1K9MQ

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1k9mQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1k9mQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1k9mQ03
3CCSP 3CPWO 1YHQP 1VQKP 1YIJP 1Q7YQ 1VQ6P 3CCJP 1YITP 1YJWP 3G6EP 1NJIQ 3CCRP 3I56P 1YJ9P 3CCVP 3CXCO 1VQ9P 3CC7P 1VQMP 2OTLP 1Q82Q 1VQPP 3G4SP 3CCUP 3CC2P 3CCEP 3CD6P 1VQ4P 1K73Q 1QVGO 1M90Q 1VQ8P 1JJ2O 1N8RQ 1YI2P 1M1KQ 3G71P 1K8AQ 1QVFO 3OW2O 1Q81Q 3CMAP 1Q86Q 1VQ7P 1KQSO 1VQNP 1VQLP 3CCMP 1W2BO 1VQ5P 2QEXP 1S72P 1KC8Q 3CC4P 1VQOP 1K9MQ 3CMEP 3CCLP 2OTJP 2QA4P 3CCQP 3I55P 1KD1Q 1YJNP
chains in the Genus database with same CATH superfamily
1PEOA 1M6EX 5HGNA 1RF0C 2Z5HA 1JMMA 2JB0A 2LIUA 1LTIC 3HRNA 1OFCX 7CEIA 1KQFB 1LP1B 2KK7A 2H7HA 3EJEA 2QRXA 2L9FA 5HVCA 1N7SB 3H1IG 3CE7A 2FFDC 3VMZA 2JU2A 2KSEA 1A8OA 4B86A 2I8DA 2CNRA 1ZRTD 4I6MC 4U3FJ 3CXHH 1LTGC 2WSFH 1BGYJ 2GDWA 2P67A 4U0AA 1RF1C 2MR7A 1SQVG 1DIPA 3MHVA 4GDOA 1K8AQ 4YXWH 1NO4A 2LKIA 1E5WA 1FJKA 3N4XA 1D1DA 3L71J 3B5IA 1HJ0A 3V2RA 1YITP 1FZAA 1AFOA 3CCRP 5CCGD 4OGQD 3CXCO 5CMZA 4OVNF 2MJZA 1Z56A 3IFMA 3CLQA 3AE1C 1M1KQ 2MKVA 2ZFCA 1NYHA 2GUSA 2Q6QA 2P10A 1KILD 2BUOA 1KB9E 1MZ8A 2WSFJ 3HE5A 2E43A 3F89A 4HKGA 1T8ZA 1EMVA 1R5LA 1ZP0C 3VP8A 2A06E 1RF0A 2Z4EA 1CI6A 2OYHA 2A45G 2Q7CA 2VRSA 1E0HA 5HGLA 1FC2C 3OA7A 4XA4A 2BASA 2IBZE 1ZLLA 2K94A 2IYOA 2N1TC 2E74B 1W5CE 2FYNC 5AW2B 5TISH 1M7LA 1NTZD 1KYOE 5APUA 1KILA 1URQB 1L4AD 4QMAA 2E75B 1PGJA 3D6YA 2JR8A 1JNMA 1NTZK 1PPJD 1USDA 2KGDA 2WQYC 2Y0CA 2PP6A 2YXQB 2P1JA 3DPHA 3KPEA 1KFNA 2WPTA 3DS0A 4GOEA 1BDCA 1DD3A 3L70E 1J1DC 1SLQA 2EFJA 3AE4C 1EZVI 1VKUA 5GTHE 1MFTA 2MF4A 1FZBA 1NAFA 3HZQA 3H32A 3L37A 2E1MA 5H2FH 2JGPA 3BCCJ 2VLNA 3G4SP 1USEA 2R5BA 3Q1MA 5AW9B 3SWFA 2N1TA 1PGOA 1ZMEC 1AVOA 3VP9A 3VMXA 1HUCA 3HD7B 1SQXD 2DNWA 4LGDE 2BHVA 4GOFA 1L0HA 2KLUA 1EIAA 2KW2A 2O1KA 3VN0A 4XFYA 1IJDB 1IMQA 1SQBD 1GU4A 1N7SC 2FYUJ 2K88A 2B9BA 3H1KE 1NGMB 2KS1A 1ZW0A 3B8EB 1W2BO 4D6TE 2QJKB 3A0BH 3RG6C 2PNGA 1VPCA 3PJSK 3IR9A 2XNXA 3I5CA 5M1BA 4HB1A 2Q9IA 4U0BA 4BPGA 4N78D 2ERHA 2K3RA 3EJDA 4ZKPA 1GK6A 4U0FA 1N7SD 1VQLP 2OGUA 1PEUA 2LF4A 3LW5H 2OTJP 3RL0D 1LGHB 4XRQA 1BE3E 1LTBC 4JYBA 3L73D 1FZCA 5CZDB 3KZIE 2Y9ZA 4H2YC 3WMM0 3V5BA 1NTZG 5EJDA 2IYPA 4I2LC 2W8ZA 3L75E 2L6EA 1VF5B 2NRGA 4IL6X 2M5RA 2R3SA 4IFMA 3WU2E 2ZXEB 1OW8A 2KYVA 2L91A 2R44A 3JCUH 4H44D 3WUVA 1AYIA 3V4WA 3SFDC 1NU1E 5AW5B 2QM8A 1PPJG 5BVZA 3AEDC 1LP1A 1J1EB 1QGKB 3CL3D 1FDOA 1N7SA 3LW5J 2XKMA 1KB9D 2PEQA 3PH0A 1RE4A 3Q5PA 2K5XA 4PD4H 1FOSF 2M3BA 3MD0A 5TJHA 4UB6H 3NTEA 1Q2NA 3E2DA 2E74C 3BATA 1IFPA 2PGDA 3TYYA 2A06D 2WWWA 1XTCC 4RKUJ 3FWLA 1AVYA 1JJ2O 5I4TG 2YIUB 1URQC 2MD9A 4JBZA 5C39A 1PP9J 3BVHA 1IFJA 2BQ1E 3B5NB 1CW5A 1RY3A 2O1JA 4KJMA 1ZRTE 4BRYB 3CCUP 2CGQA 4MRTC 3L74D 1UIIA 2K37A 1CI6B 2GYKA 1EXJA 2OYHB 2DGYA 1SQXG 4HH2A 3HTKA 2PEMA 4GIFA 4W80A 1X0TA 1SQQD 4IL6H 1WMKA 1R5SA 2E75D 1ACPA 1IZNB 1YQ4C 2K9YA 1FAVA 4OGQB 1YTZT 2NPSD 4C7RA 5DCKA 2CK3H 1SQBG 3AEAC 1DD4A 3NTNA 5KLVE 2FKWB 2YO3A 5F2NA 4I7ZB 4JPZB 4R4MA 2YNYA 3BASA 2ZVNB 3A3YB 5KKZB 3L70D 2CG5B 3P8CD 2ROQA 2WPSA 1GK4A 1X22A 4XFJA 3USSA 2QVAA 3HD7C 2M5AB 3DS1A 1OR5A 2XT1A 3DS3A 4AYCA 5JPAA 3CCMP 5APYA 4PJ0H 2J58A 2JP3A 4BPHA 1JY3O 