1K9MQ

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1k9mQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1k9mQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1k9mQ03
3CC2P 1VQ8P 1VQOP 1VQ5P 3CCUP 1KD1Q 3CC4P 1YJWP 1Q81Q 1KC8Q 1VQLP 1N8RQ 1Q7YQ 2QA4P 3OW2O 3CXCO 1KQSO 3CCEP 2OTJP 1K9MQ 1VQ9P 3G4SP 1Q86Q 3CCJP 1NJIQ 1VQKP 3CD6P 1YHQP 1Q82Q 1K8AQ 3G71P 3I55P 1VQ4P 1K73Q 3CCLP 3CMAP 1VQ6P 2OTLP 1QVFO 1YJNP 1VQMP 3CCQP 1YI2P 2QEXP 3CCSP 1YITP 3CCRP 1QVGO 1VQ7P 1YJ9P 3CCMP 3I56P 1W2BO 3CMEP 3CC7P 3CCVP 1M1KQ 1VQPP 3G6EP 3CPWO 1JJ2O 1YIJP 1VQNP 1M90Q 1S72P
chains in the Genus database with same CATH superfamily
1H89A 1N8RQ 1LTIC 1FDMA 1VDFA 3AE4C 4LGDE 4AUWA 1T8KA 2FFDA 4U3FG 1IK7A 1VQ4P 1FZBA 5BS1A 3CX5D 2J59M 3B8EB 5KLVD 3RGUA 3HE4B 3L74G 2RH0A 3HE5A 2R5DA 1TU3F 4PV1D 4PH1A 2FYNC 1EDIA 4GKGA 2KYVA 5APYA 3GF3A 2CNRA 3IN6A 4D6TE 1IMQA 3F89A 3V2PA 2KLVA 3E2DA 2JWDA 4U3FD 3P05A 1JNMA 1ZMEC 1SQBG 2K3RA 2JAZA 3L74D 3T97B 1L0NK 1J2JB 1PV3A 1XTCC 3HD7B 1JJ2O 4XFZA 1BE3G 1ZR2A 1CW5A 1A8OA 1OVRA 2N9YB 3B5NA 4GODA 4XROA 3RL0C 1RF1B 1FZAA 1OWAA 2BCCE 1BSHA 2R32A 1EZVI 4HB1A 2GYKA 1SQBD 1IMPA 4IOIH 1NU1G 5TISE 3JCUE 1YIJP 2GZJA 1BE3D 1PP9D 1NKZB 5APVA 1KV4A 1L0LK 2KG8A 2QVAA 2O1JA 3H25A 1DNYA 2JO1A 3L73E 2PRRA 2H88C 4N78D 1YQ4C 3PP5A 3I56P 3G28A 1NU1D 1NAYA 3GF7A 2FVEA 4W7YA 4ASVA 2KXPB 5B5EH 1AFOA 4IFDK 3QH9A 2WVRA 4U3FJ 4H2XC 2ZYDA 1IK9A 3BRVB 3RK2B 3L74J 5CCGD 2WSCH 3Q3DA 3NFQA 3CCRP 2K0YA 2E43A 4PV1C 3G9RA 5HGLA 1DIPA 3H6PA 5TJHA 3VMAA 1IFMA 2B87A 1IFPA 4H44D 1KD1Q 5AW1B 1KILD 2K0DX 4KJMA 4GOEA 1VQ9P 2AXCA 2KZIA 1YTZT 1GMJA 3BCCD 1KQGB 1ZXGA 1CI6A 5KAFE 4QNBA 1RQUA 2JDIH 2FY8A 1PP9J 1W2BO 3DS3A 1IJDB 1SQQG 1JTHB 2OYIB 1BCCD 2CK3H 1SQVK 1PEQA 2OQQA 1JY3N 2LTEA 1EIAA 2K93A 1FR2A 2K92A 5HGNA 1LTJA 5H2FE 3TGUJ 4XFXA 3G26A 1UJZA 5AVQB 1KB9H 1IC2A 3FXDA 3H1ID 4UB6E 1GU4A 4IL6H 2MF4A 1NU1J 2FBWC 3II6A 1LWUB 2JP3A 1SQQD 1PPJG 4U0AA 1USDA 2P10A 1Q2NA 5F2KA 3CC2P 1EMVA 2ZXEB 1M74A 1AQTA 2DW3A 2PEMA 3L71G 2PP6A 4Y99B 1QRJA 3CCLP 2M5RA 3HE4A 1PGOA 1EDJA 3CCSP 4PD4I 2MY5A 1PPJD 1LJ2A 2AVAA 2KNCA 2Y9ZA 1G1IA 3BCCJ 3ZDMA 2A45I 4NPFX 3L71D 1YI2P 5KLVE 1OVUA 2CPSA 3WUVA 1YITP 1L0HA 1BCCJ 3HD7A 1L2PA 2H8PD 2WSEH 1KTMA 4COPA 1VHNA 4L73A 1NWQA 3H1IJ 3H1JG 3L37A 2OYHB 2L9FA 3IAOA 1DD3A 2YIUB 2X2BA 1EXIA 1HTLC 1SQQJ 4EYYQ 1RNIA 2JU2A 1FU1A 2QJPB 1YBKA 1X8YA 3RK2C 3VTPC 3EFFK 1N86A 3RBZA 1IO4A 2M0BA 5AW3B 2IYOA 3E1RA 3M9BA 3AEEC 1K9MQ 1NTME 3HTKB 3DS0A 3G71P 1SQBE 1QL2A 2XNDH 1FZCC 2KUBA 1P84H 5KAIE 4WY4B 2N5HA 1OIPA 1GL2B 1QL1A 3L71J 5BS2A 3DS2A 4AQRD 3KZIE 2OYIC 3EFGA 5AVVB 5CBNA 1OW8A 2W6AA 2QSIA 1K8AQ 2D2CD 4RESB 2YMYA 2CGQA 4N78E 1T8ZA 3IFMA 2GDXA 2JR8A 2HPCB 5H2FH 1JOCA 3O6QB 2AXTH 4DT0A 2RKLA 2ONTA 4NEOA 1D1DA 2IDBA 2GDWA 3A7OA 4CA3A 4JYBA 3R2PA 2K0XA 4RO0A 1L0NG 1LT9C 2OYIA 4CPGA 1Q90D 1M8OB 2EIAA 3V5BA 5AVUB 3U59A 3DS4A 3CXHI 2JGPA 3G0VA 2IBZI 1WMKA 1GPJA 1N7SC 1K73Q 1BGYG 1LWUA 3V4WA 5AVXB 3BVHA 4OGQB 4ZMDA 2Y0CA 2Q6QA 1S4XA 3CCVP 3GW6A 4O9BA 1VQNP 7CEIA 2K1AA 1MUUA 1ZMBA 3G21A 2E1MA 4GT1A 3Q5SA 2BEQD 1Q7YQ 1USEA 1LT9A 3MGEA 2QM8A 4IZ6A 1BGYD 3IF4A 1EZVE 2AFEA 1S5LH 1KB9D 2JQ4A 2FACA 3H1HG 3PHLA 1LTAC 3TNUB 3KHUA 3AE1C 1N7SA 2LF4A 2VSQA 4JQ0D 5APQA 1LTBC 4TLFA 2NPSB 3M91A 2VLQA 1S1CX 4K35A 2FXMA 2OYOA 5APXA 2WSCJ 2M3BA 1HF9A 1L4AD 3H1KG 3H1HD 1SQQK 1SQPJ 1S5LX 2KI7B 2OYHA 1EOQA 2WPQA 3VMZA 2KOSA 3IR9A 3CL3D 2KLUA 3MGNA 4DCKA 3S1KA 1X9VA 3RK3D 4Y28J 3H1KD 2FAEA 1URQC 1KN7A 2FADA 1E0HA 1SQVG 2E74D 3SWKA 3LRYA 2I1JA 1VF5B 1KYOH 2Q3IA 4H0LB 1Z6MA 3HTKA 1BGYJ 2E75B 2PEKA 1H0TB 2KB7P 2AF8A 3CMAP 2FYUK 3CCMP 4WVZA 1RE4A 1JY2O 3B5ND 3LIEA 1GL2A 2W90A 4HKGA 2W27A 4HYTB 5KTBA 1KC8Q 3H1JE 4JPZB 1KFMA 