4NEOA

Structure of blmi, a type-ii acyl-carrier-protein from streptomyces verticillus involved in bleomycin biosynthesis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
82
Chain Sequence
APRGERTRRRALERDIAAIWAETLGRDSVGPHEDFAALGGNSIHAIITNRVEELVDAELSIRVLLETRTVAGMTDHVHATLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide synthetase NRPS type II-PCP
publication title The crystal structure of BlmI as a model for nonribosomal peptide synthetase peptidyl carrier proteins.
pubmed doi rcsb
source organism Streptomyces verticillus
molecule tags Ligase
total genus 29
structure length 82
sequence length 83
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4neoA00
2AF8A 3EJBA 3EJDA 1NQ4A 2KW2A 1KLPA 2AVAA 2N5IA 4CA3A 2LL8A 3GZLA 1X3OA 1F80D 2LOLA 2L9FA 4PWVB 2LIWA 2KGEA 5KP7B 5HVCA 2KGDA 2PNGA 1VKUA 2KG8A 2L4BA 2MD9A 4MRTC 2KGAA 2FADA 2KG9A 2FVFA 1L0IA 2JGPA 4PXHB 2N50A 1DV5A 4H2WC 1DNYA 2MF4A 3RG2A 2LTEA 1HQBA 5KP8B 3CE7A 2MVUA 2N6YA 2FACA 2K94A 2KORA 2MR7A 4BPHA 2CNRA 1AF8A 2FQ2A 2AFDA 2GDXA 2QNWA 4BPGA 2LPKA 5EJDA 4H2YC 4H2XC 2GDYA 5KP6B 2K2QA 2KGCA 2KG6A 2JU1A 2K92A 2GDWA 2ROQA 2FVEA 2FVAA 2MVVA 2KOQA 2CQ8A 2JQ4A 4R0MA 4NEOA 1L0HA 2K0YA 1HY8A 4HKGA 2K0XA 2KOOA 2XZ0D 2L22A 1OR5A 2K93A 2FAEA 2MR8A 2KR5A 1ACPA 2FHSC 2DNWA 3LMOA 2CG5B 2N5HA 2M5RA 2EHSA 2CGQA 3EJEA 3GZMA 2LIUA 4DG9A 5CZDB 2AFEA 2L0QA 2LKIA 4IZ6A 2MY5A 1T8KA 2N98A 4BPFA 2KWLA 2N6ZA 3NY7B 2KOSA 2JU2A 2KOPA 2EHTA 2FQ1A 2FQ0A 2X2BA 2VSQA 5HV8A 2XZ1C 2LMLA
chains in the Genus database with same CATH superfamily
3EJDA 1NQ4A 1N8RQ 2AVAA 4U0BA 3G29A 1Q81Q 1X3OA 2JYGA 1VQ4P 2LIWA 5KP7B 1KQSO 3GKLC 2PNGA 1GXHA 1VQ7P 2KGAA 1FR2A 2KG9A 1QVGO 1DV5A 4PH0A 4COPA 1DNYA 5KP8B 1VQ9P 4WYMA 2M8NA 2FACA 1Q82Q 1VQ6P 2MR7A 4BPHA 3CXCO 1IUQA 4QKOA 4GR2A 1K30A 3CCLP 1VQLP 3HZQA 1RNIA 2VLQA 1ZNVA 5F2KA 2OTJP 2MVVA 2K5XA 5F2NA 2K0YA 1HY8A 4HKGA 2OARA 3CCVP 3Q20A 7CEIA 2L22A 3U43A 1M1KQ 1M74A 2JAZA 2FHSC 5HGOA 2L6EA 2ERHA 2N5HA 4U0AA 3EJEA 2GZGA 3DTJA 5CZDB 3G6EP 2NO8A 2PEQA 3CC2P 2MY5A 1T8KA 2KWLA 3CPWO 1E0HA 2KOPA 1A8OA 2EHTA 1D1DA 2X2BA 3CD6P 1RO2A 