3PHLA 3A7OA 2AEFA 3L73G 1IFDA 3B71A 1Q82Q 3RBZA 1T3UA 4JF7A 5DJUB 5APTA 1M56D 3D6ZA 4XFZA 1HBWA 2IZ0A 3MTUE 1JY3N 1LT1A 2QJKC 3G29A 3E7KA 2QSIA 1AQ5A 1CSBA 3RBXA 2AXTE 1JY2P 3DTJA 5AVRB 1L4AB 3KXDA 2LL8A 1RH5B 2GZEA 1J2JB 1NJIQ 4NPEA 4YTPC 3O6QB 1ZR4A 1NAYA 3OJAB 1EXIA 2OYIB 1DX7A 3H1IJ 1SQVK 1NKZB 3H1KD 2JYLA 3M1MA 3P8MC 2O01N 2WSEH 4PD4I 4D6TD 1PPJE 3BRTB 4Y99B 1PIXA 3CCQP 4TLFA 4L75A 1SQVJ 3LIEA 5AW3B 4KT0J 1OVVA 2A06G 2N6YA 2POHA 1YI2P 3GZLA 1KQLA 1FJPA 1VF5C 4QKOA 3CMEP 2IX7C 1KTMA 3HD7A 5E79H 1QX8A 1IFNA 2ZYGA 1IMPA 1BE3D 3C8VA 2JBGA 3G28A 4NEOA 4WBAA 1J1EC 4PV1D 3L74G 2MVUA 5AW7B 1EOQA 1L0IA 2G3AA 2L4BA 2WSEJ 4ZMDA 2SPZA 3AE6C 3H47A 3AEBC 3L75D 3E1RA 3VYIA 1VQ4P 1SQQG 1ZN5A 1S5LX 1SQXE 3K5BA 1GW4A 5CJ4A 1IFMA 2IDBA 2XZ1C 1MKMA 1DNYA 5B5EH 1FZCB 3L72E 2YIUC 5H2FE 4WWIA 1SQBE 2IFMA 4BPFA 3M9BA 4GODA 3B5NC 4RO0A 1K9MQ 2M8PA 2EG5A 3CWBD 2E76D 1H88A 4EOTA 3G6EP 2V4HA 2H43A 3GG2A 1NU1K 3L70G 1GL2D 2FHSC 1NTKE 1NKNA 2OYHC 2GZGA 1JEKA 3Q20A 3M9HA 4COPA 2JJLA 4N78E 1AV1A 2M8LA 4GT1A 3B5ND 5CCGC 4OGQC 3RL0B 3WBHA 5L8RJ 2IFNA 1JO5A 1RO0A 1JCCA 3PRJA 3L73E 1IK7A 4I7ZC 5APXA 1KILC 1QRJA 3TGUE 2B89A 1S3JA 2QM7A 5HGOA 4OWFA 5KKZC 1F80D 2KIKA 1K04A 1S5LH 4CA3A 1X8YA 3SWKA 1EZVD 3G0VA 2I1JA 1T3JA 1VQMP 2XZRA 4BXLA 2YMYA 4IPYA 1S1CX 5KLVD 4H44B 2JAZA 2BCCE 3H1KG 2XV6A 3GF3A 1BSHA 5GTIH 5BU8B 4D6TG 4K3AA 1KMIZ 2Y9YA 3HTKB 3H25A 3H1JE 1KN7A 3B5NA 2WSCH 2J5UA 4BRYA 3VMAA 1A02J 1N73B 1DEEG 1JTHB 1SQPE 1HF9A 1L4AC 3KQGA 2E42A 3N7NA 1BE3G 2YKPA 5KAFE 2OYIC 2OARA 3CCEP 5CCGA 4PD4E 2K92A 1NH4A 2EHSA 2Z5IA 4Y99C 3L74E 1G2CA 3L75G 2AVAA 1P84H 3V2PA 1EDIA 5CJ0A 5KJ7D 2GDXA 1JB0J 2KOSA 3C9IA 2FQ0A 2WSSH 2YKQA 4HYTB 4LLHA 2WSCJ 1SQQE 5AW1B 1G1JA 4RJTA 3CC7P 1NWQA 3SSUA 4GKGA 3MZWB 2GA1A 1NU1G 3AEGC 2NPSB 3GHGA 1X79B 2PFXA 1X9VA 1L0NE 4AQRD 2M5AA 3VRLC 4Y28J 3A0HE 3II6A 3CWBG 2QNWA 1NTZJ 2KP8A 2OTLP 1IK9A 3U1CA 5KAIE 2KUBA 3P8CE 4OH8B 5AVZB 2AFDA 2HPCB 5AVSB 2KI7B 5KP7B 3CXHI 1Y9BA 5AVXB 4PXHB 4YXDC 1L4AA 2K9JB 3H1HE 1FZCC 1GD2E 1LWUB 1GW3A 2FXPA 3BRVB 3CX5H 2MVVA 3O6QA 2VSQA 1SFCD 3H4EA 2OYIA 5CBOA 4U0EA 3F5HA 4GR2A 1QVFO 3OW2O 2FXMA 3RGUA 2AEMA 2KXPB 1N86A 3P7KA 1BCCE 2L5GB 3EFGA 1YIJP 1Y8AA 3FWNA 3L72D 2LXCB 5KLVG 5AW8B 1JMBA 2N5IA 5B66H 5K5GB 5KP6B 3TSIA 1RE4C 2R3CA 1SQXK 3CC4P 3RL0C 1KQGB 4WVZA 5BS2A 3A5TA 3RK2D 2KZIA 1HGVA 1S4XA 1NTKD 1SQBK 2GM4A 1D7MA 4EI2A 1SQXJ 2B88A 1OXZA 3AEFC 1JM0A 1H89A 2KB7P 1OVUA 1SQBJ 2K93A 2V7QJ 1RE3A 1L0LE 3W68A 3H1LE 4H44C 4W7ZA 2K0XA 2VLQA 3G21A 3DS5A 5APSA 3TGUD 1P84I 4PV1B 1T2KD 3G71P 1OX3A 3RK3B 4GR6A 2D2CD 1IFIA 2N50A 3RK3E 4H0LD 2YO2A 1A02F 4U7JA 1QEXA 4EIJA 1HVVA 2LPKA 1NTME 2FVAA 1MZ9A 1HTLC 3ITKA 2C9LY 5HV8A 4U0DA 2BCCD 4L73A 1N73C 3TF5A 1KB9H 1H0TB 1KQSO 3HUSB 2WPRA 4UB8E 3WUUA 3H1JD 4ASWA 5HGMA 2N9BA 3JC22 1YJWP 2E76B 3CWBE 1A43A 1GL2B 3AE9C 1LTSC 3AE3C 1JUNA 3EWKA 2NZ2A 1DV5A 3RG2A 1SQPD 4U3FE 4H2XC 4HKZH 1BGYE 3PLNA 2QEXP 2MR8A 2E75C 4Z1MH 1JOCA 2AEJA 3CX5I 2ZXXA 3U59A 1YQ3C 2LOLA 2NPSC 1KYOH 4PD4D 1YBKA 4DT0A 4CPGA 1SQPK 2YMKA 2HYNA 2FBWC 1HJBA 3PP5A 2O01H 2E5TA 4JYCA 1KZUB 2ZAEB 2C0WA 4IFDK 1Z6MA 2HLOA 4L74A 1S72P 5CBNA 1ZV8A 1U7MA 1M57D 3L72G 1OIPA 1EZVE 2KSJA 2EHTA 1GTWA 1H8AA 1N2DC 1BDDA 2M3EA 3GLMA 