1K9MQ

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1k9mQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1k9mQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1k9mQ03
1KD1Q 3CCMP 3CXCO 1VQ6P 3CCQP 1VQ5P 2QEXP 3I55P 3CMAP 3CCJP 1YI2P 1M90Q 3CCRP 2OTLP 1N8RQ 1VQ9P 1VQLP 1S72P 1NJIQ 1KC8Q 3CC4P 3OW2O 1Q82Q 3G6EP 1VQ8P 1VQMP 1YHQP 1K9MQ 1K73Q 1KQSO 1VQPP 3CCSP 1Q86Q 1Q7YQ 3G4SP 2QA4P 3CC7P 3CCVP 1YJ9P 3I56P 3CPWO 1YJWP 1Q81Q 1VQ4P 1QVGO 1VQOP 1YITP 3CCLP 3G71P 2OTJP 1QVFO 1W2BO 3CC2P 1YJNP 1VQNP 1K8AQ 1VQKP 1JJ2O 3CD6P 1YIJP 1VQ7P 1M1KQ 3CCEP 3CMEP 3CCUP
chains in the Genus database with same CATH superfamily
3CCMP 3AE9C 3GHGA 2E43A 2KG6A 3OJAB 3WUVA 2KXPB 2OQQA 1JMBA 4Y99C 5KJ7D 5CCHD 5KLVJ 4U0DA 3IAOA 5APSA 1SQXE 1FR2A 3AEAC 3EFFK 4EI2A 2WTYA 2K37A 1LNQA 2K93A 1RF0A 2A06E 2ZVOB 1LTTC 4U0CA 1M1JC 1KLPA 2KOSA 1DX7A 1FOSE 4IZ6A 1N7SC 1YQ4C 2ZYAA 2A45G 1HUCA 2IZ1A 4NPEA 1LWUC 3SSUA 1SQXG 3AE8C 1N86A 1VQ5P 1ZN5A 2W6BA 4COPA 1AYIA 4C46A 2A06G 2R5BA 5GTHE 1DD3A 2JU1A 3L75E 3H1HE 3RL0B 1IFDA 1Q81Q 2H8PD 2K9JB 1HBWA 2O1KA 2KB7P 1VQKP 2AFEA 1RY3A 1VQ7P 2KYVA 5B66H 2E76C 2N5HA 3CMAP 1LT9A 1NTZK 3CXHD 4HB1A 2QM7A 3UIAA 3M9BA 1W5CE 3CX5D 3RL0D 2Q1KA 2L91A 5BVZA 1YIJP 4H0LC 3L75G 3H1HG 5EJDA 3L74G 3CCQP 2K9YA 3A0HE 4COCA 5CCGA 2QJKC 1X3OA 1A43A 2L4BA 2L22A 4WY4A 3KPEA 2B88A 4U3FE 1KORA 2BEZF 1W2BO 3FWLA 1SQBD 4XFXA 1SQQE 1OXZA 2ZT9C 3CXCO 3T97B 3KYQA 4H44B 4I6MC 3G1IA 2KORA 3M1MA 3CWBG 2Z5HA 5AW3B 1DD4A 1KQGB 1Q90D 1JY2P 2W83C 1LJ2A 4UB6H 4D6TD 1Q7YQ 3NMDA 2AXCA 3MHVA 1VQ4P 2E74C 4U3FG 4WYMA 1BE3J 3U59A 3OAKA 4H44D 1AJYA 1VL2A 4H13C 2K1AA 1RE3A 1SQQG 1NYHA 2G3AA 1FC2C 3D6YA 1KILE 1EZVI 2J58A 1OWAA 4L76A 1R8EA 2IYOA 3I56P 2GZEA 2RN0A 2NPSA 3O8ZA 1PGPA 3CCEP 5AVTB 2L0QA 2OYIC 4IL6E 2RMZA 1CEIA 1FZFA 2BCCE 3H32A 1NTZJ 4HKGA 1RF0C 1L4AD 3R4YA 2P10A 2MR7A 1IUQA 4JYBA 1GL2D 3RBXA 5CBNA 3RK2B 2J5UA 1NTKK 4YXWH 1SS1A 2PEJA 1VQNP 1GDTA 1Y47A 1AUMA 3A0BE 3H25A 1OVRA 2K0XA 1KFNA 3SFEC 1U7MA 2K5XA 3WBHA 3RK2D 1NU1D 2D2CB 1L0NE 3CXHE 4DT0A 3L73E 5HV8A 3DPHA 3W68A 3W67A 3H1KD 3CX5E 2WPVB 3RGUA 4PV1C 3HD7B 1L0NK 1FBMA 2M3EA 2CGQA 3EJDA 5M1BA 1S1CX 1LT9C 4Z1MH 3KDPB 4JYCA 2QM8A 2FQ2A 1S5LX 2D2CD 2XZRA 4PWVB 2KLVA 1IFIA 2LXBA 3JC22 3TF5A 2FHSC 3HD7D 2WPSA 2N5IA 5APTA 3F5HA 1JEKA 3AEFC 2PEQA 1BGYJ 2WPRA 1S3JA 1PEQA 5CCGC 1AA0A 3TGUE 3V6IA 1PEMA 1M7LA 4IPYA 2EHSA 1KILA 2JEEA 1CI6A 3H6PA 3IR9A 3PTZA 2OTLP 1PEOA 3SWKA 3V5BA 1IK9A 1EIAA 1Q2NA 5E79E 1NTKJ 1JY3P 1LTAC 3NXSA 3O6QA 3DS2A 1GW4A 4DG9A 1SQBG 4HH2A 5K5GB 2AFDA 2ZXXA 3VP9A 2GUSA 2A45H 5KP6B 4GT1A 5GTIE 2IBZD 4KT0J 4L75A 3H1LE 2XZ1C 2R32A 1N2DC 1OIPA 4D6TG 2C9LY 1L0LJ 1VQPP 4I2LC 1OVUA 1J1DC 3PRJA 2Y0CA 1PPJD 4WWIA 1UIXA 2C0XA 1LTJB 2B87A 3MTUE 1IK7A 2ONTA 1HGZA 1FZEA 1A02J 2FYNC 3CCJP 2JJLA 1QGKB 2YKPA 1U57A 4UHPB 3HUSB 2CQ8A 1QEXA 1T8ZA 1E5WA 5DJUB 3M06A 3K5BA 3CC2P 2ERHA 1FZAA 3EQ2A 1UJZA 2VLOA 1NU1E 3V4QA 3Q5SA 2KOPA 5CMZA 1VHNA 3I5CA 1GMJA 2KUBA 3AEBC 3G3ZA 2Z46A 1NU1K 1URQC 1Z56A 2NRGA 4A7PA 5AW6B 2N1TA 5KKZB 2NZ2A 3GF7A 1YJNP 1D7MA 3QWOC 3GJNA 1VF5C 3CCUP 4UB6E 1UNKA 3V2NA 2A45I 1LT1A 2Y0DA 2PFXA 2M3BA 2AEJA 1E6JP 2K0YA 1OVVA 2CPBA 1ZR2A 2E42A 5AVVB 3FXDA 3V2QA 3H1KG 3DS4A 2JR8A 4TT3H 1SQPD 1RO2A 2JDIH 1M1JA 4HJGH 3PLNA 3H1JE 1H89A 1VDFA 3AE2C 1OZHA 1BCCE 3G6EP 3KQGA 1LWUA 4M0IA 1FAVA 3DS0A 3B5NB 2ZYDA 5AW9B 5HGLA 3VOPA 2LF4A 2JO0A 1KILC 1PFIA 1U7JA 1R5LA 2E75B 1PP9J 4TLFA 1G2CB 3M9QA 1VQ9P 2IBZE 1LTBC 1J1EB 2KLUA 3VMAA 3G4SP 1USDA 4OH8B 1YTZT 2MJZA 5BU5A 2KG9A 2M8RA 3B5ND 1IFPA 4PJ0H 2GDWA 3LMOA 3H32B 1PPJE 2FY8A 3I55P 3GKLC 2E75D 4JBZA 1PGOA 3Q20A 4IL6H 4I7ZB 2POHA 2Y0EA 3CPWO 1OMIA 2JWAA 2IBZG 1IMQA 1HGVA 4ASWA 4RJTA 1ZW0A 2JGPA 4LLHA 