGEA 2K92A 2KGEA 3G1GA 1IMPA 2K0DX 1UNKA 1YJ9P 1ZNVA 2XZ1C 3CCQP 1VKUA 2BUOA 2LKIA 2BHVA 2GDWA 2PEIA 1EOQA 1VQNP 1VQ6P 1D1DA 3CCUP 2EFJA 4GR2A 4U0BA 1AUMA 1GXHA 2JAZA 3GZMA 3CCVP 3DS2A 1YJWP 2OARA 3DS3A 1RO0A 1GXGA 1VQLP 2MD9A 3CCMP 3G29A 3VRLC 4H2YC 3I56P 5CZDB 1VQ8P 2QEXP 2MVVA 1VQKP 2FACA 1ACPA 1YJNP 2FHSC 3CMAP 5HGOA 2JB0A 5F2KA 1M1KQ 2N6YA 3E2DA 3G4SP 2PEKA 1KLPA 1HY8A 3EJBA 2X2BA 3NTEA 2L4BA 2WPTA 1M6EX 4UHPB 5HGMA 2N6ZA 3H47A 2FQ2A 5I4TG 2XXMA 3GJNA 3DPHA 1M74A 5KP7B 2KOOA 3OW2O 1QVFO 4XRQA 5HVCA 1M6NA 3CE7A 1K73Q 4DG9A 2VSQA 3G28A 2Z46A 1A8OA 4IZ6A 2N98A 2MY5A 2EIAA 3LMOA 2KW2A 3CCEP 2E1MA 4R0MA 3EJDA 1BXIA 1KQSO 3G21A 1Z6MA 2XT1A 2KGAA 3U43A 4U0FA 2N50A 4IPYA 2AF8A 1K9MQ 2XV6A 2KOQA 5HGNA 2ERHA 2GDYA 2JU2A 4U0AA 2PEQA 1A43A 2KG8A 1YIJP 1GPJA 4NEOA 1IMQA 2N5HA 2Z45A 2JYGA 2ONTA 1K30A 2JU1A 7CEIA 2CWOA 5F2OA 4QKOA 2KR5A 3H0DA 1DV5A 3GKLC 2GZJA 3CCSP 2AFDA 2GZGA 1EMVA 2L9FA 2DNWA 1ZMBA 4H2WC 3CPWO 1AYIA 2FADA 1Q81Q 1CEIA 3CCLP 2QNWA 3B4QA 2MR7A 2VLPA 3NY7B 3CC7P 2LPKA 2K94A 1Q82Q 3EJEA 5JPAA 1E6JP 2LIUA 1E0HA 2GDXA 2LOLA 3HZQA 2K0XA 5HV8A 2KGCA 3DS1A 1L0IA 4PXHB 2CG5B 2PEJA 1OR5A 2KWLA 2JQ4A 2ROQA 1M90Q 4GR6A
chains in the Genus database with same CATH topology
5KP8B 4H2XC 2LKIA 2GDWA 2LIWA 4R0MA 3EJDA 2KGAA 1HQBA 3RG2A 2N50A 1X3OA 2AFEA 2LL8A 3GZMA 2AF8A 1F80D 2KOQA 2MD9A 2XZ0D 2N5IA 2GDYA 2JU2A 4H2YC 4CA3A 2KG6A 5CZDB 2KG8A 2MVVA 2FACA 1ACPA 2L22A 2FHSC 2LTEA 2PNGA 4NEOA 2FVEA 2KORA 2N6YA 2N5HA 2AVAA 4MRTC 2JU1A 2FQ1A 4PWVB 2KR5A 5EJDA 4BPFA 1KLPA 2KOPA 1DV5A 1HY8A 3EJBA 2X2BA 2CGQA 3GZLA 2EHSA 2L4BA 2AFDA 2FVAA 2CNRA 2L9FA 2MR8A 2DNWA 1NQ4A 2N6ZA 2FQ2A 3LMOA 2MVUA 4H2WC 4HKGA 2FADA 2FAEA 2QNWA 1L0HA 2KGDA 1T8KA 1DNYA 5KP7B 2MR7A 2KG9A 5KP6B 2KOOA 2K93A 2FQ0A 3NY7B 1AF8A 2LPKA 2EHTA 5HVCA 2K94A 2MF4A 3EJEA 3CE7A 2FVFA 4DG9A 2LIUA 2K2QA 2VSQA 2L0QA 2LMLA 2GDXA 4BPHA 2LOLA 2K92A 2KOSA 2K0XA 5HV8A 2CQ8A 2KGCA 4PXHB 1L0IA 4IZ6A 2KGEA 2M5RA 2CG5B 2N98A 1OR5A 2MY5A 2KWLA 2K0YA 