3GJNA 1YYCA 1L0ND 3CXHE 1G2CB 1N73A 1JTHA 1E79H 2H88C 1SQQK 2QA4P 1LWUC 4HJGH 2WT7B 2IZ1A 2FFDB 2W6AA 2HR3A 2DW3A 1S9KE 5GTHH 1NTKG 3Q2YA 5AVTB 3GHGB 2C0XA 2QE7H 3LIDA 1SQQJ 2C9NY 2O01J 3EFFK 3L35A 2JWAA 1KC8Q 3CI9A 2X2BA 4DJGA 2KODA 2GZFA 3H1HD 2K0YA 2N6ZA 1DEBA 1FU1A 1FOSE 3VOPA 1M1JA 2KR5A 3P05A 3B4QA 5BU5A 1OVRA 2OTKE 5CCHC 2NPSA 3V2QA 5APVA 2FQ1A 5APWA 3TGUG 1FDMA 3M0DC 3GMAA 3CMAP 2KG8A 3W67A 4YPCA 1VQ5P 1BCCD 4AUWA 3L70J 1VDFA 2RMZA 1N7LA 1GXHA 4H13B 3WUTA 2GZIA 2L22A 2BCCG 4IFFA 4PWVB 3FXEA 2QJPB 2HG5D 5CCHD 2K2QA 4WYMA 1OW6A 4IOIH 2HPCA 1PEQA 3H1JG 2MY5A 5TISE 1YJNP 3M06A 4WY4B 2Z46A 2K9JA 1LWUA 2IBZI 2WPQA 4PV1C 4PH1A 3RK3C 2N98A 1QL2A 2FVFA 1M90Q 2XDJA 2A45H 1SQPG 1E6JP 1FBMA 2Y0EA 2CPBA 4ZNCA 1KYOI 5CHXA 1EQ7A 3KZIH 1L0LD 3V4QA 2Z45A 5AW0B 3H1LD 3H1KJ 2KWLA 2YKOA 4D6TJ 4C7NB 1VHNA 2ZJSE 1MV8A 3GW6A 4K35A 1SP4A 1SFCB 2G8YA 3HUSC 5EFWB 3RK3D 3S1KA 5KP8B 3WU2H 5CCHA 2UWJE 4H2WC 3AEEC 2W6JH 2PY8A 1AA0A 3M0DA 1NTMD 2E76C 2FYUE 3AE5C 3Q3DA 1RNIA 1GL2C 1KORA 1NQ4A 1YJ9P 1GU5A 1PGPA 2KOQA 4M0IA 1FR2A 2RH0A 3NFQA 2PEKA 4ASVA 1UIXA 1L0NG 2JO1A 4DCKA 4M3LA 1Q86Q 1BE3J 2OQQA 3CX5E 1UJZA 1ZXGA 4EYYQ 1RQVA 1NTMK 1PV3A 2FADA 2M0BA 2XU6A 3RK2B 3L75J 1T8KA 3EQ2A 4U3FD 2KGCA 1LTAC 1BGYD 4IZ6A 1GMJA 4NPDA 1RQUA 3DS2A 3H1HG 1NU1J 1HGZA 1VQKP 3D70A 1M74A 2K1AA 2M8RA 1BAJA 3L71D 3A0BE 3P32A 2B87B 1VQ8P 4DG9A 1H0TA 3CWBJ 4QNBA 2D2CB 2KGAA 3HUSA 1BCCG 4H0LB 1FZFA 1CZQA 3CCLP 2P2UA 2CQ8A 3CCSP 1L2PA 1VQ6P 2AXCA 2Q3IA 3GHGC 1LTJB 2QJYB 3KHUA 1HY8A 3MUDC 4O9BA 2PRRA 3CXHD 1GL2A 3M9QA 1KV4A 1VQ7P 2ZT9B 1X3OA 2ONTA 3L4FA 1GXGA 5AVWB 2LTEA 3CPWO 2JKVA 1Y47A 1S9KD 3H6PA 4UHPB 2A45I 3NY7B 5KLVK 1YTZI 4TT3H 1K73Q 1PP9E 3TNUB 2XNDH 4ZKUA 1GZLA 4MN4C 1VQNP 3LRYA 3JCUE 5KJ7C 2LMLA 2IPPA 3I56P 4H13C 5DJTB 2OYOA 2KLVA 5KLVJ 1L0LG 2ZYDA 1ZR2A 3H1LG 2N9YB 3CC2P 2LXBA 2AXTH 2QJPC 1QVGO 3ZDMA 2WZ7A 4UB6E 3UIAA 4WY4C 2WMMA 2BEQD 5AW6B 1LT9B 1NTMG 4BWNA 1M1JB 2LR2A 2WT7A 4H13D 2FFDA 3FGAD 3H0DA 3M91A 2JWDA 2CPSA 3T97B 3MUDA 1ZMBA 1RF1A 4RESB 4W7YA 3M0AA 2H8PD 3R4YA 3HE4B 4WY4D 1HH0A 3CCJP 1P84D 1FZEA 1OW7A 1CEIA 1SFCC 1JCDA 3AE2C 1EDJA 2P9XA 4IL6E 2N1TD 4U3FG 3BCCD 2H89C 2W83C 1BGYG 2HODB 3AE8C 2KGEA 1LNQA 1OMIA 2KG9A 4JQ0D 2Q3EA 2KNCB 3EJBA 1RE3C 5KJ7A 1OWAA 1VQ9P 3L71G 2PEIA 4EDFA 2JU1A 3U43A 2XV5A 4XE5B 2FYUD 3H1IE 4A7PA 5APQA 4C46A 3RK2C 4I1LA 4WY4A 1EZVG 2V7QH 4L76A 2WITA 3E1IA 4PJ0E 3G1GA 3CX5D 1HQBA 1SQVE 1MUUA 2N5HA 2FYUK 1ZNVA 1AJYA 1K30A 2ZVOB 1PEMA 1TU3F 2P7JA 3S9OA 1G1IA 3G9RA 1T2KC 4C7NA 1HWTC 3JSVC 2D2CC 1N8RQ 1SFCA 4R0MA 1GDTA 2J59M 4H0LC 2BEZF 3L72J 3S4RA 2Z44A 1LTJC 2QJYC 3O8ZA 1NTKK 2JQ4A 1EDKA 1NOHA 2ZT9C 4KHXA 1ZOYC 1Q81Q 1RO2A 3V6IA 1NTKJ 1Q90D 3QWOC 4WB4A 5F2KA 2GUVA 3B4SA 3MGNA 2KORA 2VLPA 5E79E 4N6JA 1NVOA 2LIWA 1FE6A 3LMOA 3V2NA 2ZT9D 4NPFX 2WVRA 5KLIB 3L73J 2K0DX 1Q7YQ 3G1IA 3MP7B 3TGUJ 3D71A 1PP9D 1BSNA 1LJ2A 1RHZB 1LTTC 3BCCG 2B87A 2JO0A 5KAFH 2NO8A 1LT9C 5B5EE 3PTZA 1PFIA 3DS4A 1M1JC 1U7JA 3RL0g 4DZOA 2BCCJ 2RKLA 2M8NA 2O3JA 3FXDA 3CCVP 2PEJA 1LTJA 2R5DA 3L71E 3H1JJ 2ZYAA 2GDYA 3G3ZA 5AVUB 2KOOA 4U0CA 3AE7C 5AVVB 2IBZD 2FYUG 3ABVC 1AQTA 2FACA 3HE5B 1EC5A 3L36A 1BXIA 3G26A 1SQPJ 1IUQA 3GF7A 2E74D 1MFZA 1KYOD 2FY8A 2WPVB 3TNUA 