3E7KA 2PEIA 1URQA 2P2UA 1NKNA 5GTHE 3H1HJ 1HVVA 2XV6A 1T3JA 3NTEA 3VMXA 2GZGA 2N6YA 3M06A 2Z4EA 2JEEA 1SQXE 2C9LY 1OZHA 4UB8E 3AECC 4IFFA 3RBXA 3RL0D 1AJYA 2LIUA 1G2CB 3G29A 1Z56A 1LTTC 3BRTB 5CCHA 1IFDA 2WSEJ 5APSA 3GKLC 2E76B 2ZYAA 4I7ZC 2WSFH 1SFCC 5APWA 1HBWA 4F37A 2K9YA 2M8LA 2Z46A 4PJ0E 5E79E 1EQ7A 3P8MC 3WUUA 2O01H 3VP9A 2KW2A 5APUA 2B89A 3G1IA 1OXZA 5CZDB 2MR8A 4WBAA 2ZT9D 1L0NE 2ZFCA 3AE9C 3B5NC 2ZVOB 3TNUA 2M8PA 4M0IA 1JEKA 1FDIA 1SFCA 4LC1A 3EQ2A 2RMZA 3CCEP 2E42A 1SQPK 3CD6P 1VF5C 3PRJA 1S9KD 3GHGB 4H0LC 1SLQA 2Y9YA 1VQMP 1OVVA 1HUCA 2BQ1E 4H13B 2A06E 5CJ4A 3SWFA 2C0XA 1PP9G 2WT7B 1L0LE 3AE2C 2K2QA 1IUQA 1K30A 1Q86Q 1K04A 3TGUG 4C7NB 2L0QA 2PEQA 5GTHH 5KLIB 1NTKE 1HJ0A 1ZOYC 2KS1B 2N1TC 1UNKA 2OTJP 3HD7D 5GTIH 1Q82Q 4XFYA 3Q2YA 3TGUD 1YJNP 4GOFA 3RK3E 3H1KE 5CJ0A 1T3UA 1FS0E 4COCA 1RE3C 4MN4C 1FZEA 2QJYB 1FOSF 3Q5RA 3RG6C 2PEOA 1WT6A 2N6ZA 3A2AA 1ACPA 5F2NA 3WU2H 4YXDC 4I1LA 1MV8A 2ZYGA 1IFJA 4H44B 4LLHA 2E5TA 1BDCA 3BCCG 1KYOD 3CWBE 2ZT9C 1DD4A 3D71A 4PD4H 3CXHE 2IBZE 5AW2B 1LTJC 4NPEA 2N1TA 1PZQA 1SQVE 1H88A 2A45H 1BCCG 1XTGB 2WZ7A 1R5LA 2LIWA 3VP8A 1JM0A 3HZQA 5HV8A 2L22A 1RE3A 3H1IG 4EI2A 1FZGA 5M1BA 2KSEA 4GIFA 2I1KA 1KLPA 1ZRTE 1X79B 3RK2D 2JKVA 2K37A 4ZNCA 1KQSO 1E5WA 2AEMA 1PEMA 1MFTA 3U1AA 1M1JB 4BPHA 1DX7A 3G3ZA 1YTZI 1ZN5A 2QJKB 3B5IA 2NO8A 1JCDA 1KQLA 1BXIA 4QMAA 1M7LA 1NYHA 5CMZA 3GLMA 1VQOP 2FQ2A 2GZEA 1ZNVA 4N3YB 4PH0A 3HD7C 1ZLLA 4GDOA 2LXCB 2KWLA 1S3JA 1J1DB 1X3OA 3H32B 2FYUG 3R4YA 3L75D 4OWFA 3DS5A 3OA7A 1RF1C 2L6EA 4IL6X 4L74A 4XRQA 5AVZB 3CXCO 3S4RA 2WSSH 2P58A 3GHGA 2R3SA 1HGZA 3MD0A 5TISH 2FYUD 3JCUH 3CX5E 1L0IA 1QVGO 3T97A 2W8ZA 2KGCA 2LPKA 3QWOC 1YYCA 3F5HA 1NGMB 4HJGH 3D6ZA 2JO0A 2WT7A 3HRNA 3P8CD 3FWLA 1RF1A 2QJYC 4U3FE 3GJNA 3CE7A 1PGPA 5AVRB 1N7SD 3L74E 2VLNA 4BWNA 3H1LJ 3P7KA 3CXHH 3L75J 2OTKE 2K9JB 5DCKA 2L4BA 3DS1A 2HYNA 2WSFJ 2WTYA 1VQ7P 3VYIA 1N73B 3D6YA 2UWJE 1T2KC 3L72D 2KK7A 2M5AB 3D70A 2GZFA 1BE3E 2CG5B 4PWVB 1VQ8P 1PP9E 2MD9A 3U43A 1MZ8A 2KGAA 1VQLP 1DV5A 1VL2A 2QA4P 5KAFH 5DJTB 3AEFC 2FYUJ 3ABVC 3VOPA 4BRYB 3HUSB 2O01J 1MKMA 4UHPB 3A3YB 1OW6A 3M9QA 1AUMA 3CI9A 2G8YA 3DPHA 1NU1E 5AW9B 2QJKC 1Y9BA 5KKZB 4UB6H 1LWUC 1YJWP 2Z5HA 1SQPG 1JY3P 5AW6B 4IPYA 2KSJA 3L70J 5EW5E 3EJEA 1QVFO 1GL2D 2IYPA 3NMDA 5B66E 3KXDA 4NPDA 2V7QH 1VKUA 1J1DC 1JTHA 1LTGC 4Y99C 1VQPP 2IX7C 2Z44A 4PD4D 1URQD 1G1JA 2BEZF 1GW3A 2P1JA 1M56D 1KILE 1SQPD 2JYLA 1AF8A 2KOQA 3AE6C 3BCCE 1CSBA 2KIKA 1KORA 3L72J 3AE7C 1BCCE 3A5TA 2SPZA 3WBHA 2ZXXA 4D6TG 1AA0A 1HQBA 3H32A 2KG6A 3H1IE 3PTZA 3W68A 2AFDA 1PEUA 3AE8C 2FXPA 3L4FA 5CCHD 2OYHC 1SQXJ 1R5SA 2YIUC 1SQQE 5KP6B 2QJPC 4YTPC 3A0BE 1L4AB 2ZJSE 2PGDA 1EC5A 4D6TD 4I2LC 2KGEA 1J1EB 2FFDB 3RL0g 2C9NY 1T6AA 2ERHA 1NTZJ 1PPJE 2KODA 4TT3H 2C0WA 1JB0J 2MKVA 1LTSC 1N73C 3RK3B 4H2WC 2AEFA 2PENA 5AVWB 2GUVA 2K88A 1RE4C 4WY4C 2XXMA 2E74B 3L71E 3ITKA 1GL2C 2QM7A 5KAIH 1EDLA 2K5XA 1OMIA 1SFCD 2FXOA 2KOGA 3KZIH 2Q1KA 3G6EP 1BDDA 3SFEC 2Q7CA 2MVVA 2VRSA 1CZQA 3OW2O 2K9JA 3CX5I 2FYNB 1N73A 1HY8A 4U0DA 4PXHB 3M9HA 4N6JA 2MJZA 2KGDA 4WY4A 3N4XA 3KYQA 3TF5A 4D6TJ 4BRYA 2VLOA 3AEAC 3HUSA 1H8AA 2HR3A 5L8RJ 1NJIQ 4DJGA 4ZKUA 2KG9A 5CCHC 4U7JA 1VF5D 2HPCA 4H0LD 3O6QA 4L75A 2IZ1A 4QKOA 2IPPA 1LP1B 1M57D 2PEJA 4OGQC 2YO3A 2BCCJ 4U0CA 3V4QA 1P84D 2YKQA 1M6EX 1VQ6P 1NH4A 3CMEP 1NTKJ 2YO2A 1AVOA 1GU5A 2B87B 2LR2A 1KMIZ 3L73J 2YXQB 5AW4B 1CEIA 3GZLA 1RF0C 5KJ7C 1YHQP 2N1TD 2GDYA 3VRLC 3A0BH 3V2QA 3CCQP 2NPSC 4HH2A 2N98A 1GK4A 3OJAB 2R5BA 4EDFA 1S72P 2WITA 1ZR4A 3AEDC 1SQXK 4YXWH 3H0DA 5JPAA 3LW5H 1SQPE 3GG2A 2BUOA 4PV1B 2WMMA 1AV1A 1RHZB 2FYZA 4W80A 2YKOA 2FVFA 2L91A 4KHXA 2Y0DA 2E76D 1M1KQ 2GUSA 1R8EA 1RF0A 5KJ7A 2JU1A 4EIJA 2NRGA 1FJPA 2KR5A 1NTZK 