2B9BA 1HY8A 2QJPB 1HVVA 1SLQA 1M6EX 2KZJA 3BRVB 1H0TB 1PPJG 3CWBD 1J2JB 2GZFA 2Y9YA 1E79H 1IFJA 2R3CA 1LP1A 1EXIA 4NEOA 3BASA 3VN0A 3HTKB 2BHVA 3U1AA 2FVAA 3CXHH 1FDIA 5KTBA 3HYBA 2PY8A 1GU5A 3TDKA 3CX5H 1Q86Q 4L73A 1NAFA 3P8MC 3L70J 2N1TC 2OYHA 4F37A 4B86A 2AXTH 1HF9A 2FFDB 1S4XA 2HYNA 5EW5E 2K88A 3A2AA 1SFCA 4DCKA 1VQLP 3IN6A 2HFED 1NO4A 3BVHA 1XTGB 2JP3A 1AQTA 2WSEJ 4U7JA 2FQ1A 4DZOA 3C9IA 4XA4A 1WRGA 2W90A 1QLED 2OYIA 3E1IA 1L0IA 2YMKA 3C8VA 2Z44A 1SQXK 4H44C 3PP5A 3DS1A 5DCKA 1XTCC 2M5AA 2QA4P 4AYCA 2HPCA 1SQPG 1PZQA 2OGUA 2OTJP 3L72D 2FVFA 2PP6A 5E79H 2O01N 3VMYA 3NTNA 2MKVA 1KFMA 1EMVA 2CWOA 1DNYA 3TNUB 1HQBA 2E5YA 2FYUJ 2B89A 4XFJA 5GTIH 2QG4A 4N78E 3Q1MA 2GUVA 3L74E 1HH0A 1QX8A 3CXHI 2KP8A 1AFOA 2WWWA 2XU6A 2K3RA 3LIDA 5H2FH 3CX5I 1OX3A 3L36A 1N73B 1RF1A 2C0WA 2PNGA 3G0VA 5CJ4A 1L0LD 4H2XC 1YBKA 2QJYB 5B5EE 4IFMA 3CWBE 3FWNA 1VKUA 1MFZA 5AVWB 1T2KD 1MV8A 3MP7B 2K92A 2AVAA 1GXHA 1JM0A 1KB9D 3SFDC 3LW5H 4EYYQ 1ZNVA 3CCLP 2UWJE 1KQLA 3OA7A 1EDKA 2Q7CA 1SQXJ 2RH0A 2GA1A 2PAJA 3G26A 1FDOA 3M0DA 4R4LA 2O1JA 4OGQB 1X8YA 2KIKA 3WU2E 2PRRA 1SQQK 1A02F 2BASA 3L71D 1YJWP 2GM4A 3CC7P 3AE6C 1S2EA 2OYHC 3CLQA 2YIUC 1L4AB 1N7SB 1JB0J 3V2PA 4ASVA 2KS1B 4OGQD 1SFCC 3P32A 1GL2B 3BCCD 4PJ0E 3S1KA 5CJ0A 4C7NB 2L6EA 5CZDB 2M8NA 1MKMA 2WMMA 4U0BA 5HGOA 1IC2A 1ACPA 3HRNA 2X2BA 2MY5A 3CMEP 2PEOA 2IFNA 3L75J 3H1HJ 3TK1A 3DS3A 3L72E 1NH4A 5AVRB 1EC5A 1N7SD 5APUA 2WSFJ 3MZWB 3P8CD 1JNMA 2KNCB 4MN4C 1K8AQ 3WUUA 2E76B 2O01H 2MF4A 2FKWB 4IOIH 2L5GB 1PV3A 2WT7B 1AV1A 3WUTA 2BUOA 1BGYG 1URQA 3PH0A 1KZUB 1JY3O 3L72G 2XT1A 4UB8E 1USEA 4GOEA 2AEMA 3MGNA 4H0LB 3ABVC 2KI7B 1LTSC 3D71A 4U3FJ 4GIFA 1QRJA 2E76D 2YMYA 1M56D 2LIWA 2FAEA 3M0AA 1JTHB 4HKZH 2QJKB 3H47A 1NTMD 4BRYA 1SQQJ 3F89A 4Y28J 4EIJA 1FU1A 1Y9BA 4QNBA 2AXTE 1RF1C 5APQA 1KB9E 1ZRTD 2ZT9B 4H0LD 3FGAD 5CBOA 3NY7B 1X9VA 3E7KA 2JAZA 2GDYA 5APYA 5KJ7A 2KSEA 5CCHA 1L0LG 2H43A 1SQBE 1KC8Q 2W6AA 3HE4B 2E74B 2V7QH 4MRTC 1SQVD 1KYOD 2ZT9D 3MUDA 1SQBK 1JCDA 3M91A 3H1ID 3L71E 4D6TE 3HE5B 3RL0g 4H13B 1S9KD 3GHGB 5EFWB 4AUWA 2FADA 5KAFH 3M9HA 3U1CA 4PD4D 2YNYA 2FXPA 2KGEA 5TISH 3RG6C 2BCCJ 5APVA 1UIIA 2IBZI 3EWKA 3M0DC 2KSJA 3JSVC 2EHTA 2E74D 1T3JA 2LIUA 2LOLA 3BCCE 1GW3A 2ZAEB 2M8LA 4H13D 3EFGA 1F80D 3U43A 1CZQA 2QE7H 3L71G 2KWLA 3KXDA 2ITAA 1ZOYC 2O3JA 5H2FE 5KLVD 3P05A 1GZLA 1NQ4A 3P8CE 1L0NJ 2Y9ZA 4OVNF 1JO5A 3L73J 3BCCG 2KOGA 3HZQA 2LPKA 2DW3A 2XZ0D 2K9JA 1NGMB 1QVFO 5BU8B 2H88C 4PV1B 3AEEC 2IYPA 1MZ9A 2CPSA 1LT9B 1TU3F 3GW6A 1P84D 3H1KE 2HLOA 2FYUD 1NTME 2M0BA 3AE1C 2JYLA 2J59M 1YYCA 5C39A 4PV1D 3TGUJ 2E5TA 1PEUA 3P7KA 1ZRTE 2P67A 1HJ0A 2MVVA 5B5EH 3RK3B 2BEQD 4WY4B 1YJ9P 2ZVNB 2GYKA 1T8KA 4RKUJ 1NTMG 3T97A 1RH5B 4L74A 1DIPA 1SQVE 1IZNB 1KYOE 1M74A 4GR2A 3MD0A 2ROQA 4K3AA 3ITKA 5CCGD 3H1IE 4GDOA 5KJ7C 5CCHC 3RK3D 1KQSO 3KHUA 3RG2A 3H1LJ 4WY4D 2JU2A 4EDFA 1FZCC 4BXLA 1LTIC 4U0FA 3WU2H 3H0DA 1IO4A 3MUDC 1NKNA 4NPDA 5TJHA 1X79B 3CL3D 1QL1A 5KLIB 3G29A 1J1DB 3DTJA 1SQVG 3LIEA 5AW7B 2N9YB 4JQ0D 4N3YB 3H1IG 5AVYB 4N6JA 2NPSB 3E2DA 2MD9A 5KLVE 3G9RA 1BE3D 1IFMA 4JPZB 1NU1J 1BXIA 3B8EB 3LW5J 1NAYA 5AW0B 2N50A 4K35A 1W2EA 2NPSD 2PEKA 2C9NY 2LKIA 2MR8A 1IFNA 2JB0A 1ZMBA 2WPTA 4LC1A 3CCRP 1FOSF 1NTZD 1N8RQ 2JQ4A 2OARA 4YXDC 2ZJSE 3G28A 3OW2O 5KLVG 1YHQP 4LGDE 2E1MA 2QSIA 1BDCA 5BS2A 4XFYA 1VF5B 2FXMA 3KZIH 3RL0C 2W8ZA 1ZXGA 1N7LA 2KK7A 3MGEA 1RO0A 3HD7A 2OYOA 2VRSA 2Q9IA 2QEXP 4UB8H 3IFMA 1T2KC 5AW1B 1MUUA 3Q3DA 1VQMP 2CG5B 3H1JJ 1KQFB 5L8RJ 1BDDA 4PXHB 1AF8A 5KAFE 3GMAA 1VF5D 1BCCJ 2YKOA 5TISE 3D70A 5HGNA 2GZGA 5F2KA 2HODA 2IX7C 4O9BA 1KB9H 2EIAA 2FYUG 3A5TA 5F2NA 1SQPE 3A3YB 2GZJA 2K94A 1EDIA 1DEBA 2P9XA 1EXJA 2K0DX 3RK3E 2EG5A 2N6ZA 2O01J 1GPJA 1SQPK 1KILB 5CHXA 