2JGPA 2JQ4A 2ROQA 2XZ1C 4BPGA 1VKUA 2KW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KP8 B;  4H2X C;  2LKI A;  2GDW A;  2LIW A;  4R0M A;  3EJD A;  2KGA A;  1HQB A;  3RG2 A;  2N50 A;  1X3O A;  2AFE A;  2LL8 A;  3GZM A;  2AF8 A;  1F80 D;  2KOQ A;  2MD9 A;  2XZ0 D;  2N5I A;  2GDY A;  2JU2 A;  4H2Y C;  4CA3 A;  2KG6 A;  5CZD B;  2KG8 A;  2MVV A;  2FAC A;  1ACP A;  2L22 A;  2FHS C;  2LTE A;  2PNG A;  4NEO A;  2FVE A;  2KOR A;  2N6Y A;  2N5H A;  2AVA A;  4MRT C;  2JU1 A;  2FQ1 A;  4PWV B;  2KR5 A;  5EJD A;  4BPF A;  1KLP A;  2KOP A;  1DV5 A;  1HY8 A;  3EJB A;  2X2B A;  2CGQ A;  3GZL A;  2EHS A;  2L4B A;  2AFD A;  2FVA A;  2CNR A;  2L9F A;  2MR8 A;  2DNW A;  1NQ4 A;  2N6Z A;  2FQ2 A;  3LMO A;  2MVU A;  4H2W C;  4HKG A;  2FAD A;  2FAE A;  2QNW A;  1L0H A;  2KGD A;  1T8K A;  1DNY A;  5KP7 B;  2MR7 A;  2KG9 A;  5KP6 B;  2KOO A;  2K93 A;  2FQ0 A;  3NY7 B;  1AF8 A;  2LPK A;  2EHT A;  5HVC A;  2K94 A;  2MF4 A;  3EJE A;  3CE7 A;  2FVF A;  4DG9 A;  2LIU A;  2K2Q A;  2VSQ A;  2L0Q A;  2LML A;  2GDX A;  4BPH A;  2LOL A;  2K92 A;  2KOS A;  2K0X A;  5HV8 A;  2CQ8 A;  2KGC A;  4PXH B;  1L0I A;  4IZ6 A;  2KGE A;  2M5R A;  2CG5 B;  2N98 A;  1OR5 A;  2MY5 A;  2KWL A;  2K0Y A;  2JGP A;  2JQ4 A;  2ROQ A;  2XZ1 C;  4BPG A;  1VKU A;  2KW2 A; 
#chains in the Genus database with same CATH topology
 2VLN A;  2P9X A;  4H2X C;  1VHN A;  2KOD A;  1VQM P;  2GYK A;  3CXC O;  1HQB A;  4XRO A;  3RG6 C;  1X3O A;  2AFE A;  4COP A;  4U0C A;  3DTJ A;  3H4E A;  3WBH A;  1RO2 A;  2PEO A;  1S72 P;  2PY8 A;  1VQ4 P;  5HGL A;  1NJI Q;  4CA3 A;  2KG6 A;  1K8A Q;  2K5X A;  2PEN A;  2FQ1 A;  5EJD A;  2KOP A;  4PH1 A;  3GZL A;  2EHS A;  2FVA A;  3HYB A;  1N8R Q;  4HKG A;  1IUQ A;  3G1I A;  2GZE A;  2KGD A;  1T8K A;  2K93 A;  1FR2 A;  3M1M A;  3G26 A;  1AF8 A;  5F2N A;  4U0D A;  1BAJ A;  4PH0 A;  1YHQ P;  1YIT P;  2EG5 A;  2MF4 A;  2FVF A;  4XFY A;  5DCK A;  3I55 P;  1QRJ A;  2KOS A;  2CQ8 A;  2M5R A;  1YI2 P;  1KC8 Q;  