5AW8B 2XV5A 1PIXA 2NPSA 4DOJA 1HH0A 3SFDC 3KQGA 4C46A 3M1MA 4WWIA 2W83C 1W5CE 1BGYE 3AE5C 3MHVA 1QX8A 2ZAEB 2E75C 4XFJA 1KB9E 1DEBA 5AVSB 4IL6E 2KNCB 1NHLA 2JBGA 3LIDA 2FVAA 2RN0A 3SSUA 2LL8A 1JMBA 1U7MA 1PFIA 2J5UA 1NTMG 2JYGA 2GM4A 5CHXA 4U0FA 2YXRB 4I6MC 2G3AA 2IZ0A 3FX0A 2QIWA 5C39A 2H7HA 3USSA 1MZ9A 1NVOA 2V7QJ 2Z45A 3H1HE 3B71A 2GZIA 1FOSE 2LKIA 1H0TA 1LT1A 1GXGA 4H13D 1NTMD 1KFNA 4U0EA 4Z1MH 3Q1MA 4XA4A 1FDOA 2HLOA 3EJDA 2V4HA 4WYMA 4UB8H 5AVTB 1OFCX 5KLVJ 3JC22 5HVCA 1NOHA 2E76C 1KILB 1NO4A 1EXJA 2KORA 1GDTA 1LP1A 2HG5D 2Q3EA 4JBZA 3CPWO 1GXHA 5AW5B 1U7JA 2YNYA 2EHSA 5EJDA 5KP7B 1NTKK 3AEBC 2N9BA 4GR6A 1GD2E 1FAVA 2XDJA 1G2CA 4PJ0H 5E79H 3AEGC 2XT1A 4W7ZA 3CC7P 3A0HE 3VN0A 1E6JP 2VLPA 1EDKA 1NTMJ 1HWTC 1Q81Q 3Q20A 3H1LG 1SQBJ 1P84E 3W67A 1SVFA 2QG4A 4ASWA 1FZCB 3P32A 1NAFA 4L76A 3L75G 2QEXP 1BE3J 1EZVG 2O3JA 1RQVA 2XNXA 5BU8B 2H43A 2IFNA 5BU5A 3GHGC 1OW7A 2OGUA 1T2KD 2HFED 1PGJA 4H13C 2ROQA 1JY2N 3H1LD 2AXTE 1JO5A 3I55P 2AEJA 1WRGA 1EZVD 1AYIA 3H47A 3L36A 2XKMA 1QGKB 1KZUB 3LMOA 2WPTA 2ITAA 2WPVB 2DNWA 2EHTA 1F80D 1LT9B 5KLIC 1X0TA 4EOTA 4R4MA 4GR2A 2O01N 2M8RA 2Q5UA 1YQ3C 3EWKA 5APTA 3L70G 5AVYB 4BPGA 3UIAA 3RG2A 4HKZH 1N7SB 3GMAA 3NXSA 5CCGC 1LNQA 4XE5B 2H89C 1E79H 1S9KE 4C7NA 4B86A 2OTLP 4ZKPA 2XZ0D 2ZVNB 1FC2C 2NZ2A 4IFMA 1JCCA 2HODB 3L70D 4H44C 3PJSK 2J58A 3L72G 1KILC 5AW7B 1S5LE 1W2EA 2KS1A 1RY3A 2M3EA 2L5GB 2WPSA 1ZW0A 1GK6A 2WPRA 1RO2A 1UIXA 3EJBA 2M8NA 4KT0J 1A02J 1KB9I 3M0AA 5KLVK 3V2NA 1IFNA 5CCGA 5DJUB 2EFJA 2KOOA 1GW4A 1LGHB 2D2CB 2LXBA 1FBMA 1SQXG 3SWYA 3DTJA 3WUTA 2I8DA 3H1JD 3LW5J 2QE7H 3C9IA 2LOLA 3A0HH 3S9OA 5I4TG 3H4EA 4BXLA 1KILA 2YKPA 3TGUE 2B9BA 1JMMA 3N7NA 1M1JC 3GZMA 2FQ0A 2KZJA 1IZNB 3L35A 5CBOA 1GZLA 3C8VA 1SQXD 1NTZG 3CCUP 2CQ8A 2JB0A 1ZP0C 3CLQA 1X22A 1FJKA 1HGVA 1URQB 2A45G 1HJBA 1NTMK 2WWWA 2PY8A 4A7PA 1KYOE 3C1LA 4WY4D 3BATA 1SQBK 4DZOA 3I5CA 3PLNA 1YJ9P 3OAKA 2YMKA 1VQKP 1NTZD 2PAJA 4YPCA 1MFZA 1QLED 3WMM0 4JF7A 2JWAA 2XU6A 5K5GB 1FZCA 2CWOA 4BPFA 1M1JA 5AW0B 1JY2P 4R4LA 3MTUE 2R3CA 3AE3C 1NU1K 3H1JJ 3CX5H 2MVUA 3KDPB 2W6JH 1PGQA 3CCJP 4MRTC 1FE6A 3MUDC 2Q9IA 1AQ5A 3M0DC 2KOPA 1M6NA 1L0ND 2GA1A 3B4SA 4C7RA 4U0BA 2KP8A 1M90Q 1K05A 2A06G 3KPEA 1IFIA 3FXEA 2WQYC 4JYCA 5BVZA 1P84I 1L0LG 1DEEG 3H1LE 4OGQD 3Q5PA 1PL5A 3E1IA 1SS1A 2BCCG 3L75E 3HE5B 4DG9A 2CPBA 1N2DC 2A06D 2FQ1A 2P9XA 3MUDA 2MR7A 4I7ZB 2BHVA 3O8ZA 3M0DA 1GTWA 2P67A 1NTKG 1SFCB 3K5BA 1L0LD 1BAJA 1DH3A 3MIWA 2D2CC 3V2RA 5F2OA 2BCCD 2N5IA 2FYUE 3L73G 5KJ7D 1A02F 2HODA 3HUSC 5HGOA 1N7LA 4M3LA 3V6IA 2NPSD 2N50A 2EG5A 1BSNA 4H2YC 3MP7B 2QNWA 3HYBA 1NTKD 1ZV8A 3P8CE 2JJLA 1SP4A 1U57A 3G4SP 3B5NB 3B4QA 5KKZC 1L0NJ 4K3AA 3CWBG 3L73D 2IBZG 3NY7B 2PFXA 3L70E 1JY3O 4OH8B 2M5AA 2PNGA 2XZRA 2LKMA 1S2EA 1VQ5P 5B66H 2P7JA 2FHSC 2XZ1C 2B88A 3CWBD 3CXHD 2IBZD 3FGAD 4RJTA 2Z5IA 3L72E 2E75D 1L0LJ 4WB4A 1SQVD 3RL0B 1D7MA 1OX3A 2FKWB 4R0MA 3JSVC 2DGYA 3TK1A 1NQ4A 3BASA 2E5YA 1AVYA 2IFMA 5KP8B 1QEXA 1PEOA 3MZWB 1ZRTD 5GTIE 2N1TB 1OR5A 3TDKA 3FWNA 1VPCA 1A43A 1FZFA 3H1KJ 1L4AC 1UIIA 5B5EE 1RH5B 4AYCA 3VMYA 2POHA 1CI6B 3WU2E 3TSIA 3G1GA 1KQFB 2OARA 1J1EC 2FFDC 2Y0EA 4PD4E 4RKUJ 1NTZE 2W6BA 2LMLA 3TYYA 2BASA 3CC4P 3U1CA 2ZT9B 2O1KA 3CWBJ 3PH0A 1KYOI 1LTJB 5EFWB 4OVNF 3RK3C 1Y47A 1JUNA 3NTNA 5KLVG 1SQVJ 1RO0A 2E74C 2R44A 2K94A 5HGMA 2QRXA 1Y8AA 1L4AA
chains in the Genus database with same CATH topology