3A0HH 3KYQA 2CWOA 1IO4A 1R8EA 3KDPB 1URQD 5EW5E 3QH9A 5KAIH 1KLPA 3HYBA 2QG4A 3L74J 2QIWA 3MGEA 2LKMA 2Q5UA 1S5LE 1PZQA 1L0NK 4N3YB 2FAEA 1RF1B 1KILB 5AVYB 2EIAA 1KILE 2I1KA 2W6BA 1LT9A 1YHQP 5GTIE 2YXRB 1WRGA 1JY3P 2AFEA 1AF8A 1L0NJ 3Q5SA 1VL2A 2FVEA 3C1LA 1SVFA 4XROA 2ITAA 3U1AA 3NMDA 1M8OB 2PEOA 3T97A 3H1ID 2GZJA 2XXMA 1VQOP 3TDKA 1URQA 3HE4A 3I55P 1KD1Q 2KOPA 1T6AA 2R32A 1KB9I 1WT6A 1OZHA 1SQVD 3GZMA 1FS0E 2KG6A 3H1HJ 2JDIH 1NHLA 2HODA 4LC1A 1NTZE 3HD7D 2L0QA 2VLOA 3H32B 2Q1KA 1JY2O 2KNCA 2PAJA 5AW4B 1AUMA 4R4LA 1QLED 3AECC 2HFED 4COCA 1PP9G 1P84E 1JY2N 2P58A 2FYZA 1BCCJ 2N1TB 3VTPC 5KTBA 3IF4A 1SS1A 2FYNB 3BCCE 5BS1A 2JYGA 3NXSA 3TK1A 3A2AA 2AF8A 4PH0A 1K05A 2W90A 2W27A 3CD6P 3R2PA 3SFEC 2E5YA 5KLIC 2KS1B 4XFXA 2XZ0D 2IBZG 1U57A 1PL5A 1L0LK 1XTGB 1M6NA 1IC2A 3Q5RA 2KOGA 4UB8H 3FX0A 1S2EA 2FXOA 1W2EA 1FZGA 2KZJA 3GKLC 5AVQB 1DH3A 1J1DB 1L0LJ 3H1LJ 2PENA 1VF5D 1GPJA 3IN6A 4F37A 1PGQA 1UNKA 2JEEA 2FQ2A 1NU1D 1VQPP 3VMYA 3MIWA 1KFMA 5F2OA 1NTMJ 3IAOA 3SWYA 1EDLA 2RN0A 1FDIA 3OAKA 2WTYA 2Y0DA 5B66E 1QL1A 4DOJA
chains in the Genus database with same CATH topology
5HGLA 3CCSP 1AUMA 2Z45A 3NTEA 1VQ6P 1PEOA 3CCJP 3E2DA 1EIAA 1M6EX 3G26A 5HGNA 1IUQA 4XFYA 4COCA 1Q82Q 4U0DA 4XFZA 2P9XA 3H4EA 1JJ2O 4U0EA 4GR2A 3G29A 5I4TG 1QVFO 3OW2O 2CWOA 1Q81Q 1VQ7P 1KQSO 5BS1A 1RO2A 2JYGA 1W2BO 1KC8Q 2ONTA 1K9MQ 2M8PA 2PY8A 3DTJA 3RG6C 2KODA 1A8OA 3HYBA 5HGMA 3CPWO 2BQ1E 5F2KA 2EG5A 1YIJP 4PH0A 1RNIA 1YJWP 3G6EP 1NJIQ 1YJ9P 3P05A 1VQ9P 2OARA 3MGEA 1A43A 3CCEP 4M0IA 3CCUP 3CD6P 2PEIA 4U0AA 1K73Q 2PEKA 4U0BA 2JYLA 3M1MA 3Q20A 1K8AQ 4COPA 4U0FA 3CMAP 1Q86Q 1VQNP 1VQLP 3LRYA 4XFXA 2EIAA 1VQ5P 2DGYA 2QEXP 3CC4P 1PEUA 2LF4A 1D1DA 2M8LA 2OTJP 2PEMA 3B5IA 3I56P 3CCQP 3DPHA 5BS2A 1M6NA 4XRQA 1YHQP 1Q7YQ 3G1IA 3DS0A 3WBHA 1YITP 3CCRP 3CXCO 3CC7P 1RO0A 3CC2P 5DCKA 3G1GA 1QVGO 4XROA 2EFJA 1YI2P 1M1KQ 1QRJA 2JO0A 4WYMA 2PEOA 5F2NA 3VRLC 2PENA 5HGOA 3DS4A 2XXMA 3CMEP 1VQOP 3DS2A 1PEQA 2L6EA 2BUOA 1S72P 3HZQA 3I55P 1KD1Q 2E1MA 1K30A 1YJNP 1PEMA 1VQKP 1M74A 2M8NA 3G0VA 2Z46A 3CCVP 1BAJA 2PEJA 1VQMP 3G28A 4IPYA 2OTLP 1VQPP 3G4SP 4PH1A 3H0DA 3G21A 3DS5A 1M90Q 1VQ8P 5F2OA 1EOQA 2XV6A 1N8RQ 3G71P 3DS1A 2XT1A 3DS3A 1E6JP 1ZMBA 4GR6A 5JPAA 4QNBA 4U0CA 3H47A 3CCMP 2PEQA 3CCLP 2BHVA 2QA4P 2Z44A 1VQ4P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS P;  3CPW O;  1YHQ P;  1VQK P;  1YIJ P;  1Q7Y Q;  1VQ6 P;  3CCJ P;  1YIT P;  1YJW P;  3G6E P;  1NJI Q;  3CCR P;  3I56 P;  1YJ9 P;  3CCV P;  3CXC O;  1VQ9 P;  3CC7 P;  1VQM P;  2OTL P;  1Q82 Q;  1VQP P;  3G4S P;  3CCU P;  3CC2 P;  3CCE P;  3CD6 P;  1VQ4 P;  1K73 Q;  1QVG O;  1M90 Q;  1VQ8 P;  1JJ2 O;  1N8R Q;  1YI2 P;  1M1K Q;  3G71 P;  1K8A Q;  1QVF O;  3OW2 O;  1Q81 Q;  3CMA P;  1Q86 Q;  1VQ7 P;  1KQS O;  1VQN P;  1VQL P;  3CCM P;  1W2B O;  1VQ5 P;  2QEX P;  1S72 P;  1KC8 Q;  3CC4 P;  1VQO P;  1K9M Q;  3CME P;  3CCL P;  2OTJ P;  2QA4 P;  3CCQ P;  3I55 P;  1KD1 Q;  1YJN P; 
#chains in the Genus database with same CATH topology