1W2B O;  3P05 A;  3LRY A;  2K0Y A;  2JGP A;  5BS1 A;  4F37 A;  2VLQ A;  4BPG A;  4QNB A;  5KP8 B;  1VQ9 P;  1VQ7 P;  3CC4 P;  2NO8 A;  3G6E P;  4XFX A;  2JO0 A;  2M8P A;  2LIW A;  1MZ8 A;  2Z44 A;  2LF4 A;  3RG2 A;  2DGY A;  2LL8 A;  3B5I A;  1EIA A;  1F80 D;  2JYL A;  4U0E A;  5BS2 A;  3DS5 A;  3DS0 A;  1Q86 Q;  3CME P;  2QA4 P;  2XZ0 D;  2OTJ P;  2N5I A;  3Q20 A;  2GZF A;  4COC A;  5EW5 E;  3CCR P;  2VLO A;  2L22 A;  2LTE A;  2PNG A;  2FVE A;  1VQ5 P;  2KOR A;  2GZI A;  1VQO P;  3DS4 A;  2OTL P;  2AVA A;  4MRT C;  3CC2 P;  2M8N A;  4PWV B;  1JJ2 O;  4BPF A;  2M8L A;  4WYM A;  2L6E A;  1RNI A;  2CGQ A;  3CCJ P;  2CNR A;  2MR8 A;  1NQ4 A;  3G71 P;  3G0V A;  2MVU A;  1VQP P;  2JBG A;  2FAE A;  1L0H A;  4M0I A;  1DNY A;  1UJZ A;  2KG9 A;  5KP6 B;  1KD1 Q;  2PEM A;  4XFZ A;  1Q7Y Q;  2FQ0 A;  1QVG O;  2EHT A;  3CD6 P;  2K2Q A;  2L0Q A;  2LML A;  4BPH A;  3MGE A;  2K92 A;  2KGE A;  3G1G A;  1IMP A;  2K0D X;  1UNK A;  1YJ9 P;  1ZNV A;  2XZ1 C;  3CCQ P;  1VKU A;  2BUO A;  2LKI A;  2BHV A;  2GDW A;  2PEI A;  1EOQ A;  1VQN P;  1VQ6 P;  1D1D A;  3CCU P;  2EFJ A;  4GR2 A;  4U0B A;  1AUM A;  1GXH A;  2JAZ A;  3GZM A;  3CCV P;  3DS2 A;  1YJW P;  2OAR A;  3DS3 A;  1RO0 A;  1GXG A;  1VQL P;  2MD9 A;  3CCM P;  3G29 A;  3VRL C;  4H2Y C;  3I56 P;  5CZD B;  1VQ8 P;  2QEX P;  2MVV A;  1VQK P;  2FAC A;  1ACP A;  1YJN P;  2FHS C;  3CMA P;  5HGO A;  2JB0 A;  5F2K A;  1M1K Q;  2N6Y A;  3E2D A;  3G4S P;  2PEK A;  1KLP A;  1HY8 A;  3EJB A;  2X2B A;  3NTE A;  2L4B A;  2WPT A;  1M6E X;  4UHP B;  5HGM A;  2N6Z A;  3H47 A;  2FQ2 A;  5I4T G;  2XXM A;  3GJN A;  3DPH A;  1M74 A;  5KP7 B;  2KOO A;  3OW2 O;  1QVF O;  4XRQ A;  5HVC A;  1M6N A;  3CE7 A;  1K73 Q;  4DG9 A;  2VSQ A;  3G28 A;  2Z46 A;  1A8O A;  4IZ6 A;  2N98 A;  2MY5 A;  2EIA A;  3LMO A;  2KW2 A;  3CCE P;  2E1M A;  4R0M A;  3EJD A;  1BXI A;  1KQS O;  3G21 A;  1Z6M A;  2XT1 A;  2KGA A;  3U43 A;  4U0F A;  2N50 A;  4IPY A;  2AF8 A;  1K9M Q;  2XV6 A;  2KOQ A;  5HGN A;  2ERH A;  2GDY A;  2JU2 A;  4U0A A;  2PEQ A;  1A43 A;  2KG8 A;  1YIJ P;  1GPJ A;  4NEO A;  1IMQ A;  2N5H A;  2Z45 A;  2JYG A;  2ONT A;  1K30 A;  2JU1 A;  7CEI A;  2CWO A;  5F2O A;  4QKO A;  2KR5 A;  3H0D A;  1DV5 A;  3GKL C;  2GZJ A;  3CCS P;  2AFD A;  2GZG A;  1EMV A;  2L9F A;  2DNW A;  1ZMB A;  4H2W C;  3CPW O;  1AYI A;  2FAD A;  1Q81 Q;  1CEI A;  3CCL P;  2QNW A;  3B4Q A;  2MR7 A;  2VLP A;  3NY7 B;  3CC7 P;  2LPK A;  2K94 A;  1Q82 Q;  3EJE A;  5JPA A;  1E6J P;  2LIU A;  1E0H A;  2GDX A;  2LOL A;  3HZQ A;  2K0X A;  5HV8 A;  2KGC A;  3DS1 A;  1L0I A;  4PXH B;  2CG5 B;  2PEJ A;  1OR5 A;  2KWL A;  2JQ4 A;  2ROQ A;  1M90 Q;  4GR6 A; 
#chains in the Genus database with same CATH homology
 5KP8 B;  4H2X C;  2LKI A;  2GDW A;  2LIW A;  4R0M A;  3EJD A;  2KGA A;  1HQB A;  3RG2 A;  2N50 A;  1X3O A;  2AFE A;  2LL8 A;  3GZM A;  2AF8 A;  1F80 D;  2KOQ A;  2MD9 A;  2XZ0 D;  2N5I A;  2GDY A;  2JU2 A;  4H2Y C;  4CA3 A;  2KG6 A;  5CZD B;  2KG8 A;  2MVV A;  2FAC A;  1ACP A;  2L22 A;  2FHS C;  2LTE A;  2PNG A;  4NEO A;  2FVE A;  2KOR A;  2N6Y A;  2N5H A;  2AVA A;  4MRT C;  2JU1 A;  2FQ1 A;  4PWV B;  2KR5 A;  5EJD A;  4BPF A;  1KLP A;  2KOP A;  1DV5 A;  1HY8 A;  3EJB A;  2X2B A;  2CGQ A;  3GZL A;  2EHS A;  2L4B A;  2AFD A;  2FVA A;  2CNR A;  2L9F A;  2MR8 A;  2DNW A;  1NQ4 A;  2N6Z A;  2FQ2 A;  3LMO A;  2MVU A;  4H2W C;  4HKG A;  2FAD A;  2FAE A;  2QNW A;  1L0H A;  2KGD A;  1T8K A;  1DNY A;  5KP7 B;  2MR7 A;  2KG9 A;  5KP6 B;  2KOO A;  2K93 A;  2FQ0 A;  3NY7 B;  1AF8 A;  2LPK A;  2EHT A;  5HVC A;  2K94 A;  2MF4 A;  3EJE A;  3CE7 A;  2FVF A;  4DG9 A;  2LIU A;  2K2Q A;  2VSQ A;  2L0Q A;  2LML A;  2GDX A;  4BPH A;  2LOL A;  2K92 A;  2KOS A;  2K0X A;  5HV8 A;  2CQ8 A;  2KGC A;  4PXH B;  1L0I A;  4IZ6 A;  2KGE A;  2M5R A;  2CG5 B;  2N98 A;  1OR5 A;  2MY5 A;  2KWL A;  2K0Y A;  2JGP A;  2JQ4 A;  2ROQ A;  2XZ1 C;  4BPG A;  1VKU A;  2KW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...