1CI6B 1FDMA 1CW5A 3II6A 1OW6A 3A7OA 3FX0A 4GKGA 3QH9A 2XDJA 2I1JA 3O6QB 1BSNA 1G1IA 4OGQC 4GODA 1BGYD 2Z5IA 4XROA 4XFZA 4DOJA 2N98A 1OW8A 2YKQA 1KILD 3E1RA 1NWQA 3JCUH 4R0MA 2KGAA 3CC4P 5BS1A 2QNWA 1L4AC 2P1JA 1PGQA 3AEGC 1JY3N 1BE3E 3CCSP 4IFFA 1JY2O 1GL2C 1NTKD 2BCCD 5HVCA 1LTJA 1S5LH 2KODA 1CSBA 2B87B 2LKMA 1PL5A 2IFMA 2IPPA 2PENA 2KR5A 3HUSA 4W7ZA 2JKVA 4KHXA 2V7QJ 1NTZE 2DGYA 3RK2C 1JCCA 1YITP 1PGJA 5APWA 1G1JA 2Q5UA 1KB9I 1NHLA 1BE3G 1M1KQ 2FQ0A 2XKMA 2LL8A 4YPCA 2P58A 1DEEG 1L0ND 4JF7A 1FE6A 4NPFX 3L73D 2Q3IA 3VRLC 2JYGA 4ZNCA 3CCVP 1SQPJ 2WQYC 2N1TB 2D2CC 5APXA 3G21A 2WITA 1NTZG 3AE7C 4Y99B 4IL6X 1H8AA 2GDXA 1M90Q 3HD7C 3AE3C 2PEMA 1JOCA 2VSQA 4RESB 3Q5PA 2M5RA 1QVGO 1L2PA 2N1TD 4DJGA 3C1LA 1MFTA 3USSA 2R3SA 5DJTB 5KP8B 1M1JB 3TGUD 5AVXB 1IJDB 1YQ3C 5JPAA 3N7NA 1GK4A 1K73Q 2BQ1E 3VP8A 3BRTB 5AW5B 3AE5C 1FS0E 1KN7A 2XV6A 1KYOH 3B71A 3VTPC 1LWUB 2IDBA 3IF4A 1AVOA 1YTZI 3B5NA 1K04A 2CNRA 3L37A 1HJBA 1BGYE 3NTEA 3L74J 1G2CA 1WMKA 3GHGC 4PD4H 1GTWA 1NVOA 1SVFA 3PJSK 2LR2A 1MZ8A 1FJKA 4CA3A 4OWFA 4M3LA 2WSCH 3H1LD 2IZ0A 1X22A 1EZVD 4ZKPA 1DV5A 1NTKE 3TYYA 2VLQA 1ZR4A 3CWBJ 2JO1A 3KZIE 4WVZA 1PP9D 3LRYA 2NO8A 5AVUB 2XNDH 2WSEH 2ZYGA 3S4RA 4H2YC 1M57D 1H88A 2PEIA 1L0LE 3VMZA 1LTJC 1RHZB 4W80A 2MVUA 1RNIA 2AF8A 4HYTB 2N6YA 2WVRA 2KW2A 1H0TA 1NTKG 2BCCG 3GF3A 1L0LK 4R4MA 3CE7A 4GR6A 3HUSC 2KGCA 4YTPC 1IMPA 3G71P 2P7JA 1LP1B 3MIWA 3HTKA 5AVSB 2ZXEB 1P84H 1KYOI 3G1GA 2G8YA 2Z45A 1OR5A 5AW4B 1JMMA 3GLMA 2QRXA 5KAIH 1FZCA 3WMM0 2CK3H 2V4HA 4PD4I 1L0NG 5AW8B 5KKZC 2KGDA 2VLNA 2OYHB 2XNXA 2FFDA 1KTMA 2YIUB 1AVYA 4AQRD 3L73G 1RE4A 2HODB 3S9OA 2R44A 1ZLLA 1SFCB 2KZIA 5AVQB 3N4XA 2WPQA 3RK3C 1FZBA 3L72J 1GU4A 2LXCB 3H1JD 4W7YA 4WY4C 3JCUE 1FZGA 2OYIB 2YO2A 3ZDMA 1BCCD 2EFJA 5F2OA 1RQUA 3L70D 4GOFA 3Q5RA 1ZMEC 1SFCD 2Q6QA 4H2WC 1NJIQ 2R5DA 4PH1A 1K05A 1S5LE 2ZFCA 1BSHA 2M5AB 2HPCB 1JJ2O 3TGUG 3GG2A 4BPFA 3B5NC 1ZP0C 3V2RA 3TNUA 1T6AA 2FBWC 1EZVE 1NOHA 2E75C 1ZV8A 1RE3C 1EQ7A 2YXRB 3AECC 5KLIC 1EDLA 5B66E 1M8OB 1J1EC 1PP9E 3Q2YA 5I4TG 2KG8A 1P84I 1QL2A 2NPSC 3EJBA 2H89C 4C7RA 1N73A 5AVZB 2WZ7A 1RF1B 4U0EA 3H1LG 1L0HA 2QIWA 4IFDK 1HWTC 1EZVG 3PHLA 4I7ZC 1SQBJ 1DH3A 2LTEA 5GTHH 1EOQA 4WB4A 1VQ6P 4WBAA 1PP9G 4QKOA 1FJPA 1NTMK 3B5IA 2HR3A 2VLPA 3L71J 4D6TJ 2WSFH 1K9MQ 2QJPC 2SPZA 1RQVA 2QVAA 3B4SA 4RO0A 3L4FA 2OTKE 4BPHA 2FVEA 2AEFA 3SWFA 1SP4A 1KD1Q 5AW2B 5KP7B 3DS5A 4EOTA 2JBGA 2FYZA 1NU1G 1D1DA 2JWDA 4U0AA 1OFCX 2I8DA 3BCCJ 3NFQA 3RBZA 4ZMDA 1A8OA 1S9KE 3TSIA 2Q3EA 3A0HH 3R2PA 1AQ5A 1VQOP 1GXGA 1SQVK 4PD4E 3CD6P 1SQXD 1L4AA 1N7SA 2FFDC 7CEIA 1GK6A 1JUNA 4ZKUA 1M6NA 2KS1A 2W27A 1RE4C 3L70E 1GL2A 3AE4C 3H4EA 2XV5A 4C7NA 2W6JH 2M8PA 1JY2N 3V4WA 2A06D 1BAJA 3GZMA 1KMIZ 3B4QA 1R5SA 2FYNB 4BWNA 1KV4A 1PIXA 2LMLA 2WSSH 3H1JG 5KLVK 2KNCA 2HG5D 1BCCG 2Z4EA 3L70G 3H1KJ 1NTMJ 3EJEA 2WT7A 1Y8AA 1HTLC 4N78D 1YI2P 3L75D 1WT6A 3H1HD 3L74D 2FACA 2N9BA 1OW7A 1URQB 1X0TA 1Q82Q 4XE5B 4KJMA 2YO3A 3L35A 1P84E 1GD2E 3VYIA 3VMXA 2K2QA 3FXEA 2FYUE 3CI9A 5KAIE 1JTHA 2L9FA 2FXOA 2XXMA 4BRYB 2P2UA 2GZIA 4QMAA 3A0BH 1URQD 3GZLA 1N73C 1VQ8P 2KOOA 2FYUK 1SQVJ 1T3UA 1EDJA 3H1IJ 4I1LA 3SWYA 1E0HA 4BPGA 2QJYC 4CPGA 2PGDA 5HGMA 4U3FD 2KOQA 1LTGC 2H7HA 2I1KA 3BATA 1S72P 2RKLA 3D6ZA 1Z6MA 4PH0A 3HE4A 1SQQD 1FZCB 1LGHB 2WSCJ 4XRQA 3AEDC 1NKZB 1K30A 1VPCA 2DNWA 3HE5A 2YXQB
chains in the Genus database with same CATH topology
3CCMP 1RO2A 3CCQP 1PEUA 2BHVA 1ZMBA 3DS3A 4COCA 3CCRP 3G1GA 1N8RQ 2Z45A 2OARA 3CC4P 5BS1A 1A43A 3G28A 3HYBA 5JPAA 2PY8A 3G0VA 3G6EP 3OW2O 4U0EA 3RG6C 1YHQP 4U0DA 1K73Q 2BQ1E 3WBHA 2E1MA 1VQPP 3CCSP 1Q86Q 5BS2A 4XFYA 1YJ9P 2XV6A 4M0IA 1W2BO 3DS0A 1K8AQ 3DPHA 4XFXA 2KODA 2ONTA 1EOQA 3MGEA 1RO0A 2M8LA 5HGLA 3CXCO 1VQ6P 3NTEA 2LF4A 2JO0A 2QEXP 1M74A 4GR2A 3G1IA 3M1MA 4U0CA 3CCJP 1YI2P 3B5IA 2PENA 2BUOA 1VQ9P 1VQLP 1Q82Q 1VQMP 1K9MQ 1KQSO 1Q7YQ 3G4SP 2XT1A 3P05A 1VQ4P 2DGYA 1YITP 3CCLP 3CC2P 4U0FA 4WYMA 1M1KQ 1QRJA 2EFJA 1KD1Q 5F2OA 5HGNA 3H0DA 1VQ5P 2Z44A 3DS5A 5F2KA 3I55P 3H47A 2EIAA 4COPA 2XXMA 3G26A 1D1DA 4U0AA 3Q20A 5F2NA 3HZQA 1NJIQ 2PEQA 4PH1A 3VRLC 3LRYA 1VQ8P 1PEQA 2JYGA 3DS1A 3G29A 3DTJA 4QNBA 1A8OA 2Z46A 5DCKA 2QA4P 3CCVP 3I56P 3CPWO 1YJWP 1Q81Q 2P9XA 1VQOP 1PEMA 2OTJP 1QVFO 1YJNP 2EG5A 4IPYA 1VQKP 1JJ2O 3E2DA 3CD6P 1VQ7P 2PEIA 3CCEP 3CC7P 3G21A 3CCUP 2OTLP 1PEOA 5HGMA 2CWOA 3CMAP 1RNIA 1EIAA 1M90Q 1M6NA 2PEMA 1IUQA 1M6EX 1S72P 1KC8Q 4PH0A 3H4EA 4GR6A 2M8PA 3DS2A 1E6JP 2L6EA 1BAJA 2M8NA 4XRQA 1QVGO 3G71P 4XROA 1K30A 2JYLA 4U0BA 4XFZA 3DS4A 2PEJA 5HGOA 5I4TG 1VQNP 1YIJP 2PEKA 1AUMA 3CMEP 2PEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 Q;  3CCM P;  3CXC O;  1VQ6 P;  3CCQ P;  1VQ5 P;  2QEX P;  3I55 P;  3CMA P;  3CCJ P;  1YI2 P;  1M90 Q;  3CCR P;  2OTL P;  1N8R Q;  1VQ9 P;  1VQL P;  1S72 P;  1NJI Q;  1KC8 Q;  3CC4 P;  3OW2 O;  1Q82 Q;  3G6E P;  1VQ8 P;  1VQM P;  1YHQ P;  1K9M Q;  1K73 Q;  1KQS O;  1VQP P;  3CCS P;  1Q86 Q;  1Q7Y Q;  3G4S P;  2QA4 P;  3CC7 P;  3CCV P;  1YJ9 P;  3I56 P;  3CPW O;  1YJW P;  1Q81 Q;  1VQ4 P;  1QVG O;  1VQO P;  1YIT P;  3CCL P;  3G71 P;  2OTJ P;  1QVF O;  1W2B O;  3CC2 P;  1YJN P;  1VQN P;  1K8A Q;  1VQK P;  1JJ2 O;  3CD6 P;  1YIJ P;  1VQ7 P;  1M1K Q;  3CCE P;  3CME P;  3CCU P; 
#chains in the Genus database with same CATH topology
 3CCM P;  3AE9 C;  3GHG A;  2E43 A;  2KG6 A;  3OJA B;  3WUV A;  2KXP B;  2OQQ A;  1JMB A;  4Y99 C;  5KJ7 D;  5CCH D;  5KLV J;  4U0D A;  3IAO A;  5APS A;  1SQX E;  1FR2 A;  3AEA C;  3EFF K;  4EI2 A;  2WTY A;  2K37 A;  1LNQ A;  2K93 A;  1RF0 A;  2A06 E;  2ZVO B;  1LTT C;  4U0C A;  1M1J C;  1KLP A;  2KOS A;  1DX7 A;  1FOS E;  4IZ6 A;  1N7S C;  1YQ4 C;  2ZYA A;  2A45 G;  1HUC A;  2IZ1 A;  4NPE A;  1LWU C;  3SSU A;  1SQX G;  3AE8 C;  1N86 A;  1VQ5 P;  1ZN5 A;  2W6B A;  4COP A;  1AYI A;  4C46 A;  2A06 G;  2R5B A;  5GTH E;  1DD3 A;  2JU1 A;  3L75 E;  3H1H E;  3RL0 B;  1IFD A;  1Q81 Q;  2H8P D;  2K9J B;  1HBW A;  2O1K A;  2KB7 P;  1VQK P;  2AFE A;  1RY3 A;  1VQ7 P;  2KYV A;  5B66 H;  2E76 C;  2N5H A;  3CMA P;  1LT9 A;  1NTZ K;  3CXH D;  4HB1 A;  2QM7 A;  3UIA A;  3M9B A;  1W5C E;  3CX5 D;  3RL0 D;  2Q1K A;  2L91 A;  5BVZ A;  1YIJ P;  4H0L C;  3L75 G;  3H1H G;  5EJD A;  3L74 G;  3CCQ P;  2K9Y A;  3A0H E;  4COC A;  5CCG A;  2QJK C;  1X3O A;  1A43 A;  2L4B A;  2L22 A;  4WY4 A;  3KPE A;  2B88 A;  4U3F E;  1KOR A;  2BEZ F;  1W2B O;  3FWL A;  1SQB D;  4XFX A;  1SQQ E;  1OXZ A;  2ZT9 C;  3CXC O;  3T97 B;  3KYQ A;  4H44 B;  4I6M C;  3G1I A;  2KOR A;  3M1M A;  3CWB G;  2Z5H A;  5AW3 B;  1DD4 A;  1KQG B;  1Q90 D;  1JY2 P;  2W83 C;  1LJ2 A;  4UB6 H;  4D6T D;  1Q7Y Q;  3NMD A;  2AXC A;  3MHV A;  1VQ4 P;  2E74 C;  4U3F G;  4WYM A;  1BE3 J;  3U59 A;  3OAK A;  4H44 D;  1AJY A;  1VL2 A;  4H13 C;  2K1A A;  1RE3 A;  1SQQ G;  1NYH A;  2G3A A;  1FC2 C;  3D6Y A;  1KIL E;  1EZV I;  2J58 A;  1OWA A;  4L76 A;  1R8E A;  2IYO A;  3I56 P;  2GZE A;  2RN0 A;  2NPS A;  3O8Z A;  1PGP A;  3CCE P;  5AVT B;  2L0Q A;  2OYI C;  4IL6 E;  2RMZ A;  1CEI A;  1FZF A;  2BCC E;  3H32 A;  1NTZ J;  4HKG A;  1RF0 C;  1L4A D;  3R4Y A;  2P10 A;  2MR7 A;  1IUQ A;  4JYB A;  1GL2 D;  3RBX A;  5CBN A;  3RK2 B;  2J5U A;  1NTK K;  4YXW H;  1SS1 A;  2PEJ A;  1VQN P;  1GDT A;  1Y47 A;  1AUM A;  3A0B E;  3H25 A;  1OVR A;  2K0X A;  1KFN A;  3SFE C;  1U7M A;  2K5X A;  3WBH A;  3RK2 D;  1NU1 D;  2D2C B;  1L0N E;  3CXH E;  4DT0 A;  3L73 E;  5HV8 A;  3DPH A;  3W68 A;  3W67 A;  3H1K D;  3CX5 E;  2WPV B;  3RGU A;  4PV1 C;  3HD7 B;  1L0N K;  1FBM A;  2M3E A;  2CGQ A;  3EJD A;  5M1B A;  1S1C X;  1LT9 C;  4Z1M H;  3KDP B;  4JYC A;  2QM8 A;  2FQ2 A;  1S5L X;  2D2C D;  2XZR A;  4PWV B;  2KLV A;  1IFI A;  2LXB A;  3JC2 2;  3TF5 A;  2FHS C;  3HD7 D;  2WPS A;  2N5I A;  5APT A;  3F5H A;  1JEK A;  3AEF C;  2PEQ A;  1BGY J;  2WPR A;  1S3J A;  1PEQ A;  5CCG C;  1AA0 A;  3TGU E;  3V6I A;  1PEM A;  1M7L A;  4IPY A;  2EHS A;  1KIL A;  2JEE A;  1CI6 A;  3H6P A;  3IR9 A;  3PTZ A;  2OTL P;  1PEO A;  3SWK A;  3V5B A;  1IK9 A;  1EIA A;  1Q2N A;  5E79 E;  1NTK J;  1JY3 P;  1LTA C;  3NXS A;  3O6Q A;  3DS2 A;  1GW4 A;  4DG9 A;  1SQB G;  4HH2 A;  5K5G B;  2AFD A;  2ZXX A;  3VP9 A;  2GUS A;  2A45 H;  5KP6 B;  4GT1 A;  5GTI E;  2IBZ D;  4KT0 J;  4L75 A;  3H1L E;  2XZ1 C;  2R32 A;  1N2D C;  1OIP A;  4D6T G;  2C9L Y;  1L0L J;  1VQP P;  4I2L C;  1OVU A;  1J1D C;  3PRJ A;  2Y0C A;  1PPJ D;  4WWI A;  1UIX A;  2C0X A;  1LTJ B;  2B87 A;  3MTU E;  1IK7 A;  2ONT A;  1HGZ A;  1FZE A;  1A02 J;  2FYN C;  3CCJ P;  2JJL A;  1QGK B;  2YKP A;  1U57 A;  4UHP B;  3HUS B;  2CQ8 A;  1QEX A;  1T8Z A;  1E5W A;  5DJU B;  3M06 A;  3K5B A;  3CC2 P;  2ERH A;  1FZA A;  3EQ2 A;  1UJZ A;  2VLO A;  1NU1 E;  3V4Q A;  3Q5S A;  2KOP A;  5CMZ A;  1VHN A;  3I5C A;  1GMJ A;  2KUB A;  3AEB C;  3G3Z A;  2Z46 A;  1NU1 K;  1URQ C;  1Z56 A;  2NRG A;  4A7P A;  5AW6 B;  2N1T A;  5KKZ B;  2NZ2 A;  3GF7 A;  1YJN P;  1D7M A;  3QWO C;  3GJN A;  1VF5 C;  3CCU P;  4UB6 E;  1UNK A;  3V2N A;  2A45 I;  1LT1 A;  2Y0D A;  2PFX A;  2M3B A;  2AEJ A;  1E6J P;  2K0Y A;  1OVV A;  2CPB A;  1ZR2 A;  2E42 A;  5AVV B;  3FXD A;  3V2Q A;  3H1K G;  3DS4 A;  2JR8 A;  4TT3 H;  1SQP D;  1RO2 A;  2JDI H;  1M1J A;  4HJG H;  3PLN A;  3H1J E;  1H89 A;  1VDF A;  3AE2 C;  1OZH A;  1BCC E;  3G6E P;  3KQG A;  1LWU A;  4M0I A;  1FAV A;  3DS0 A;  3B5N B;  2ZYD A;  5AW9 B;  5HGL A;  3VOP A;  2LF4 A;  2JO0 A;  1KIL C;  1PFI A;  1U7J A;  1R5L A;  2E75 B;  1PP9 J;  4TLF A;  1G2C B;  3M9Q A;  1VQ9 P;  2IBZ E;  1LTB C;  1J1E B;  2KLU A;  3VMA A;  3G4S P;  1USD A;  4OH8 B;  1YTZ T;  2MJZ A;  5BU5 A;  2KG9 A;  2M8R A;  3B5N D;  1IFP A;  4PJ0 H;  2GDW A;  3LMO A;  3H32 B;  1PPJ E;  2FY8 A;  3I55 P;  3GKL C;  2E75 D;  4JBZ A;  1PGO A;  3Q20 A;  4IL6 H;  4I7Z B;  2POH A;  2Y0E A;  3CPW O;  1OMI A;  2JWA A;  2IBZ G;  1IMQ A;  1HGV A;  4ASW A;  4RJT A;  1ZW0 A;  2JGP A;  4LLH A;  2B9B A;  1HY8 A;  2QJP B;  1HVV A;  1SLQ A;  1M6E X;  2KZJ A;  3BRV B;  1H0T B;  1PPJ G;  3CWB D;  1J2J B;  2GZF A;  2Y9Y A;  1E79 H;  1IFJ A;  2R3C A;  1LP1 A;  1EXI A;  4NEO A;  3BAS A;  3VN0 A;  3HTK B;  2BHV A;  3U1A A;  2FVA A;  3CXH H;  1FDI A;  5KTB A;  3HYB A;  2PY8 A;  1GU5 A;  3TDK A;  3CX5 H;  1Q86 Q;  4L73 A;  1NAF A;  3P8M C;  3L70 J;  2N1T C;  2OYH A;  4F37 A;  4B86 A;  2AXT H;  1HF9 A;  2FFD B;  1S4X A;  2HYN A;  5EW5 E;  2K88 A;  3A2A A;  1SFC A;  4DCK A;  1VQL P;  3IN6 A;  2HFE D;  1NO4 A;  3BVH A;  1XTG B;  2JP3 A;  1AQT A;  2WSE J;  4U7J A;  2FQ1 A;  4DZO A;  3C9I A;  4XA4 A;  1WRG A;  2W90 A;  1QLE D;  2OYI A;  3E1I A;  1L0I A;  2YMK A;  3C8V A;  2Z44 A;  1SQX K;  4H44 C;  3PP5 A;  3DS1 A;  5DCK A;  1XTC C;  2M5A A;  2QA4 P;  4AYC A;  2HPC A;  1SQP G;  1PZQ A;  2OGU A;  2OTJ P;  3L72 D;  2FVF A;  2PP6 A;  5E79 H;  2O01 N;  3VMY A;  3NTN A;  2MKV A;  1KFM A;  1EMV A;  2CWO A;  1DNY A;  3TNU B;  1HQB A;  2E5Y A;  2FYU J;  2B89 A;  4XFJ A;  5GTI H;  2QG4 A;  4N78 E;  3Q1M A;  2GUV A;  3L74 E;  1HH0 A;  1QX8 A;  3CXH I;  2KP8 A;  1AFO A;  2WWW A;  2XU6 A;  2K3R A;  3LID A;  5H2F H;  3CX5 I;  1OX3 A;  3L36 A;  1N73 B;  1RF1 A;  2C0W A;  2PNG A;  3G0V A;  5CJ4 A;  1L0L D;  4H2X C;  1YBK A;  2QJY