 1PEO A;  1M6E X;  5HGN A;  1RF0 C;  2Z5H A;  1JMM A;  2JB0 A;  2LIU A;  1LTI C;  3HRN A;  1OFC X;  7CEI A;  1KQF B;  1LP1 B;  2KK7 A;  2H7H A;  3EJE A;  2QRX A;  2L9F A;  5HVC A;  1N7S B;  3H1I G;  3CE7 A;  2FFD C;  3VMZ A;  2JU2 A;  2KSE A;  1A8O A;  4B86 A;  2I8D A;  2CNR A;  1ZRT D;  4I6M C;  4U3F J;  3CXH H;  1LTG C;  2WSF H;  1BGY J;  2GDW A;  2P67 A;  4U0A A;  1RF1 C;  2MR7 A;  1SQV G;  1DIP A;  3MHV A;  4GDO A;  1K8A Q;  4YXW H;  1NO4 A;  2LKI A;  1E5W A;  1FJK A;  3N4X A;  1D1D A;  3L71 J;  3B5I A;  1HJ0 A;  3V2R A;  1YIT P;  1FZA A;  1AFO A;  3CCR P;  5CCG D;  4OGQ D;  3CXC O;  5CMZ A;  4OVN F;  2MJZ A;  1Z56 A;  3IFM A;  3CLQ A;  3AE1 C;  1M1K Q;  2MKV A;  2ZFC A;  1NYH A;  2GUS A;  2Q6Q A;  2P10 A;  1KIL D;  2BUO A;  1KB9 E;  1MZ8 A;  2WSF J;  3HE5 A;  2E43 A;  3F89 A;  4HKG A;  1T8Z A;  1EMV A;  1R5L A;  1ZP0 C;  3VP8 A;  2A06 E;  1RF0 A;  2Z4E A;  1CI6 A;  2OYH A;  2A45 G;  2Q7C A;  2VRS A;  1E0H A;  5HGL A;  1FC2 C;  3OA7 A;  4XA4 A;  2BAS A;  2IBZ E;  1ZLL A;  2K94 A;  2IYO A;  2N1T C;  2E74 B;  1W5C E;  2FYN C;  5AW2 B;  5TIS H;  1M7L A;  1NTZ D;  1KYO E;  5APU A;  1KIL A;  1URQ B;  1L4A D;  4QMA A;  2E75 B;  1PGJ A;  3D6Y A;  2JR8 A;  1JNM A;  1NTZ K;  1PPJ D;  1USD A;  2KGD A;  2WQY C;  2Y0C A;  2PP6 A;  2YXQ B;  2P1J A;  3DPH A;  3KPE A;  1KFN A;  2WPT A;  3DS0 A;  4GOE A;  1BDC A;  1DD3 A;  3L70 E;  1J1D C;  1SLQ A;  2EFJ A;  3AE4 C;  1EZV I;  1VKU A;  5GTH E;  1MFT A;  2MF4 A;  1FZB A;  1NAF A;  3HZQ A;  3H32 A;  3L37 A;  2E1M A;  5H2F H;  2JGP A;  3BCC J;  2VLN A;  3G4S P;  1USE A;  2R5B A;  3Q1M A;  5AW9 B;  3SWF A;  2N1T A;  1PGO A;  1ZME C;  1AVO A;  3VP9 A;  3VMX A;  1HUC A;  3HD7 B;  1SQX D;  2DNW A;  4LGD E;  2BHV A;  4GOF A;  1L0H A;  2KLU A;  1EIA A;  2KW2 A;  2O1K A;  3VN0 A;  4XFY A;  1IJD B;  1IMQ A;  1SQB D;  1GU4 A;  1N7S C;  2FYU J;  2K88 A;  2B9B A;  3H1K E;  1NGM B;  2KS1 A;  1ZW0 A;  3B8E B;  1W2B O;  4D6T E;  2QJK B;  3A0B H;  3RG6 C;  2PNG A;  1VPC A;  3PJS K;  3IR9 A;  2XNX A;  3I5C A;  5M1B A;  4HB1 A;  2Q9I A;  4U0B A;  4BPG A;  4N78 D;  2ERH A;  2K3R A;  3EJD A;  4ZKP A;  1GK6 A;  4U0F A;  1N7S D;  1VQL P;  2OGU A;  1PEU A;  2LF4 A;  3LW5 H;  2OTJ P;  3RL0 D;  1LGH B;  4XRQ A;  1BE3 E;  1LTB C;  4JYB A;  3L73 D;  1FZC A;  5CZD B;  3KZI E;  2Y9Z A;  4H2Y C;  3WMM 0;  3V5B A;  1NTZ G;  5EJD A;  2IYP A;  4I2L C;  2W8Z A;  3L75 E;  2L6E A;  1VF5 B;  2NRG A;  4IL6 X;  2M5R A;  2R3S A;  4IFM A;  3WU2 E;  2ZXE B;  1OW8 A;  2KYV A;  2L91 A;  2R44 A;  3JCU H;  4H44 D;  3WUV A;  1AYI A;  3V4W A;  3SFD C;  1NU1 E;  5AW5 B;  2QM8 A;  1PPJ G;  5BVZ A;  3AED C;  1LP1 A;  1J1E B;  1QGK B;  3CL3 D;  1FDO A;  1N7S A;  3LW5 J;  2XKM A;  1KB9 D;  2PEQ A;  3PH0 A;  1RE4 A;  3Q5P A;  2K5X A;  4PD4 H;  1FOS F;  2M3B A;  3MD0 A;  5TJH A;  4UB6 H;  3NTE A;  1Q2N A;  3E2D A;  2E74 C;  3BAT A;  1IFP A;  2PGD A;  3TYY A;  2A06 D;  2WWW A;  1XTC C;  4RKU J;  3FWL A;  1AVY A;  1JJ2 O;  5I4T G;  2YIU B;  1URQ C;  2MD9 A;  4JBZ A;  5C39 A;  1PP9 J;  3BVH A;  1IFJ A;  2BQ1 E;  3B5N B;  1CW5 A;  1RY3 A;  2O1J A;  4KJM A;  1ZRT E;  4BRY B;  3CCU P;  2CGQ A;  4MRT C;  3L74 D;  1UII A;  2K37 A;  1CI6 B;  2GYK A;  1EXJ A;  2OYH B;  2DGY A;  1SQX G;  4HH2 A;  3HTK A;  2PEM A;  4GIF A;  4W80 A;  1X0T A;  1SQQ D;  4IL6 H;  1WMK A;  1R5S A;  2E75 D;  1ACP A;  1IZN B;  1YQ4 C;  2K9Y A;  1FAV A;  4OGQ B;  1YTZ T;  2NPS D;  