1VQ8P 1VQOP 1VQ5P 1Q81Q 3Q20A 1D1DA 1VQLP 1N8RQ 4U0CA 1EOQA 2QA4P 4PH0A 2OTJP 2JYGA 3CCJP 1RO2A 4U0FA 1Q82Q 1M6EX 2M8NA 1VQ4P 4XFYA 1VQ6P 5BS1A 1YJNP 1YI2P 2QEXP 3DS5A 1YITP 3CCRP 1AUMA 1M6NA 2L6EA 5HGLA 3DPHA 3CMEP 2EFJA 2KODA 2Z45A 4PH1A 4U0BA 4COCA 2M8LA 2Z46A 1M90Q 4COPA 3LRYA 2EIAA 3RG6C 3DTJA 2PEOA 1KD1Q 1YJWP 4XRQA 2PENA 5F2NA 3CXCO 2DGYA 2PEKA 1VQ9P 3DS4A 3G0VA 3G1IA 2XXMA 3E2DA 4U0EA 1YHQP 4IPYA 3P05A 5I4TG 3I55P 1K73Q 3H4EA 3CMAP 3VRLC 1RNIA 1QVFO 3CCQP 4QNBA 1PEOA 1QVGO 3CCMP 3H47A 1W2BO 3DS3A 3CCVP 1VQPP 3G6EP 4WYMA 2Z44A 1JJ2O 2M8PA 4M0IA 1VQNP 2JO0A 4XFZA 1S72P 2P9XA 1PEQA 1ZMBA 3G21A 3CCUP 2BHVA 1EIAA 5JPAA 3H0DA 2E1MA 1A8OA 1KC8Q 1BAJA 1Q7YQ 3OW2O 5HGNA 3CCEP 1A43A 3HZQA 3G26A 4XFXA 2PEIA 4XROA 1K9MQ 2BUOA 2JYLA 3MGEA 3CD6P 3DS0A 5F2OA 3G71P 2PY8A 1VQMP 4GR2A 4U0DA 5HGOA 2XV6A 1YJ9P 2BQ1E 3G1GA 3NTEA 2OARA 1M1KQ 4U0AA 3CPWO 2EG5A 1YIJP 1VQKP 5F2KA 3CC2P 2LF4A 3CC4P 5BS2A 3DS2A 3HYBA 3WBHA 1M74A 1KQSO 4GR6A 2CWOA 1IUQA 1K30A 2PEMA 3G4SP 1Q86Q 1PEMA 1NJIQ 3M1MA 1K8AQ 1PEUA 1QRJA 5DCKA 3CCLP 2OTLP 3B5IA 3DS1A 3CCSP 3G29A 1VQ7P 1RO0A 2XT1A 3I56P 3G28A 3CC7P 5HGMA 1E6JP 2PEQA 2ONTA 2PEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 P;  1VQ8 P;  1VQO P;  1VQ5 P;  3CCU P;  1KD1 Q;  3CC4 P;  1YJW P;  1Q81 Q;  1KC8 Q;  1VQL P;  1N8R Q;  1Q7Y Q;  2QA4 P;  3OW2 O;  3CXC O;  1KQS O;  3CCE P;  2OTJ P;  1K9M Q;  1VQ9 P;  3G4S P;  1Q86 Q;  3CCJ P;  1NJI Q;  1VQK P;  3CD6 P;  1YHQ P;  1Q82 Q;  1K8A Q;  3G71 P;  3I55 P;  1VQ4 P;  1K73 Q;  3CCL P;  3CMA P;  1VQ6 P;  2OTL P;  1QVF O;  1YJN P;  1VQM P;  3CCQ P;  1YI2 P;  2QEX P;  3CCS P;  1YIT P;  3CCR P;  1QVG O;  1VQ7 P;  1YJ9 P;  3CCM P;  3I56 P;  1W2B O;  3CME P;  3CC7 P;  3CCV P;  1M1K Q;  1VQP P;  3G6E P;  3CPW O;  1JJ2 O;  1YIJ P;  1VQN P;  1M90 Q;  1S72 P; 
#chains in the Genus database with same CATH topology
 1H89 A;  1N8R Q;  1LTI C;  1FDM A;  1VDF A;  3AE4 C;  4LGD E;  4AUW A;  1T8K A;  2FFD A;  4U3F G;  1IK7 A;  1VQ4 P;  1FZB A;  5BS1 A;  3CX5 D;  2J59 M;  3B8E B;  5KLV D;  3RGU A;  3HE4 B;  3L74 G;  2RH0 A;  3HE5 A;  2R5D A;  1TU3 F;  4PV1 D;  4PH1 A;  2FYN C;  1EDI A;  4GKG A;  2KYV A;  5APY A;  3GF3 A;  2CNR A;  3IN6 A;  4D6T E;  1IMQ A;  3F89 A;  3V2P A;  2KLV A;  3E2D A;  2JWD A;  4U3F D;  3P05 A;  1JNM A;  1ZME C;  1SQB G;  2K3R A;  2JAZ A;  3L74 D;  3T97 B;  1L0N K;  1J2J B;  1PV3 A;  1XTC C;  3HD7 B;  1JJ2 O;  4XFZ A;  1BE3 G;  1ZR2 A;  1CW5 A;  1A8O A;  1OVR A;  2N9Y B;  3B5N A;  4GOD A;  4XRO A;  3RL0 C;  1RF1 B;  1FZA A;  1OWA A;  2BCC E;  1BSH A;  2R32 A;  1EZV I;  4HB1 A;  2GYK A;  1SQB D;  1IMP A;  4IOI H;  1NU1 G;  5TIS E;  3JCU E;  1YIJ P;  2GZJ A;  1BE3 D;  1PP9 D;  1NKZ B;  5APV A;  1KV4 A;  1L0L K;  2KG8 A;  2QVA A;  2O1J A;  3H25 A;  1DNY A;  2JO1 A;  3L73 E;  2PRR A;  2H88 C;  4N78 D;  1YQ4 C;  3PP5 A;  3I56 P;  3G28 A;  1NU1 D;  1NAY A;  3GF7 A;  2FVE A;  4W7Y A;  4ASV A;  2KXP B;  5B5E H;  1AFO A;  4IFD K;  3QH9 A;  2WVR A;  4U3F J;  4H2X C;  2ZYD A;  1IK9 A;  3BRV B;  3RK2 B;  3L74 J;  5CCG D;  2WSC H;  3Q3D A;  3NFQ A;  3CCR P;  2K0Y A;  2E43 A;  4PV1 C;  3G9R A;  5HGL A;  1DIP A;  3H6P A;  5TJH A;  3VMA A;  1IFM A;  2B87 A;  1IFP A;  4H44 D;  1KD1 Q;  5AW1 B;  1KIL D;  2K0D X;  4KJM A;  4GOE A;  1VQ9 P;  2AXC A;  2KZI A;  1YTZ T;  1GMJ A;  3BCC D;  1KQG B;  1ZXG A;  1CI6 A;  5KAF E;  4QNB A;  1RQU A;  2JDI H;  2FY8 A;  1PP9 J;  1W2B O;  3DS3 A;  1IJD B;  1SQQ G;  1JTH B;  2OYI B;  1BCC D;  2CK3 H;  1SQV K;  1PEQ A;  2OQQ A;  1JY3 N;  2LTE A;  1EIA A;  2K93 A;  1FR2 A;  2K92 A;  5HGN A;  1LTJ A;  5H2F E;  3TGU J;  4XFX A;  3G26 A;  1UJZ A;  5AVQ B;  1KB9 H;  1IC2 A;  3FXD A;  3H1I D;  4UB6 E;  1GU4 A;  4IL6 H;  2MF4 A;  1NU1 J;  2FBW C;  3II6 A;  1LWU B;  2JP3 A;  1SQQ D;  1PPJ G;  4U0A A;  1USD A;  2P10 A;  1Q2N A;  5F2K A;  3CC2 P;  1EMV A;  2ZXE B;  1M74 A;  1AQT A;  2DW3 A;  2PEM A;  3L71 G;  2PP6 A;  4Y99 B;  1QRJ A;  3CCL P;  2M5R A;  3HE4 A;  1PGO A;  1EDJ A;  3CCS P;  4PD4 I;  2MY5 A;  1PPJ D;  1LJ2 A;  2AVA A;  2KNC A;  2Y9Z A;  1G1I A;  3BCC J;  3ZDM A;  2A45 I;  4NPF X;  3L71 D;  1YI2 P;  5KLV E;  1OVU A;  2CPS A;  3WUV A;  1YIT P;  1L0H A;  1BCC J;  3HD7 A;  1L2P A;  2H8P D;  2WSE H;  1KTM A;  4COP A;  1VHN A;  4L73 A;  1NWQ A;  3H1I J;  3H1J G;  3L37 A;  2OYH B;  2L9F A;  3IAO A;  1DD3 A;  2YIU B;  2X2B A;  1EXI A;  1HTL C;  1SQQ J;  4EYY Q;  1RNI A;  2JU2 A;  1FU1 A;  2QJP B;  1YBK A;  1X8Y A;  3RK2 C;  3VTP C;  3EFF K;  1N86 A;  3RBZ A;  1IO4 A;  2M0B A;  5AW3 B;  2IYO A;  3E1R A;  3M9B A;  3AEE C;  1K9M Q;  1NTM E;  3HTK B;  3DS0 A;  3G71 P;  1SQB E;  1QL2 A;  2XND H;  1FZC C;  2KUB A;  1P84 H;  5KAI E;  4WY4 B;  2N5H A;  1OIP A;  1GL2 B;  1QL1 A;  3L71 J;  5BS2 A;  3DS2 A;  4AQR D;  3KZI E;  2OYI C;  3EFG A;  5AVV B;  5CBN A;  1OW8 A;  2W6A A;  2QSI A;  1K8A Q;  2D2C D;  4RES B;  2YMY A;  2CGQ A;  4N78 E;  1T8Z A;  3IFM A;  2GDX A;  2JR8 A;  2HPC B;  5H2F H;  1JOC A;  3O6Q B;  2AXT H;  4DT0 A;  2RKL A;  2ONT A;  4NEO A;  1D1D A;  2IDB A;  2GDW A;  3A7O A;  4CA3 A;  4JYB A;  3R2P A;  2K0X A;  4RO0 A;  1L0N G;  1LT9 C;  2OYI A;  4CPG A;  1Q90 D;  1M8O B;  2EIA A;  3V5B A;  5AVU B;  3U59 A;  3DS4 A;  3CXH I;  2JGP A;  3G0V A;  2IBZ I;  1WMK A;  1GPJ A;  1N7S C;  1K73 Q;  1BGY G;  1LWU A;  3V4W A;  5AVX B;  3BVH A;  4OGQ B;  4ZMD A;  2Y0C A;  2Q6Q A;  1S4X A;  3CCV P;  3GW6 A;  4O9B A;  1VQN P;  7CEI A;  2K1A A;  1MUU A;  1ZMB A;  3G21 A;  2E1M A;  4GT1 A;  3Q5S A;  2BEQ D;  1Q7Y Q;  1USE A;  1LT9 A;  3MGE A;  2QM8 A;  4IZ6 A;  1BGY D;  3IF4 A;  1EZV E;  2AFE A;  1S5L H;  1KB9 D;  2JQ4 A;  2FAC A;  3H1H G;  3PHL A;  1LTA C;  3TNU B;  3KHU A;  3AE1 C;  1N7S A;  2LF4 A;  2VSQ A;  4JQ0 D;  5APQ A;  1LTB C;  4TLF A;  2NPS B;  3M91 A;  2VLQ A;  1S1C X;  4K35 A;  2FXM A;  2OYO A;  5APX A;  2WSC J;  2M3B A;  1HF9 A;  1L4A D;  3H1K G;  3H1H D;  1SQQ K;  1SQP J;  1S5L X;  2KI7 B;  2OYH A;  1EOQ A;  2WPQ A;  3VMZ A;  2KOS A;  3IR9 A;  3CL3 D;  2KLU A;  3MGN A;  4DCK A;  3S1K A;  1X9V A;  3RK3 D;  4Y28 J;  3H1K D;  2FAE A;  1URQ C;  1KN7 A;  2FAD A;  1E0H A;  1SQV G;  2E74 D;  3SWK A;  3LRY A;  2I1J A;  1VF5 B;  1KYO H;  2Q3I A;  4H0L B;  1Z6M A;  3HTK A;  1BGY J;  2E75 B;  2PEK A;  1H0T B;  2KB7 P;  2AF8 A;  3CMA P;  2FYU K;  3CCM P;  4WVZ A;  1RE4 A;  1JY2 O;  3B5N D;  3LIE A;  1GL2 A;  2W90 A;  4HKG A;  2W27 A;  4HYT B;  5KTB A;  1KC8 Q;  3H1J E;  4JPZ B;  1KFM A;  3E7K A;  2PEI A;  1URQ A;  2P2U A;  1NKN A;  5GTH E;  3H1H J;  1HVV A;  2XV6 A;  1T3J A;  3NTE A;  3VMX A;  2GZG A;  2N6Y A;  3M06 A;  2Z4E A;  2JEE A;  1SQX E;  2C9L Y;  1OZH A;  4UB8 E;  3AEC C;  4IFF A;  3RBX A;  3RL0 D;  1AJY A;  2LIU A;  1G2C B;  3G29 A;  1Z56 A;  1LTT C;  3BRT B;  5CCH A;  1IFD A;  2WSE J;  5APS A;  3GKL C;  2E76 B;  2ZYA A;  4I7Z C;  2WSF H;  1SFC C;  5APW A;  1HBW A;  4F37 A;  2K9Y A;  2M8L A;  2Z46 A;  4PJ0 E;  5E79 E;  1EQ7 A;  3P8M C;  3WUU A;  2O01 H;  3VP9 A;  2KW2 A;  5APU A;  2B89 A;  3G1I A;  1OXZ A;  5CZD B;  2MR8 A;  4WBA A;  2ZT9 D;  1L0N E;  2ZFC A;  3AE9 C;  3B5N C;  2ZVO B;  3TNU A;  2M8P A;  4M0I A;  1JEK A;  1FDI A;  1SFC A;  4LC1 A;  3EQ2 A;  2RMZ A;  3CCE P;  2E42 A;  1SQP K;  3CD6 P;  1VF5 C;  3PRJ A;  1S9K D;  3GHG B;  4H0L C;  1SLQ A;  2Y9Y A;  1VQM P;  1OVV A;  1HUC A;  2BQ1 E;  4H13 B;  2A06 E;  5CJ4 A;  3SWF A;  2C0X A;  1PP9 G;  2WT7 B;  1L0L E;  3AE2 C;  2K2Q A;  1IUQ A;  1K30 A;  1Q86 Q;  1K04 A;  3TGU G;  4C7N B;  2L0Q A;  2PEQ A;  5GTH H;  5KLI B;  1NTK E;  1HJ0 A;  1ZOY C;  2KS1 B;  2N1T C;  1UNK A;  2OTJ P;  3HD7 D;  5GTI H;  1Q82 Q;  4XFY A;  3Q2Y A;  3TGU D;  1YJN P;  4GOF A;  3RK3 E;  3H1K E;  5CJ0 A;  1T3U A;  1FS0 E;  4COC A;  1RE3 C;  4MN4 C;  1FZE