B;  5B5E E;  4IFM A;  3CWB E;  3FWN A;  1VKU A;  1MFZ A;  5AVW B;  1T2K D;  1MV8 A;  3MP7 B;  2K92 A;  2AVA A;  1GXH A;  1JM0 A;  1KB9 D;  3SFD C;  3LW5 H;  4EYY Q;  1ZNV A;  3CCL P;  2UWJ E;  1KQL A;  3OA7 A;  1EDK A;  2Q7C A;  1SQX J;  2RH0 A;  2GA1 A;  2PAJ A;  3G26 A;  1FDO A;  3M0D A;  4R4L A;  2O1J A;  4OGQ B;  1X8Y A;  2KIK A;  3WU2 E;  2PRR A;  1SQQ K;  1A02 F;  2BAS A;  3L71 D;  1YJW P;  2GM4 A;  3CC7 P;  3AE6 C;  1S2E A;  2OYH C;  3CLQ A;  2YIU C;  1L4A B;  1N7S B;  1JB0 J;  3V2P A;  4ASV A;  2KS1 B;  4OGQ D;  1SFC C;  3P32 A;  1GL2 B;  3BCC D;  4PJ0 E;  3S1K A;  5CJ0 A;  4C7N B;  2L6E A;  5CZD B;  2M8N A;  1MKM A;  2WMM A;  4U0B A;  5HGO A;  1IC2 A;  1ACP A;  3HRN A;  2X2B A;  2MY5 A;  3CME P;  2PEO A;  2IFN A;  3L75 J;  3H1H J;  3TK1 A;  3DS3 A;  3L72 E;  1NH4 A;  5AVR B;  1EC5 A;  1N7S D;  5APU A;  2WSF J;  3MZW B;  3P8C D;  1JNM A;  2KNC B;  4MN4 C;  1K8A Q;  3WUU A;  2E76 B;  2O01 H;  2MF4 A;  2FKW B;  4IOI H;  2L5G B;  1PV3 A;  2WT7 B;  1AV1 A;  3WUT A;  2BUO A;  1BGY G;  1URQ A;  3PH0 A;  1KZU B;  1JY3 O;  3L72 G;  2XT1 A;  4UB8 E;  1USE A;  4GOE A;  2AEM A;  3MGN A;  4H0L B;  3ABV C;  2KI7 B;  1LTS C;  3D71 A;  4U3F J;  4GIF A;  1QRJ A;  2E76 D;  2YMY A;  1M56 D;  2LIW A;  2FAE A;  3M0A A;  1JTH B;  4HKZ H;  2QJK B;  3H47 A;  1NTM D;  4BRY A;  1SQQ J;  3F89 A;  4Y28 J;  4EIJ A;  1FU1 A;  1Y9B A;  4QNB A;  2AXT E;  1RF1 C;  5APQ A;  1KB9 E;  1ZRT D;  2ZT9 B;  4H0L D;  3FGA D;  5CBO A;  3NY7 B;  1X9V A;  3E7K A;  2JAZ A;  2GDY A;  5APY A;  5KJ7 A;  2KSE A;  5CCH A;  1L0L G;  2H43 A;  1SQB E;  1KC8 Q;  2W6A A;  3HE4 B;  2E74 B;  2V7Q H;  4MRT C;  1SQV D;  1KYO D;  2ZT9 D;  3MUD A;  1SQB K;  1JCD A;  3M91 A;  3H1I D;  3L71 E;  4D6T E;  3HE5 B;  3RL0 g;  4H13 B;  1S9K D;  3GHG B;  5EFW B;  4AUW A;  2FAD A;  5KAF H;  3M9H A;  3U1C A;  4PD4 D;  2YNY A;  2FXP A;  2KGE A;  5TIS H;  3RG6 C;  2BCC J;  5APV A;  1UII A;  2IBZ I;  3EWK A;  3M0D C;  2KSJ A;  3JSV C;  2EHT A;  2E74 D;  1T3J A;  2LIU A;  2LOL A;  3BCC E;  1GW3 A;  2ZAE B;  2M8L A;  4H13 D;  3EFG A;  1F80 D;  3U43 A;  1CZQ A;  2QE7 H;  3L71 G;  2KWL A;  3KXD A;  2ITA A;  1ZOY C;  2O3J A;  5H2F E;  5KLV D;  3P05 A;  1GZL A;  1NQ4 A;  3P8C E;  1L0N J;  2Y9Z A;  4OVN F;  1JO5 A;  3L73 J;  3BCC G;  2KOG A;  3HZQ A;  2LPK A;  2DW3 A;  2XZ0 D;  2K9J A;  1NGM B;  1QVF O;  5BU8 B;  2H88 C;  4PV1 B;  3AEE C;  2IYP A;  1MZ9 A;  2CPS A;  1LT9 B;  1TU3 F;  3GW6 A;  1P84 D;  3H1K E;  2HLO A;  2FYU D;  1NTM E;  2M0B A;  3AE1 C;  2JYL A;  2J59 M;  1YYC A;  5C39 A;  4PV1 D;  3TGU J;  2E5T A;  1PEU A;  3P7K A;  1ZRT E;  2P67 A;  1HJ0 A;  2MVV A;  5B5E H;  3RK3 B;  2BEQ D;  4WY4 B;  1YJ9 P;  2ZVN B;  2GYK A;  1T8K A;  4RKU J;  1NTM G;  3T97 A;  1RH5 B;  4L74 A;  1DIP A;  1SQV E;  1IZN B;  1KYO E;  1M74 A;  4GR2 A;  3MD0 A;  2ROQ A;  4K3A A;  3ITK A;  5CCG D;  3H1I E;  4GDO A;  5KJ7 C;  5CCH C;  3RK3 D;  1KQS O;  3KHU A;  3RG2 A;  3H1L J;  4WY4 D;  2JU2 A;  4EDF A;  1FZC C;  4BXL A;  1LTI C;  4U0F A;  3WU2 H;  3H0D A;  1IO4 A;  3MUD C;  1NKN A;  4NPD A;  5TJH A;  1X79 B;  3CL3 D;  1QL1 A;  5KLI B;  3G29 A;  1J1D B;  3DTJ A;  1SQV G;  3LIE A;  5AW7 B;  2N9Y B;  4JQ0 D;  4N3Y B;  3H1I G;  5AVY B;  4N6J A;  2NPS B;  3E2D A;  2MD9 A;  5KLV E;  3G9R A;  1BE3 D;  1IFM A;  4JPZ B;  1NU1 J;  1BXI A;  3B8E B;  3LW5 J;  1NAY A;  5AW0 B;  2N50 A;  4K35 A;  1W2E A;  2NPS D;  2PEK A;  2C9N Y;  2LKI A;  2MR8 A;  1IFN A;  2JB0 A;  1ZMB A;  2WPT A;  4LC1 A;  3CCR P;  1FOS F;  1NTZ D;  1N8R Q;  2JQ4 A;  2OAR A;  4YXD C;  2ZJS E;  3G28 A;  3OW2 O;  5KLV G;  1YHQ P;  4LGD E;  2E1M A;  2QSI A;  1BDC A;  5BS2 A;  4XFY A;  1VF5 B;  2FXM A;  3KZI H;  3RL0 