4C7R A;  5DCK A;  2CK3 H;  1SQB G;  3AEA C;  1DD4 A;  3NTN A;  5KLV E;  2FKW B;  2YO3 A;  5F2N A;  4I7Z B;  4JPZ B;  4R4M A;  2YNY A;  3BAS A;  2ZVN B;  3A3Y B;  5KKZ B;  3L70 D;  2CG5 B;  3P8C D;  2ROQ A;  2WPS A;  1GK4 A;  1X22 A;  4XFJ A;  3USS A;  2QVA A;  3HD7 C;  2M5A B;  3DS1 A;  1OR5 A;  2XT1 A;  3DS3 A;  4AYC A;  5JPA A;  3CCM P;  5APY A;  4PJ0 H;  2J58 A;  2JP3 A;  4BPH A;  1JY3 O;  3PHL A;  3A7O A;  2AEF A;  3L73 G;  1IFD A;  3B71 A;  1Q82 Q;  3RBZ A;  1T3U A;  4JF7 A;  5DJU B;  5APT A;  1M56 D;  3D6Z A;  4XFZ A;  1HBW A;  2IZ0 A;  3MTU E;  1JY3 N;  1LT1 A;  2QJK C;  3G29 A;  3E7K A;  2QSI A;  1AQ5 A;  1CSB A;  3RBX A;  2AXT E;  1JY2 P;  3DTJ A;  5AVR B;  1L4A B;  3KXD A;  2LL8 A;  1RH5 B;  2GZE A;  1J2J B;  1NJI Q;  4NPE A;  4YTP C;  3O6Q B;  1ZR4 A;  1NAY A;  3OJA B;  1EXI A;  2OYI B;  1DX7 A;  3H1I J;  1SQV K;  1NKZ B;  3H1K D;  2JYL A;  3M1M A;  3P8M C;  2O01 N;  2WSE H;  4PD4 I;  4D6T D;  1PPJ E;  3BRT B;  4Y99 B;  1PIX A;  3CCQ P;  4TLF A;  4L75 A;  1SQV J;  3LIE A;  5AW3 B;  4KT0 J;  1OVV A;  2A06 G;  2N6Y A;  2POH A;  1YI2 P;  3GZL A;  1KQL A;  1FJP A;  1VF5 C;  4QKO A;  3CME P;  2IX7 C;  1KTM A;  3HD7 A;  5E79 H;  1QX8 A;  1IFN A;  2ZYG A;  1IMP A;  1BE3 D;  3C8V A;  2JBG A;  3G28 A;  4NEO A;  4WBA A;  1J1E C;  4PV1 D;  3L74 G;  2MVU A;  5AW7 B;  1EOQ A;  1L0I A;  2G3A A;  2L4B A;  2WSE J;  4ZMD A;  2SPZ A;  3AE6 C;  3H47 A;  3AEB C;  3L75 D;  3E1R A;  3VYI A;  1VQ4 P;  1SQQ G;  1ZN5 A;  1S5L X;  1SQX E;  3K5B A;  1GW4 A;  5CJ4 A;  1IFM A;  2IDB A;  2XZ1 C;  1MKM A;  1DNY A;  5B5E H;  1FZC B;  3L72 E;  2YIU C;  5H2F E;  4WWI A;  1SQB E;  2IFM A;  4BPF A;  3M9B A;  4GOD A;  3B5N C;  4RO0 A;  1K9M Q;  2M8P A;  2EG5 A;  3CWB D;  2E76 D;  1H88 A;  4EOT A;  3G6E P;  2V4H A;  2H43 A;  3GG2 A;  1NU1 K;  3L70 G;  1GL2 D;  2FHS C;  1NTK E;  1NKN A;  2OYH C;  2GZG A;  1JEK A;  3Q20 A;  3M9H A;  4COP A;  2JJL A;  4N78 E;  1AV1 A;  2M8L A;  4GT1 A;  3B5N D;  5CCG C;  4OGQ C;  3RL0 B;  3WBH A;  5L8R J;  2IFN A;  1JO5 A;  1RO0 A;  1JCC A;  3PRJ A;  3L73 E;  1IK7 A;  4I7Z C;  5APX A;  1KIL C;  1QRJ A;  3TGU E;  2B89 A;  1S3J A;  2QM7 A;  5HGO A;  4OWF A;  5KKZ C;  1F80 D;  2KIK A;  1K04 A;  1S5L H;  4CA3 A;  1X8Y A;  3SWK A;  1EZV D;  3G0V A;  2I1J A;  1T3J A;  1VQM P;  2XZR A;  4BXL A;  2YMY A;  4IPY A;  1S1C X;  5KLV D;  4H44 B;  2JAZ A;  2BCC E;  3H1K G;  2XV6 A;  3GF3 A;  1BSH A;  5GTI H;  5BU8 B;  4D6T G;  4K3A A;  1KMI Z;  2Y9Y A;  3HTK B;  3H25 A;  3H1J E;  1KN7 A;  3B5N A;  2WSC H;  2J5U A;  4BRY A;  3VMA A;  1A02 J;  1N73 B;  1DEE G;  1JTH B;  1SQP E;  1HF9 A;  1L4A C;  3KQG A;  2E42 A;  3N7N A;  1BE3 G;  2YKP A;  5KAF E;  2OYI C;  2OAR A;  3CCE P;  5CCG A;  4PD4 E;  2K92 A;  1NH4 A;  2EHS A;  2Z5I A;  4Y99 C;  3L74 E;  1G2C A;  3L75 G;  2AVA A;  1P84 H;  3V2P A;  1EDI A;  5CJ0 A;  5KJ7 D;  2GDX A;  1JB0 J;  2KOS A;  3C9I A;  2FQ0 A;  2WSS H;  2YKQ A;  4HYT B;  4LLH A;  2WSC J;  1SQQ E;  5AW1 B;  1G1J A;  4RJT A;  3CC7 P;  1NWQ A;  3SSU A;  4GKG A;  3MZW B;  2GA1 A;  1NU1 G;  3AEG C;  2NPS B;  3GHG A;  1X79 B;  2PFX A;  1X9V A;  1L0N E;  4AQR D;  2M5A A;  3VRL C;  4Y28 J;  3A0H E;  3II6 A;  3CWB G;  2QNW A;  1NTZ J;  2KP8 A;  2OTL P;  1IK9 A;  3U1C A;  5KAI E;  2KUB A;  3P8C E;  4OH8 B;  5AVZ B;  2AFD A;  2HPC B;  5AVS B;  2KI7 B;  5KP7 B;  3CXH I;  1Y9B A;  5AVX B;  4PXH B;  4YXD C;  1L4A A;  2K9J B;  3H1H E;  1FZC C;  1GD2 E;  1LWU B;  1GW3 A;  2FXP A;  3BRV B;  3CX5 H;  2MVV A;  3O6Q A;  2VSQ A;  1SFC D;  3H4E A;  2OYI A;  5CBO A;  4U0E A;  3F5H A;  4GR2 A;  1QVF O;  3OW2 O;  2FXM A;  3RGU A;  2AEM A;  2KXP B;  1N86 A;  3P7K A;  1BCC E;  2L5G B;  3EFG A;  1YIJ P;  1Y8A A;  3FWN A;  3L72 D;  2LXC B;  5KLV G;  5AW8 B;  1JMB A;  2N5I A;  5B66 H;  5K5G B;  5KP6 B;  3TSI A;  1RE4 C;  2R3C A;  1SQX K;  3CC4 P;  3RL0 C;  1KQG B;  4WVZ A;  5BS2 A;  3A5T A;  3RK2 D;  2KZI A;  1HGV A;  1S4X A;  1NTK D;  1SQB K;  2GM4 A;  1D7M A;  4EI2 A;  1SQX J;  2B88 A;  1OXZ A;  3AEF C;  1JM0 A;  1H89 A;  2KB7 P;  1OVU A;  1SQB J;  2K93 A;  2V7Q J;  1RE3 A;  1L0L E;  3W68 A;  3H1L E;  4H44 C;  4W7Z A;  2K0X A;  2VLQ A;  3G21 A;  3DS5 A;  5APS A;  3TGU D;  1P84 I;  4PV1 B;  1T2K D;  3G71 P;  1OX3 A;  3RK3 B;  4GR6 A;  2D2C D;  1IFI A;  2N50 A;  3RK3 E;  4H0L D;  2YO2 A;  1A02 F;  4U7J A;  1QEX A;  4EIJ A;  1HVV A;  2LPK A;  1NTM E;  2FVA A;  1MZ9 A;  1HTL C;  3ITK A;  2C9L Y;  5HV8 A;  4U0D A;  2BCC D;  4L73 A;  1N73 C;  3TF5 A;  1KB9 H;  1H0T B;  1KQS O;  3HUS B;  2WPR A;  4UB8 E;  3WUU A;  3H1J D;  4ASW A;  5HGM A;  2N9B A;  3JC2 2;  1YJW P;  2E76 B;  3CWB E;  1A43 A;  1GL2 B;  3AE9 C;  1LTS C;  3AE3 C;  1JUN A;  3EWK A;  2NZ2 A;  1DV5 A;  3RG2 A;  1SQP D;  4U3F E;  4H2X C;  4HKZ H;  1BGY E;  3PLN A;  2QEX P;  2MR8 A;  2E75 C;  4Z1M H;  1JOC A;  2AEJ A;  3CX5 I;  2ZXX A;  3U59 A;  1YQ3 C;  2LOL A;  2NPS C;  1KYO H;  4PD4 D;  1YBK A;  4DT0 A;  4CPG A;  1SQP K;  2YMK A;  2HYN A;  2FBW C;  1HJB A;  3PP5 A;  2O01 H;  2E5T A;  4JYC A;  1KZU B;  2ZAE B;  2C0W A;  4IFD K;  1Z6M A;  2HLO A;  4L74 A;  1S72 P;  5CBN A;  1ZV8 A;  1U7M A;  1M57 D;  3L72 G;  1OIP A;  1EZV E;  2KSJ A;  2EHT A;  1GTW A;  1H8A A;  1N2D C;  1BDD A;  2M3E A;  3GLM A;  3GJN A;  1YYC A;  1L0N D;  3CXH E;  1G2C B;  1N73 A;  1JTH A;  1E79 H;  2H88 C;  1SQQ K;  2QA4 P;  1LWU C;  4HJG H;  2WT7 B;  2IZ1 A;  2FFD B;  2W6A A;  2HR3 A;  2DW3 A;  1S9K E;  5GTH H;  1NTK G;  3Q2Y A;  5AVT B;  3GHG B;  2C0X A;  2QE7 H;  3LID A;  1SQQ J;  2C9N Y;  2O01 J;  3EFF K;  3L35 A;  2JWA A;  1KC8 Q;  3CI9 A;  2X2B A;  4DJG A;  2KOD A;  2GZF A;  3H1H D;  2K0Y A;  2N6Z A;  1DEB A;  1FU1 A;  1FOS E;  3VOP A;  1M1J A;  2KR5 A;  3P05 A;  3B4Q A;  5BU5 A;  1OVR A;  2OTK E;  5CCH C;  2NPS A;  3V2Q A;  5APV A;  2FQ1 A;  5APW A;  3TGU G;  1FDM A;  3M0D C;  3GMA A;  3CMA P;  2KG8 A;  3W67 A;  4YPC A;  1VQ5 P;  1BCC D;  4AUW A;  3L70 J;  1VDF A;  2RMZ A;  1N7L A;  1GXH A;  4H13 B;  3WUT A;  2GZI A;  2L22 A;  2BCC G;  4IFF A;  4PWV B;  3FXE A;  2QJP B;  2HG5 D;  5CCH D;  2K2Q A;  4WYM A;  1OW6 A;  4IOI H;  2HPC A;  1PEQ A;  3H1J G;  2MY5 A;  5TIS E;  1YJN P;  3M06 A;  4WY4 B;  2Z46 A;  2K9J A;  1LWU A;  2IBZ I;  2WPQ A;  4PV1 C;  4PH1 A;  3RK3 C;  2N98 A;  1QL2 A;  2FVF A;  1M90 Q;  2XDJ A;  2A45 H;  1SQP G;  1E6J P;  1FBM A;  2Y0E A;  2CPB A;  4ZNC A;  1KYO I;  5CHX A;  1EQ7 A;  3KZI H;  1L0L D;  3V4Q A;  2Z45 A;  5AW0 B;  