A;  2QJY B;  1FOS F;  3Q5R A;  3RG6 C;  2PEO A;  1WT6 A;  2N6Z A;  3A2A A;  1ACP A;  5F2N A;  3WU2 H;  4YXD C;  4I1L A;  1MV8 A;  2ZYG A;  1IFJ A;  4H44 B;  4LLH A;  2E5T A;  1BDC A;  3BCC G;  1KYO D;  3CWB E;  2ZT9 C;  1DD4 A;  3D71 A;  4PD4 H;  3CXH E;  2IBZ E;  5AW2 B;  1LTJ C;  4NPE A;  2N1T A;  1PZQ A;  1SQV E;  1H88 A;  2A45 H;  1BCC G;  1XTG B;  2WZ7 A;  1R5L A;  2LIW A;  3VP8 A;  1JM0 A;  3HZQ A;  5HV8 A;  2L22 A;  1RE3 A;  3H1I G;  4EI2 A;  1FZG A;  5M1B A;  2KSE A;  4GIF A;  2I1K A;  1KLP A;  1ZRT E;  1X79 B;  3RK2 D;  2JKV A;  2K37 A;  4ZNC A;  1KQS O;  1E5W A;  2AEM A;  1PEM A;  1MFT A;  3U1A A;  1M1J B;  4BPH A;  1DX7 A;  3G3Z A;  1YTZ I;  1ZN5 A;  2QJK B;  3B5I A;  2NO8 A;  1JCD A;  1KQL A;  1BXI A;  4QMA A;  1M7L A;  1NYH A;  5CMZ A;  3GLM A;  1VQO P;  2FQ2 A;  2GZE A;  1ZNV A;  4N3Y B;  4PH0 A;  3HD7 C;  1ZLL A;  4GDO A;  2LXC B;  2KWL A;  1S3J A;  1J1D B;  1X3O A;  3H32 B;  2FYU G;  3R4Y A;  3L75 D;  4OWF A;  3DS5 A;  3OA7 A;  1RF1 C;  2L6E A;  4IL6 X;  4L74 A;  4XRQ A;  5AVZ B;  3CXC O;  3S4R A;  2WSS H;  2P58 A;  3GHG A;  2R3S A;  1HGZ A;  3MD0 A;  5TIS H;  2FYU D;  3JCU H;  3CX5 E;  1L0I A;  1QVG O;  3T97 A;  2W8Z A;  2KGC A;  2LPK A;  3QWO C;  1YYC A;  3F5H A;  1NGM B;  4HJG H;  3D6Z A;  2JO0 A;  2WT7 A;  3HRN A;  3P8C D;  3FWL A;  1RF1 A;  2QJY C;  4U3F E;  3GJN A;  3CE7 A;  1PGP A;  5AVR B;  1N7S D;  3L74 E;  2VLN A;  4BWN A;  3H1L J;  3P7K A;  3CXH H;  3L75 J;  2OTK E;  2K9J B;  5DCK A;  2L4B A;  3DS1 A;  2HYN A;  2WSF J;  2WTY A;  1VQ7 P;  3VYI A;  1N73 B;  3D6Y A;  2UWJ E;  1T2K C;  3L72 D;  2KK7 A;  2M5A B;  3D70 A;  2GZF A;  1BE3 E;  2CG5 B;  4PWV B;  1VQ8 P;  1PP9 E;  2MD9 A;  3U43 A;  1MZ8 A;  2KGA A;  1VQL P;  1DV5 A;  1VL2 A;  2QA4 P;  5KAF H;  5DJT B;  3AEF C;  2FYU J;  3ABV C;  3VOP A;  4BRY B;  3HUS B;  2O01 J;  1MKM A;  4UHP B;  3A3Y B;  1OW6 A;  3M9Q A;  1AUM A;  3CI9 A;  2G8Y A;  3DPH A;  1NU1 E;  5AW9 B;  2QJK C;  1Y9B A;  5KKZ B;  4UB6 H;  1LWU C;  1YJW P;  2Z5H A;  1SQP G;  1JY3 P;  5AW6 B;  4IPY A;  2KSJ A;  3L70 J;  5EW5 E;  3EJE A;  1QVF O;  1GL2 D;  2IYP A;  3NMD A;  5B66 E;  3KXD A;  4NPD A;  2V7Q H;  1VKU A;  1J1D C;  1JTH A;  1LTG C;  4Y99 C;  1VQP P;  2IX7 C;  2Z44 A;  4PD4 D;  1URQ D;  1G1J A;  2BEZ F;  1GW3 A;  2P1J A;  1M56 D;  1KIL E;  1SQP D;  2JYL A;  1AF8 A;  2KOQ A;  3AE6 C;  3BCC E;  1CSB A;  2KIK A;  1KOR A;  3L72 J;  3AE7 C;  1BCC E;  3A5T A;  2SPZ A;  3WBH A;  2ZXX A;  4D6T G;  1AA0 A;  1HQB A;  3H32 A;  2KG6 A;  3H1I E;  3PTZ A;  3W68 A;  2AFD A;  1PEU A;  3AE8 C;  2FXP A;  3L4F A;  5CCH D;  2OYH C;  1SQX J;  1R5S A;  2YIU C;  1SQQ E;  5KP6 B;  2QJP C;  4YTP C;  3A0B E;  1L4A B;  2ZJS E;  2PGD A;  1EC5 A;  4D6T D;  4I2L C;  2KGE A;  1J1E B;  2FFD B;  3RL0 g;  2C9N Y;  1T6A A;  2ERH A;  1NTZ J;  1PPJ E;  2KOD A;  4TT3 H;  2C0W A;  1JB0 J;  2MKV A;  1LTS C;  1N73 C;  3RK3 B;  4H2W C;  2AEF A;  2PEN A;  5AVW B;  2GUV A;  2K88 A;  1RE4 C;  4WY4 C;  2XXM A;  2E74 B;  3L71 E;  3ITK A;  1GL2 C;  2QM7 A;  5KAI H;  1EDL A;  2K5X A;  1OMI A;  1SFC D;  2FXO A;  2KOG A;  3KZI H;  2Q1K A;  3G6E P;  1BDD A;  3SFE C;  2Q7C A;  2MVV A;  2VRS A;  1CZQ A;  3OW2 O;  2K9J A;  3CX5 I;  2FYN B;  1N73 A;  1HY8 A;  4U0D A;  4PXH B;  3M9H A;  4N6J A;  2MJZ A;  2KGD A;  4WY4 A;  3N4X A;  3KYQ A;  3TF5 A;  4D6T J;  4BRY A;  2VLO A;  3AEA C;  3HUS A;  1H8A A;  2HR3 A;  5L8R J;  1NJI Q;  4DJG A;  4ZKU A;  2KG9 A;  5CCH C;  4U7J A;  1VF5 D;  2HPC A;  4H0L D;  3O6Q A;  4L75 A;  2IZ1 A;  4QKO A;  2IPP A;  1LP1 B;  1M57 D;  2PEJ A;  4OGQ C;  2YO3 A;  2BCC J;  4U0C A;  3V4Q A;  1P84 D;  2YKQ A;  1M6E X;  1VQ6 P;  1NH4 A;  3CME P;  1NTK J;  2YO2 A;  1AVO A;  1GU5 A;  2B87 B;  2LR2 A;  1KMI Z;  3L73 J;  2YXQ B;  5AW4 B;  1CEI A;  3GZL A;  1RF0 C;  5KJ7 C;  1YHQ P;  2N1T D;  2GDY A;  3VRL C;  3A0B H;  3V2Q A;  3CCQ P;  2NPS C;  4HH2 A;  2N98 A;  1GK4 A;  3OJA B;  2R5B A;  4EDF A;  1S72 P;  2WIT A;  1ZR4 A;  3AED C;  1SQX K;  4YXW H;  3H0D A;  5JPA A;  3LW5 H;  1SQP E;  3GG2 A;  2BUO A;  4PV1 B;  2WMM A;  1AV1 A;  1RHZ B;  2FYZ A;  4W80 A;  2YKO A;  2FVF A;  2L91 A;  4KHX A;  2Y0D A;  2E76 D;  1M1K Q;  2GUS A;  1R8E A;  1RF0 A;  5KJ7 A;  2JU1 A;  4EIJ A;  2NRG A;  1FJP A;  2KR5 A;  1NTZ K;  5AW8 B;  2XV5 A;  1PIX A;  2NPS A;  4DOJ A;  1HH0 A;  3SFD C;  3KQG A;  4C46 A;  3M1M A;  4WWI A;  2W83 C;  1W5C E;  1BGY E;  3AE5 C;  3MHV A;  1QX8 A;  2ZAE B;  2E75 C;  4XFJ A;  1KB9 E;  1DEB A;  5AVS B;  4IL6 E;  2KNC B;  1NHL A;  2JBG A;  3LID A;  2FVA A;  2RN0 A;  3SSU A;  2LL8 A;  1JMB A;  1U7M A;  1PFI A;  2J5U A;  1NTM G;  2JYG A;  2GM4 A;  5CHX A;  4U0F A;  2YXR B;  4I6M C;  2G3A A;  2IZ0 A;  3FX0 A;  2QIW A;  5C39 A;  2H7H A;  3USS A;  1MZ9 A;  1NVO A;  2V7Q J;  2Z45 A;  3H1H E;  3B71 A;  2GZI A;  1FOS E;  2LKI A;  1H0T A;  1LT1 A;  1GXG A;  4H13 D;  1NTM D;  1KFN A;  4U0E A;  4Z1M H;  3Q1M A;  4XA4 A;  1FDO A;  2HLO A;  3EJD A;  2V4H A;  4WYM A;  4UB8 H;  5AVT B;  1OFC X;  5KLV J;  3JC2 2;  5HVC A;  1NOH A;  2E76 C;  1KIL B;  1NO4 A;  1EXJ A;  2KOR A;  1GDT A;  1LP1 A;  2HG5 D;  2Q3E A;  4JBZ A;  3CPW O;  1GXH A;  5AW5 B;  1U7J A;  2YNY A;  2EHS A;  5EJD A;  5KP7 B;  1NTK K;  3AEB C;  2N9B A;  4GR6 A;  1GD2 E;  1FAV A;  2XDJ A;  1G2C A;  4PJ0 H;  5E79 H;  3AEG C;  2XT1 A;  4W7Z A;  3CC7 P;  3A0H E;  3VN0 A;  1E6J P;  2VLP A;  1EDK A;  1NTM J;  1HWT C;  1Q81 Q;  3Q20 A;  3H1L G;  1SQB J;  1P84 E;  3W67 A;  1SVF A;  2QG4 A;  4ASW A;  1FZC B;  3P32 A;  1NAF A;  4L76 A;  3L75 G;  2QEX P;  1BE3 J;  1EZV G;  2O3J A;  1RQV A;  2XNX A;  5BU8 B;  2H43 A;  2IFN A;  5BU5 A;  3GHG C;  1OW7 A;  2OGU A;  1T2K D;  2HFE D;  1PGJ A;  4H13 C;  2ROQ A;  1JY2 N;  3H1L D;  2AXT E;  1JO5 A;  3I55 P;  2AEJ A;  1WRG A;  1EZV D;  1AYI A;  3H47 A;  3L36 A;  2XKM A;  1QGK B;  1KZU B;  3LMO A;  2WPT A;  2ITA A;  2WPV B;  2DNW A;  2EHT A;  1F80 D;  1LT9 B;  5KLI C;  1X0T A;  4EOT A;  4R4M A;  4GR2 A;  2O01 N;  2M8R A;  2Q5U A;  1YQ3 C;  3EWK A;  5APT A;  3L70 G;  5AVY B;  4BPG A;  3UIA A;  3RG2 A;  4HKZ H;  1N7S B;  3GMA A;  3NXS A;  5CCG C;  1LNQ A;  4XE5 B;  2H89 C;  1E79 H;  1S9K E;  4C7N A;  4B86 A;  2OTL P;  4ZKP A;  2XZ0 D;  2ZVN B;  1FC2 C;  2NZ2 A;  4IFM A;  1JCC A;  2HOD B;  3L70 D;  4H44 C;  3PJS K;  2J58 A;  3L72 G;  1KIL C;  5AW7 B;  1S5L E;  1W2E A;  2KS1 A;  1RY3 A;  2M3E A;  2L5G B;  2WPS A;  1ZW0 A;  1GK6 A;  2WPR A;  1RO2 A;  1UIX A;  3EJB A;  2M8N A;  4KT0 J;  1A02 J;  1KB9 I;  3M0A A;  5KLV K;  3V2N A;  1IFN A;  5CCG A;  5DJU B;  2EFJ A;  2KOO A;  1GW4 A;  1LGH B;  2D2C B;  2LXB A;  1FBM A;  1SQX G;  3SWY A;  3DTJ A;  3WUT A;  2I8D A;  3H1J D;  3LW5 J;  2QE7 H;  3C9I A;  2LOL A;  3A0H H;  3S9O A;  5I4T G;  3H4E A;  4BXL A;  1KIL A;  2YKP A;  3TGU E;  2B9B A;  1JMM A;  3N7N A;  1M1J C;  3GZM A;  2FQ0 A;  2KZJ A;  1IZN B;  3L35 A;  5CBO A;  1GZL A;  3C8V A;  1SQX D;  1NTZ G;  3CCU P;  2CQ8 A;  2JB0 A;  1ZP0 C;  3CLQ A;  1X22 A;  1FJK A;  1HGV A;  1URQ B;  2A45 G;  1HJB A;  1NTM K;  2WWW A;  2PY8 A;  4A7P A;  1KYO E;  3C1L A;  4WY4 D;  3BAT A;  1SQB K;  4DZO A;  3I5C A;  3PLN A;  1YJ9 P;  3OAK A;  2YMK A;  1VQK P;  1NTZ D;  2PAJ A;  4YPC A;  1MFZ A;  1QLE D;  3WMM 0;  4JF7 A;  2JWA A;  2XU6 A;  5K5G B;  1FZC A;  2CWO A;  4BPF A;  1M1J A;  5AW0 B;  1JY2 P;  4R4L A;  3MTU E;  2R3C A;  3AE3 C;  1NU1 K;  3H1J J;  3CX5 H;  2MVU A;  3KDP B;  2W6J H;  1PGQ A;  3CCJ P;  4MRT C;  1FE6 A;  3MUD C;  2Q9I A;  1AQ5 A;  3M0D C;  2KOP A;  1M6N A;  1L0N D;  2GA1 A;  3B4S A;  4C7R A;  4U0B A;  2KP8 A;  1M90 Q;  1K05 A;  2A06 G;  3KPE A;  1IFI A;  3FXE A;  2WQY C;  4JYC A;  5BVZ A;  1P84 I;  1L0L G;  1DEE G;  3H1L E;  4OGQ D;  3Q5P A;  1PL5 A;  3E1I A;  1SS1 A;  2BCC G;  3L75 E;  3HE5 B;  4DG9 A;  2CPB A;  1N2D C;  2A06 D;  2FQ1 A;  2P9X A;  3MUD A;  2MR7 A;  4I7Z B;  2BHV A;  3O8Z A;  3M0D A;  1GTW A;  2P67 A;  1NTK G;  1SFC B;  3K5B A;  1L0L D;  1BAJ A;  1DH3 A;  3MIW A;  2D2C C;  3V2R A;  5F2O A;  2BCC D;  2N5I A;  2FYU E;  3L73 G;  5KJ7 D;  1A02 F;  2HOD A;  3HUS C;  5HGO A;  1N7L A;  4M3L A;  3V6I A;  2NPS D;  2N50 A;  2EG5 A;  1BSN A;  4H2Y C;  3MP7 B;  2QNW A;  3HYB A;  1NTK D;  1ZV8 A;  3P8C E;  2JJL A;  1SP4 A;  1U57 A;  3G4S P;  3B5N B;  3B4Q A;  5KKZ C;  1L0N J;  4K3A A;  3CWB G;  3L73 D;  2IBZ G;  3NY7 B;  2PFX A;  3L70 E;  1JY3 O;  4OH8 B;  2M5A A;  2PNG A;  2XZR A;  2LKM A;  1S2E A;  1VQ5 P;  5B66 H;  2P7J A;  2FHS C;  2XZ1 C;  2B88 A;  3CWB D;  3CXH D;  2IBZ D;  3FGA D;  4RJT A;  2Z5I A;  3L72 E;  2E75 D;  1L0L J;  4WB4 A;  1SQV D;  3RL0 B;  1D7M A;  1OX3 A;  2FKW B;  4R0M A;  3JSV C;  2DGY A;  3TK1 A;  1NQ4 A;  3BAS A;  2E5Y A;  1AVY A;  2IFM A;  5KP8 B;  1QEX A;  1PEO A;  3MZW B;  1ZRT D;  5GTI E;  2N1T B;  1OR5 A;  3TDK A;  3FWN A;  1VPC A;  1A43 A;  1FZF A;  3H1K J;  1L4A C;  1UII A;  5B5E E;  1RH5 B;  4AYC A;  3VMY A;  2POH A;  1CI6 B;  3WU2 E;  3TSI A;  3G1G A;  1KQF B;  2OAR A;  1J1E C;  2FFD C;  2Y0E A;  4PD4 E;  4RKU J;  1NTZ E;  2W6B A;  2LML A;  3TYY A;  2BAS A;  3CC4 P;  3U1C A;  2ZT9 B;  2O1K A;  3CWB J;  3PH0 A;  1KYO I;  1LTJ B;  5EFW B;  4OVN F;  3RK3 C;  1Y47 A;  1JUN A;  3NTN A;  5KLV G;  1SQV J;  1RO0 A;  2E74 C;  2R44 A;  2K94 A;  5HGM A;  2QRX A;  1Y8A A;  1L4A A; 
#chains in the Genus database with same CATH homology
 1VQ8 P;  1VQO P;  1VQ5 P;  1Q81 Q;  3Q20 A;  1D1D A;  1VQL P;  1N8R Q;  4U0C A;  1EOQ A;  2QA4 P;  4PH0 A;  2OTJ P;  2JYG A;  3CCJ P;  1RO2 A;  4U0F A;  1Q82 Q;  1M6E X;  2M8N A;  1VQ4 P;  4XFY A;  1VQ6 P;  5BS1 A;  1YJN P;  1YI2 P;  2QEX P;  3DS5 A;  1YIT P;  3CCR P;  1AUM A;  1M6N A;  2L6E A;  5HGL A;  3DPH A;  3CME P;  2EFJ A;  2KOD A;  2Z45 A;  4PH1 A;  4U0B A;  4COC A;  2M8L A;  2Z46 A;  1M90 Q;  4COP A;  3LRY A;  2EIA A;  3RG6 C;  3DTJ A;  2PEO A;  1KD1 Q;  1YJW P;  4XRQ A;  2PEN A;  5F2N A;  3CXC O;  2DGY A;  2PEK A;  1VQ9 P;  3DS4 A;  3G0V A;  3G1I A;  2XXM A;  3E2D A;  4U0E A;  1YHQ P;  4IPY A;  3P05 A;  5I4T G;  3I55 P;  1K73 Q;  3H4E A;  3CMA P;  3VRL C;  1RNI A;  1QVF O;  3CCQ P;  4QNB A;  1PEO A;  1QVG O;  3CCM P;  3H47 A;  1W2B O;  3DS3 A;  3CCV P;  1VQP P;  3G6E P;  4WYM A;  2Z44 A;  1JJ2 O;  2M8P A;  4M0I A;  1VQN P;  2JO0 A;  4XFZ A;  1S72 P;  2P9X A;  1PEQ A;  1ZMB A;  3G21 A;  3CCU P;  2BHV A;  1EIA A;  5JPA A;  3H0D A;  2E1M A;  1A8O A;  1KC8 Q;  1BAJ A;  1Q7Y Q;  3OW2 O;  5HGN A;  3CCE P;  1A43 A;  3HZQ A;  3G26 A;  4XFX A;  2PEI A;  4XRO A;  1K9M Q;  2BUO A;  2JYL A;  3MGE A;  3CD6 P;  3DS0 A;  5F2O A;  3G71 P;  2PY8 A;  1VQM P;  4GR2 A;  4U0D A;  5HGO A;  2XV6 A;  1YJ9 P;  2BQ1 E;  3G1G A;  3NTE A;  2OAR A;  1M1K Q;  4U0A A;  3CPW O;  2EG5 A;  1YIJ P;  1VQK P;  5F2K A;  3CC2 P;  2LF4 A;  3CC4 P;  5BS2 A;  3DS2 A;  3HYB A;  3WBH A;  1M74 A;  1KQS O;  4GR6 A;  2CWO A;  1IUQ A;  1K30 A;  2PEM A;  3G4S P;  1Q86 Q;  1PEM A;  1NJI Q;  3M1M A;  1K8A Q;  1PEU A;  1QRJ A;  5DCK A;  3CCL P;  2OTL P;  3B5I A;  3DS1 A;  3CCS P;  3G29 A;  1VQ7 P;  1RO0 A;  2XT1 A;  3I56 P;  3G28 A;  3CC7 P;  5HGM A;  1E6J P;  2PEQ A;  2ONT A;  2PEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...