C;  2W8Z A;  1ZXG A;  1N7L A;  2KK7 A;  3MGE A;  1RO0 A;  3HD7 A;  2OYO A;  2VRS A;  2Q9I A;  2QEX P;  4UB8 H;  3IFM A;  1T2K C;  5AW1 B;  1MUU A;  3Q3D A;  1VQM P;  2CG5 B;  3H1J J;  1KQF B;  5L8R J;  1BDD A;  4PXH B;  1AF8 A;  5KAF E;  3GMA A;  1VF5 D;  1BCC J;  2YKO A;  5TIS E;  3D70 A;  5HGN A;  2GZG A;  5F2K A;  2HOD A;  2IX7 C;  4O9B A;  1KB9 H;  2EIA A;  2FYU G;  3A5T A;  5F2N A;  1SQP E;  3A3Y B;  2GZJ A;  2K94 A;  1EDI A;  1DEB A;  2P9X A;  1EXJ A;  2K0D X;  3RK3 E;  2EG5 A;  2N6Z A;  2O01 J;  1GPJ A;  1SQP K;  1KIL B;  5CHX A;  1CI6 B;  1FDM A;  1CW5 A;  3II6 A;  1OW6 A;  3A7O A;  3FX0 A;  4GKG A;  3QH9 A;  2XDJ A;  2I1J A;  3O6Q B;  1BSN A;  1G1I A;  4OGQ C;  4GOD A;  1BGY D;  2Z5I A;  4XRO A;  4XFZ A;  4DOJ A;  2N98 A;  1OW8 A;  2YKQ A;  1KIL D;  3E1R A;  1NWQ A;  3JCU H;  4R0M A;  2KGA A;  3CC4 P;  5BS1 A;  2QNW A;  1L4A C;  2P1J A;  1PGQ A;  3AEG C;  1JY3 N;  1BE3 E;  3CCS P;  4IFF A;  1JY2 O;  1GL2 C;  1NTK D;  2BCC D;  5HVC A;  1LTJ A;  1S5L H;  2KOD A;  1CSB A;  2B87 B;  2LKM A;  1PL5 A;  2IFM A;  2IPP A;  2PEN A;  2KR5 A;  3HUS A;  4W7Z A;  2JKV A;  4KHX A;  2V7Q J;  1NTZ E;  2DGY A;  3RK2 C;  1JCC A;  1YIT P;  1PGJ A;  5APW A;  1G1J A;  2Q5U A;  1KB9 I;  1NHL A;  1BE3 G;  1M1K Q;  2FQ0 A;  2XKM A;  2LL8 A;  4YPC A;  2P58 A;  1DEE G;  1L0N D;  4JF7 A;  1FE6 A;  4NPF X;  3L73 D;  2Q3I A;  3VRL C;  2JYG A;  4ZNC A;  3CCV P;  1SQP J;  2WQY C;  2N1T B;  2D2C C;  5APX A;  3G21 A;  2WIT A;  1NTZ G;  3AE7 C;  4Y99 B;  4IL6 X;  1H8A A;  2GDX A;  1M90 Q;  3HD7 C;  3AE3 C;  2PEM A;  1JOC A;  2VSQ A;  4RES B;  3Q5P A;  2M5R A;  1QVG O;  1L2P A;  2N1T D;  4DJG A;  3C1L A;  1MFT A;  3USS A;  2R3S A;  5DJT B;  5KP8 B;  1M1J B;  3TGU D;  5AVX B;  1IJD B;  1YQ3 C;  5JPA A;  3N7N A;  1GK4 A;  1K73 Q;  2BQ1 E;  3VP8 A;  3BRT B;  5AW5 B;  3AE5 C;  1FS0 E;  1KN7 A;  2XV6 A;  1KYO H;  3B71 A;  3VTP C;  1LWU B;  2IDB A;  3IF4 A;  1AVO A;  1YTZ I;  3B5N A;  1K04 A;  2CNR A;  3L37 A;  1HJB A;  1BGY E;  3NTE A;  3L74 J;  1G2C A;  1WMK A;  3GHG C;  4PD4 H;  1GTW A;  1NVO A;  1SVF A;  3PJS K;  2LR2 A;  1MZ8 A;  1FJK A;  4CA3 A;  4OWF A;  4M3L A;  2WSC H;  3H1L D;  2IZ0 A;  1X22 A;  1EZV D;  4ZKP A;  1DV5 A;  1NTK E;  3TYY A;  2VLQ A;  1ZR4 A;  3CWB J;  2JO1 A;  3KZI E;  4WVZ A;  1PP9 D;  3LRY A;  2NO8 A;  5AVU B;  2XND H;  2WSE H;  2ZYG A;  3S4R A;  4H2Y C;  1M57 D;  1H88 A;  2PEI A;  1L0L E;  3VMZ A;  1LTJ C;  1RHZ B;  4W80 A;  2MVU A;  1RNI A;  2AF8 A;  4HYT B;  2N6Y A;  2WVR A;  2KW2 A;  1H0T A;  1NTK G;  2BCC G;  3GF3 A;  1L0L K;  4R4M A;  3CE7 A;  4GR6 A;  3HUS C;  2KGC A;  4YTP C;  1IMP A;  3G71 P;  2P7J A;  1LP1 B;  3MIW A;  3HTK A;  5AVS B;  2ZXE B;  1P84 H;  1KYO I;  3G1G A;  2G8Y A;  2Z45 A;  1OR5 A;  5AW4 B;  1JMM A;  3GLM A;  2QRX A;  5KAI H;  1FZC A;  3WMM 0;  2CK3 H;  2V4H A;  4PD4 I;  1L0N G;  5AW8 B;  5KKZ C;  2KGD A;  2VLN A;  2OYH B;  2XNX A;  2FFD A;  1KTM A;  2YIU B;  1AVY A;  4AQR D;  3L73 G;  1RE4 A;  2HOD B;  3S9O A;  2R44 A;  1ZLL A;  1SFC B;  2KZI A;  5AVQ B;  3N4X A;  2WPQ A;  3RK3 C;  1FZB A;  3L72 J;  1GU4 A;  2LXC B;  3H1J D;  4W7Y A;  4WY4 C;  3JCU E;  1FZG A;  2OYI B;  2YO2 A;  3ZDM A;  1BCC D;  2EFJ A;  5F2O A;  1RQU A;  3L70 D;  4GOF A;  3Q5R A;  1ZME C;  1SFC D;  2Q6Q A;  4H2W C;  1NJI Q;  2R5D A;  4PH1 A;  1K05 A;  1S5L E;  2ZFC A;  1BSH A;  2M5A B;  2HPC B;  1JJ2 O;  3TGU G;  3GG2 A;  4BPF A;  3B5N C;  1ZP0 C;  3V2R A;  3TNU A;  1T6A A;  2FBW C;  1EZV E;  1NOH A;  2E75 C;  1ZV8 A;  1RE3 C;  1EQ7 A;  2YXR B;  3AEC C;  5KLI C;  1EDL A;  5B66 E;  1M8O B;  1J1E C;  1PP9 E;  3Q2Y A;  5I4T G;  2KG8 A;  1P84 I;  1QL2 A;  2NPS C;  3EJB A;  2H89 C;  4C7R A;  1N73 