2AF8A 3EJBA 2KW2A 2N5IA 3HYBA 2JO0A 2LL8A 2M8PA 2EIAA 2Z46A 1YI2P 4PWVB 2GZEA 5HVCA 2CWOA 1VKUA 2KG8A 1VQ5P 3B5IA 2JBGA 2PEJA 3G0VA 3M1MA 2FVFA 2N50A 5BS2A 2BHVA 4PH1A 2MVUA 3CCRP 3B4QA 5BS1A 2XXMA 1AF8A 3CCJP 3DS5A 2Z44A 2JYLA 4H2XC 2GDYA 2PEKA 2PEIA 5KP6B 1Q7YQ 2K2QA 2K92A 1BAJA 2FVEA 3CC4P 2KOQA 3CCSP 1VQ8P 2JQ4A 4R0MA 1VQOP 3H47A 1L0HA 1M6NA 4IPYA 2DGYA 1YITP 1MZ8A 3DS4A 1GPJA 2M5RA 2GYKA 4U0DA 1YJNP 4DG9A 2AFEA 3CMAP 4BPFA 3CC7P 3NY7B 2KOSA 1RO0A 1QVFO 2XV6A 2FQ1A 1CEIA 1Q86Q 3G71P 2JB0A 2OTLP 3G21A 3GZLA 1F80D 2L4BA 2MD9A 2FADA 1KC8Q 1L0IA 1E6JP 2JGPA 4PXHB 3H0DA 4H2WC 4M0IA 2MF4A 1A43A 1HQBA 2QA4P 2N6YA 1YHQP 1YJ9P 2PY8A 3LRYA 1UJZA 2CNRA 1GXGA 3P05A 1AUMA 3CCUP 3MGEA 4BPGA 1K73Q 4H2YC 4XFXA 3GJNA 2KG6A 4U0EA 2GDWA 5HGNA 1S72P 1VQNP 1K9MQ 1W2BO 4XFYA 2K0XA 2XZ0D 4XROA 4U0FA 2K93A 2FAEA 2MR8A 1Z6MA 2KR5A 1ACPA 2WPTA 3LMOA 2CG5B 5HGLA 2P9XA 2EHSA 3VRLC 1VQKP 1EIAA 2LIUA 2QEXP 4IZ6A 3I56P 1YJWP 1AYIA 1YIJP 3DS0A 4QNBA 2VLNA 3NTEA 4COCA 2LF4A 2VSQA 3G4SP 5HV8A 1UNKA 5F2OA 1EMVA 4F37A 2M8LA 2PEOA 1KLPA 1VHNA 2XT1A 4CA3A 3RG6C 2LOLA 2L9FA 2KGEA 3CCEP 3DPHA 2KGDA 3WBHA 2VLOA 1VQMP 3G1IA 2Z45A 4MRTC 3G1GA 2VLPA 4GR6A 4XRQA 3RG2A 1BXIA 2LTEA 3CE7A 2E1MA 2K94A 5HGMA 2KORA 2BUOA 3DS2A 3H4EA 5JPAA 2FQ2A 2AFDA 1VQPP 2GDXA 2QNWA 2LPKA 5EJDA 3DS1A 3OW2O 4XFZA 5I4TG 2KGCA 1IMPA 2JU1A 2EG5A 1K8AQ 2ROQA 1ZMBA 2FVAA 2EFJA 4UHPB 1EOQA 2CQ8A 4NEOA 3DS3A 1IMQA 2KOOA 1QRJA 3G28A 1OR5A 2PENA 1M90Q 1M6EX 5EW5E 3CCMP 2DNWA 5DCKA 2K0DX 3I55P 2CGQA 1JJ2O 3GZMA 2GZIA 3E2DA 3CMEP 2L0QA 2LKIA 3CCQP 3G26A 2N98A 2ONTA 2N6ZA 1KD1Q 2GZFA 2JU2A 2KODA 1NJIQ 2FQ0A 2PEMA 2XZ1C 4U0CA 2GZJA 2LMLA
chains in the Genus database with same CATH topology
2AF8A 3EJBA 3EJDA 1NQ4A 2KW2A 1KLPA 2AVAA 2N5IA 4CA3A 2LL8A 3GZLA 1X3OA 1F80D 2LOLA 2L9FA 4PWVB 2LIWA 2KGEA 5KP7B 5HVCA 2KGDA 2PNGA 1VKUA 2KG8A 2L4BA 2MD9A 4MRTC 2KGAA 2FADA 2KG9A 2FVFA 1L0IA 2JGPA 4PXHB 2N50A 1DV5A 4H2WC 1DNYA 2MF4A 3RG2A 2LTEA 1HQBA 5KP8B 3CE7A 2MVUA 2N6YA 2FACA 2K94A 2KORA 2MR7A 4BPHA 2CNRA 1AF8A 2FQ2A 2AFDA 2GDXA 2QNWA 4BPGA 2LPKA 5EJDA 4H2YC 4H2XC 2GDYA 5KP6B 2K2QA 2KGCA 2KG6A 2JU1A 2K92A 2GDWA 2ROQA 2FVEA 2FVAA 2MVVA 2KOQA 2CQ8A 2JQ4A 4R0MA 4NEOA 1L0HA 2K0YA 1HY8A 4HKGA 2K0XA 2KOOA 2XZ0D 2L22A 1OR5A 2K93A 2FAEA 2MR8A 2KR5A 1ACPA 2FHSC 2DNWA 3LMOA 2CG5B 2N5HA 2M5RA 2EHSA 2CGQA 3EJEA 3GZMA 2LIUA 4DG9A 5CZDB 2AFEA 2L0QA 2LKIA 4IZ6A 2MY5A 1T8KA 2N98A 4BPFA 2KWLA 2N6ZA 3NY7B 2KOSA 2JU2A 2KOPA 2EHTA 2FQ1A 2FQ0A 2X2BA 2VSQA 5HV8A 2XZ1C 2LMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AF8 A;  3EJB A;  3EJD A;  1NQ4 A;  2KW2 A;  1KLP A;  2AVA A;  2N5I A;  4CA3 A;  2LL8 A;  3GZL A;  1X3O A;  1F80 D;  2LOL A;  2L9F A;  4PWV B;  2LIW A;  2KGE A;  5KP7 B;  5HVC A;  2KGD A;  2PNG A;  1VKU A;  2KG8 A;  2L4B A;  2MD9 A;  4MRT C;  2KGA A;  2FAD A;  2KG9 A;  2FVF A;  1L0I A;  2JGP A;  4PXH B;  2N50 A;  1DV5 A;  4H2W C;  1DNY A;  2MF4 A;  3RG2 A;  2LTE A;  1HQB A;  5KP8 B;  3CE7 A;  2MVU A;  2N6Y A;  2FAC A;  2K94 A;  2KOR A;  2MR7 A;  4BPH A;  2CNR A;  1AF8 A;  2FQ2 A;  2AFD A;  2GDX A;  2QNW A;  4BPG A;  2LPK A;  5EJD A;  4H2Y C;  4H2X C;  2GDY A;  5KP6 B;  2K2Q A;  2KGC A;  2KG6 A;  2JU1 A;  2K92 A;  2GDW A;  2ROQ A;  2FVE A;  2FVA A;  2MVV A;  2KOQ A;  2CQ8 A;  2JQ4 A;  4R0M A;  4NEO A;  1L0H A;  2K0Y A;  1HY8 A;  4HKG A;  2K0X A;  2KOO A;  2XZ0 D;  2L22 A;  1OR5 A;  2K93 A;  2FAE A;  2MR8 A;  2KR5 A;  1ACP A;  2FHS C;  2DNW A;  3LMO A;  2CG5 B;  2N5H A;  2M5R A;  2EHS A;  2CGQ A;  3EJE A;  3GZM A;  2LIU A;  4DG9 A;  5CZD B;  2AFE A;  2L0Q A;  2LKI A;  4IZ6 A;  2MY5 A;  1T8K A;  2N98 A;  4BPF A;  2KWL A;  2N6Z A;  3NY7 B;  2KOS A;  2JU2 A;  2KOP A;  2EHT A;  2FQ1 A;  2FQ0 A;  2X2B A;  2VSQ A;  5HV8 A;  2XZ1 C;  2LML A; 
#chains in the Genus database with same CATH topology
 3EJD A;  1NQ4 A;  1N8R Q;  2AVA A;  4U0B A;  3G29 A;  1Q81 Q;  1X3O A;  2JYG A;  1VQ4 P;  2LIW A;  5KP7 B;  1KQS O;  3GKL C;  2PNG A;  1GXH A;  1VQ7 P;  2KGA A;  1FR2 A;  2KG9 A;  1QVG O;  1DV5 A;  4PH0 A;  4COP A;  1DNY A;  5KP8 B;  1VQ9 P;  4WYM A;  2M8N A;  2FAC A;  1Q82 Q;  1VQ6 P;  2MR7 A;  4BPH A;  3CXC O;  1IUQ A;  4QKO A;  4GR2 A;  1K30 A;  3CCL P;  1VQL P;  3HZQ A;  1RNI