A;  5AVZ B;  2WZ7 A;  1RF1 B;  4U0E A;  3H1L G;  1L0H A;  2QIW A;  4IFD K;  1HWT C;  1EZV G;  3PHL A;  4I7Z C;  1SQB J;  1DH3 A;  2LTE A;  5GTH H;  1EOQ A;  4WB4 A;  1VQ6 P;  4WBA A;  1PP9 G;  4QKO A;  1FJP A;  1NTM K;  3B5I A;  2HR3 A;  2VLP A;  3L71 J;  4D6T J;  2WSF H;  1K9M Q;  2QJP C;  2SPZ A;  1RQV A;  2QVA A;  3B4S A;  4RO0 A;  3L4F A;  2OTK E;  4BPH A;  2FVE A;  2AEF A;  3SWF A;  1SP4 A;  1KD1 Q;  5AW2 B;  5KP7 B;  3DS5 A;  4EOT A;  2JBG A;  2FYZ A;  1NU1 G;  1D1D A;  2JWD A;  4U0A A;  1OFC X;  2I8D A;  3BCC J;  3NFQ A;  3RBZ A;  4ZMD A;  1A8O A;  1S9K E;  3TSI A;  2Q3E A;  3A0H H;  3R2P A;  1AQ5 A;  1VQO P;  1GXG A;  1SQV K;  4PD4 E;  3CD6 P;  1SQX D;  1L4A A;  1N7S A;  2FFD C;  7CEI A;  1GK6 A;  1JUN A;  4ZKU A;  1M6N A;  2KS1 A;  2W27 A;  1RE4 C;  3L70 E;  1GL2 A;  3AE4 C;  3H4E A;  2XV5 A;  4C7N A;  2W6J H;  2M8P A;  1JY2 N;  3V4W A;  2A06 D;  1BAJ A;  3GZM A;  1KMI Z;  3B4Q A;  1R5S A;  2FYN B;  4BWN A;  1KV4 A;  1PIX A;  2LML A;  2WSS H;  3H1J G;  5KLV K;  2KNC A;  2HG5 D;  1BCC G;  2Z4E A;  3L70 G;  3H1K J;  1NTM J;  3EJE A;  2WT7 A;  1Y8A A;  1HTL C;  4N78 D;  1YI2 P;  3L75 D;  1WT6 A;  3H1H D;  3L74 D;  2FAC A;  2N9B A;  1OW7 A;  1URQ B;  1X0T A;  1Q82 Q;  4XE5 B;  4KJM A;  2YO3 A;  3L35 A;  1P84 E;  1GD2 E;  3VYI A;  3VMX A;  2K2Q A;  3FXE A;  2FYU E;  3CI9 A;  5KAI E;  1JTH A;  2L9F A;  2FXO A;  2XXM A;  4BRY B;  2P2U A;  2GZI A;  4QMA A;  3A0B H;  1URQ D;  3GZL A;  1N73 C;  1VQ8 P;  2KOO A;  2FYU K;  1SQV J;  1T3U A;  1EDJ A;  3H1I J;  4I1L A;  3SWY A;  1E0H A;  4BPG A;  2QJY C;  4CPG A;  2PGD A;  5HGM A;  4U3F D;  2KOQ A;  1LTG C;  2H7H A;  2I1K A;  3BAT A;  1S72 P;  2RKL A;  3D6Z A;  1Z6M A;  4PH0 A;  3HE4 A;  1SQQ D;  1FZC B;  1LGH B;  2WSC J;  4XRQ A;  3AED C;  1NKZ B;  1K30 A;  1VPC A;  2DNW A;  3HE5 A;  2YXQ B; 
#chains in the Genus database with same CATH homology
 3CCM P;  1RO2 A;  3CCQ P;  1PEU A;  2BHV A;  1ZMB A;  3DS3 A;  4COC A;  3CCR P;  3G1G A;  1N8R Q;  2Z45 A;  2OAR A;  3CC4 P;  5BS1 A;  1A43 A;  3G28 A;  3HYB A;  5JPA A;  2PY8 A;  3G0V A;  3G6E P;  3OW2 O;  4U0E A;  3RG6 C;  1YHQ P;  4U0D A;  1K73 Q;  2BQ1 E;  3WBH A;  2E1M A;  1VQP P;  3CCS P;  1Q86 Q;  5BS2 A;  4XFY A;  1YJ9 P;  2XV6 A;  4M0I A;  1W2B O;  3DS0 A;  1K8A Q;  3DPH A;  4XFX A;  2KOD A;  2ONT A;  1EOQ A;  3MGE A;  1RO0 A;  2M8L A;  5HGL A;  3CXC O;  1VQ6 P;  3NTE A;  2LF4 A;  2JO0 A;  2QEX P;  1M74 A;  4GR2 A;  3G1I A;  3M1M A;  4U0C A;  3CCJ P;  1YI2 P;  3B5I A;  2PEN A;  2BUO A;  1VQ9 P;  1VQL P;  1Q82 Q;  1VQM P;  1K9M Q;  1KQS O;  1Q7Y Q;  3G4S P;  2XT1 A;  3P05 A;  1VQ4 P;  2DGY A;  1YIT P;  3CCL P;  3CC2 P;  4U0F A;  4WYM A;  1M1K Q;  1QRJ A;  2EFJ A;  1KD1 Q;  5F2O A;  5HGN A;  3H0D A;  1VQ5 P;  2Z44 A;  3DS5 A;  5F2K A;  3I55 P;  3H47 A;  2EIA A;  4COP A;  2XXM A;  3G26 A;  1D1D A;  4U0A A;  3Q20 A;  5F2N A;  3HZQ A;  1NJI Q;  2PEQ A;  4PH1 A;  3VRL C;  3LRY A;  1VQ8 P;  1PEQ A;  2JYG A;  3DS1 A;  3G29 A;  3DTJ A;  4QNB A;  1A8O A;  2Z46 A;  5DCK A;  2QA4 P;  3CCV P;  3I56 P;  3CPW O;  1YJW P;  1Q81 Q;  2P9X A;  1VQO P;  1PEM A;  2OTJ P;  1QVF O;  1YJN P;  2EG5 A;  4IPY A;  1VQK P;  1JJ2 O;  3E2D A;  3CD6 P;  1VQ7 P;  2PEI A;  3CCE P;  3CC7 P;  3G21 A;  3CCU P;  2OTL P;  1PEO A;  5HGM A;  2CWO A;  3CMA P;  1RNI A;  1EIA A;  1M90 Q;  1M6N A;  2PEM A;  1IUQ A;  1M6E X;  1S72 P;  1KC8 Q;  4PH0 A;  3H4E A;  4GR6 A;  2M8P A;  3DS2 A;  1E6J P;  2L6E A;  1BAJ A;  2M8N A;  4XRQ A;  1QVG O;  3G71 P;  4XRO A;  1K30 A;  2JYL A;  4U0B A;  4XFZ A;  3DS4 A;  2PEJ A;  5HGO A;  5I4T G;  1VQN P;  1YIJ P;  2PEK A;  1AUM A;  3CME P;  2PEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...