A;  2VLQ A;  1ZNV A;  5F2K A;  2OTJ P;  2MVV A;  2K5X A;  5F2N A;  2K0Y A;  1HY8 A;  4HKG A;  2OAR A;  3CCV P;  3Q20 A;  7CEI A;  2L22 A;  3U43 A;  1M1K Q;  1M74 A;  2JAZ A;  2FHS C;  5HGO A;  2L6E A;  2ERH A;  2N5H A;  4U0A A;  3EJE A;  2GZG A;  3DTJ A;  5CZD B;  3G6E P;  2NO8 A;  2PEQ A;  3CC2 P;  2MY5 A;  1T8K A;  2KWL A;  3CPW O;  1E0H A;  2KOP A;  1A8O A;  2EHT A;  1D1D A;  2X2B A;  3CD6 P;  1RO2 A;  2AF8 A;  3EJB A;  2KW2 A;  2N5I A;  3HYB A;  2JO0 A;  2LL8 A;  2M8P A;  2EIA A;  2Z46 A;  1YI2 P;  4PWV B;  2GZE A;  5HVC A;  2CWO A;  1VKU A;  2KG8 A;  1VQ5 P;  3B5I A;  2JBG A;  2PEJ A;  3G0V A;  3M1M A;  2FVF A;  2N50 A;  5BS2 A;  2BHV A;  4PH1 A;  2MVU A;  3CCR P;  3B4Q A;  5BS1 A;  2XXM A;  1AF8 A;  3CCJ P;  3DS5 A;  2Z44 A;  2JYL A;  4H2X C;  2GDY A;  2PEK A;  2PEI A;  5KP6 B;  1Q7Y Q;  2K2Q A;  2K92 A;  1BAJ A;  2FVE A;  3CC4 P;  2KOQ A;  3CCS P;  1VQ8 P;  2JQ4 A;  4R0M A;  1VQO P;  3H47 A;  1L0H A;  1M6N A;  4IPY A;  2DGY A;  1YIT P;  1MZ8 A;  3DS4 A;  1GPJ A;  2M5R A;  2GYK A;  4U0D A;  1YJN P;  4DG9 A;  2AFE A;  3CMA P;  4BPF A;  3CC7 P;  3NY7 B;  2KOS A;  1RO0 A;  1QVF O;  2XV6 A;  2FQ1 A;  1CEI A;  1Q86 Q;  3G71 P;  2JB0 A;  2OTL P;  3G21 A;  3GZL A;  1F80 D;  2L4B A;  2MD9 A;  2FAD A;  1KC8 Q;  1L0I A;  1E6J P;  2JGP A;  4PXH B;  3H0D A;  4H2W C;  4M0I A;  2MF4 A;  1A43 A;  1HQB A;  2QA4 P;  2N6Y A;  1YHQ P;  1YJ9 P;  2PY8 A;  3LRY A;  1UJZ A;  2CNR A;  1GXG A;  3P05 A;  1AUM A;  3CCU P;  3MGE A;  4BPG A;  1K73 Q;  4H2Y C;  4XFX A;  3GJN A;  2KG6 A;  4U0E A;  2GDW A;  5HGN A;  1S72 P;  1VQN P;  1K9M Q;  1W2B O;  4XFY A;  2K0X A;  2XZ0 D;  4XRO A;  4U0F A;  2K93 A;  2FAE A;  2MR8 A;  1Z6M A;  2KR5 A;  1ACP A;  2WPT A;  3LMO A;  2CG5 B;  5HGL A;  2P9X A;  2EHS A;  3VRL C;  1VQK P;  1EIA A;  2LIU A;  2QEX P;  4IZ6 A;  3I56 P;  1YJW P;  1AYI A;  1YIJ P;  3DS0 A;  4QNB A;  2VLN A;  3NTE A;  4COC A;  2LF4 A;  2VSQ A;  3G4S P;  5HV8 A;  1UNK A;  5F2O A;  1EMV A;  4F37 A;  2M8L A;  2PEO A;  1KLP A;  1VHN A;  2XT1 A;  4CA3 A;  3RG6 C;  2LOL A;  2L9F A;  2KGE A;  3CCE P;  3DPH A;  2KGD A;  3WBH A;  2VLO A;  1VQM P;  3G1I A;  2Z45 A;  4MRT C;  3G1G A;  2VLP A;  4GR6 A;  4XRQ A;  3RG2 A;  1BXI A;  2LTE A;  3CE7 A;  2E1M A;  2K94 A;  5HGM A;  2KOR A;  2BUO A;  3DS2 A;  3H4E A;  5JPA A;  2FQ2 A;  2AFD A;  1VQP P;  2GDX A;  2QNW A;  2LPK A;  5EJD A;  3DS1 A;  3OW2 O;  4XFZ A;  5I4T G;  2KGC A;  1IMP A;  2JU1 A;  2EG5 A;  1K8A Q;  2ROQ A;  1ZMB A;  2FVA A;  2EFJ A;  4UHP B;  1EOQ A;  2CQ8 A;  4NEO A;  3DS3 A;  1IMQ A;  2KOO A;  1QRJ A;  3G28 A;  1OR5 A;  2PEN A;  1M90 Q;  1M6E X;  5EW5 E;  3CCM P;  2DNW A;  5DCK A;  2K0D X;  3I55 P;  2CGQ A;  1JJ2 O;  3GZM A;  2GZI A;  3E2D A;  3CME P;  2L0Q A;  2LKI A;  3CCQ P;  3G26 A;  2N98 A;  2ONT A;  2N6Z A;  1KD1 Q;  2GZF A;  2JU2 A;  2KOD A;  1NJI Q;  2FQ0 A;  2PEM A;  2XZ1 C;  4U0C A;  2GZJ A;  2LML A; 
#chains in the Genus database with same CATH homology
 2AF8 A;  3EJB A;  3EJD A;  1NQ4 A;  2KW2 A;  1KLP A;  2AVA A;  2N5I A;  4CA3 A;  2LL8 A;  3GZL A;  1X3O A;  1F80 D;  2LOL A;  2L9F A;  4PWV B;  2LIW A;  2KGE A;  5KP7 B;  5HVC A;  2KGD A;  2PNG A;  1VKU A;  2KG8 A;  2L4B A;  2MD9 A;  4MRT C;  2KGA A;  2FAD A;  2KG9 A;  2FVF A;  1L0I A;  2JGP A;  4PXH B;  2N50 A;  1DV5 A;  4H2W C;  1DNY A;  2MF4 A;  3RG2 A;  2LTE A;  1HQB A;  5KP8 B;  3CE7 A;  2MVU A;  2N6Y A;  2FAC A;  2K94 A;  2KOR A;  2MR7 A;  4BPH A;  2CNR A;  1AF8 A;  2FQ2 A;  2AFD A;  2GDX A;  2QNW A;  4BPG A;  2LPK A;  5EJD A;  4H2Y C;  4H2X C;  2GDY A;  5KP6 B;  2K2Q A;  2KGC A;  2KG6 A;  2JU1 A;  2K92 A;  2GDW A;  2ROQ A;  2FVE A;  2FVA A;  2MVV A;  2KOQ A;  2CQ8 A;  2JQ4 A;  4R0M A;  4NEO A;  1L0H A;  2K0Y A;  1HY8 A;  4HKG A;  2K0X A;  2KOO A;  2XZ0 D;  2L22 A;  1OR5 A;  2K93 A;  2FAE A;  2MR8 A;  2KR5 A;  1ACP A;  2FHS C;  2DNW A;  3LMO A;  2CG5 B;  2N5H A;  2M5R A;  2EHS A;  2CGQ A;  3EJE A;  3GZM A;  2LIU A;  4DG9 A;  5CZD B;  2AFE A;  2L0Q A;  2LKI A;  4IZ6 A;  2MY5 A;  1T8K A;  2N98 A;  4BPF A;  2KWL A;  2N6Z A;  3NY7 B;  2KOS A;  2JU2 A;  2KOP A;  2EHT A;  2FQ1 A;  2FQ0 A;  2X2B A;  2VSQ A;  5HV8 A;  2XZ1 C;  2LML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...