3H1L D;  3H1K J;  2KWL A;  2YKO A;  4D6T J;  4C7N B;  1VHN A;  2ZJS E;  1MV8 A;  3GW6 A;  4K35 A;  1SP4 A;  1SFC B;  2G8Y A;  3HUS C;  5EFW B;  3RK3 D;  3S1K A;  5KP8 B;  3WU2 H;  5CCH A;  2UWJ E;  4H2W C;  3AEE C;  2W6J H;  2PY8 A;  1AA0 A;  3M0D A;  1NTM D;  2E76 C;  2FYU E;  3AE5 C;  3Q3D A;  1RNI A;  1GL2 C;  1KOR A;  1NQ4 A;  1YJ9 P;  1GU5 A;  1PGP A;  2KOQ A;  4M0I A;  1FR2 A;  2RH0 A;  3NFQ A;  2PEK A;  4ASV A;  1UIX A;  1L0N G;  2JO1 A;  4DCK A;  4M3L A;  1Q86 Q;  1BE3 J;  2OQQ A;  3CX5 E;  1UJZ A;  1ZXG A;  4EYY Q;  1RQV A;  1NTM K;  1PV3 A;  2FAD A;  2M0B A;  2XU6 A;  3RK2 B;  3L75 J;  1T8K A;  3EQ2 A;  4U3F D;  2KGC A;  1LTA C;  1BGY D;  4IZ6 A;  1GMJ A;  4NPD A;  1RQU A;  3DS2 A;  3H1H G;  1NU1 J;  1HGZ A;  1VQK P;  3D70 A;  1M74 A;  2K1A A;  2M8R A;  1BAJ A;  3L71 D;  3A0B E;  3P32 A;  2B87 B;  1VQ8 P;  4DG9 A;  1H0T A;  3CWB J;  4QNB A;  2D2C B;  2KGA A;  3HUS A;  1BCC G;  4H0L B;  1FZF A;  1CZQ A;  3CCL P;  2P2U A;  2CQ8 A;  3CCS P;  1L2P A;  1VQ6 P;  2AXC A;  2Q3I A;  3GHG C;  1LTJ B;  2QJY B;  3KHU A;  1HY8 A;  3MUD C;  4O9B A;  2PRR A;  3CXH D;  1GL2 A;  3M9Q A;  1KV4 A;  1VQ7 P;  2ZT9 B;  1X3O A;  2ONT A;  3L4F A;  1GXG A;  5AVW B;  2LTE A;  3CPW O;  2JKV A;  1Y47 A;  1S9K D;  3H6P A;  4UHP B;  2A45 I;  3NY7 B;  5KLV K;  1YTZ I;  4TT3 H;  1K73 Q;  1PP9 E;  3TNU B;  2XND H;  4ZKU A;  1GZL A;  4MN4 C;  1VQN P;  3LRY A;  3JCU E;  5KJ7 C;  2LML A;  2IPP A;  3I56 P;  4H13 C;  5DJT B;  2OYO A;  2KLV A;  5KLV J;  1L0L G;  2ZYD A;  1ZR2 A;  3H1L G;  2N9Y B;  3CC2 P;  2LXB A;  2AXT H;  2QJP C;  1QVG O;  3ZDM A;  2WZ7 A;  4UB6 E;  3UIA A;  4WY4 C;  2WMM A;  2BEQ D;  5AW6 B;  1LT9 B;  1NTM G;  4BWN A;  1M1J B;  2LR2 A;  2WT7 A;  4H13 D;  2FFD A;  3FGA D;  3H0D A;  3M91 A;  2JWD A;  2CPS A;  3T97 B;  3MUD A;  1ZMB A;  1RF1 A;  4RES B;  4W7Y A;  3M0A A;  2H8P D;  3R4Y A;  3HE4 B;  4WY4 D;  1HH0 A;  3CCJ P;  1P84 D;  1FZE A;  1OW7 A;  1CEI A;  1SFC C;  1JCD A;  3AE2 C;  1EDJ A;  2P9X A;  4IL6 E;  2N1T D;  4U3F G;  3BCC D;  2H89 C;  2W83 C;  1BGY G;  2HOD B;  3AE8 C;  2KGE A;  1LNQ A;  1OMI A;  2KG9 A;  4JQ0 D;  2Q3E A;  2KNC B;  3EJB A;  1RE3 C;  5KJ7 A;  1OWA A;  1VQ9 P;  3L71 G;  2PEI A;  4EDF A;  2JU1 A;  3U43 A;  2XV5 A;  4XE5 B;  2FYU D;  3H1I E;  4A7P A;  5APQ A;  4C46 A;  3RK2 C;  4I1L A;  4WY4 A;  1EZV G;  2V7Q H;  4L76 A;  2WIT A;  3E1I A;  4PJ0 E;  3G1G A;  3CX5 D;  1HQB A;  1SQV E;  1MUU A;  2N5H A;  2FYU K;  1ZNV A;  1AJY A;  1K30 A;  2ZVO B;  1PEM A;  1TU3 F;  2P7J A;  3S9O A;  1G1I A;  3G9R A;  1T2K C;  4C7N A;  1HWT C;  3JSV C;  2D2C C;  1N8R Q;  1SFC A;  4R0M A;  1GDT A;  2J59 M;  4H0L C;  2BEZ F;  3L72 J;  3S4R A;  2Z44 A;  1LTJ C;  2QJY C;  3O8Z A;  1NTK K;  2JQ4 A;  1EDK A;  1NOH A;  2ZT9 C;  4KHX A;  1ZOY C;  1Q81 Q;  1RO2 A;  3V6I A;  1NTK J;  1Q90 D;  3QWO C;  4WB4 A;  5F2K A;  2GUV A;  3B4S A;  3MGN A;  2KOR A;  2VLP A;  5E79 E;  4N6J A;  1NVO A;  2LIW A;  1FE6 A;  3LMO A;  3V2N A;  2ZT9 D;  4NPF X;  2WVR A;  5KLI B;  3L73 J;  2K0D X;  1Q7Y Q;  3G1I A;  3MP7 B;  3TGU J;  3D71 A;  1PP9 D;  1BSN A;  1LJ2 A;  1RHZ B;  1LTT C;  3BCC G;  2B87 A;  2JO0 A;  5KAF H;  2NO8 A;  1LT9 C;  5B5E E;  3PTZ A;  1PFI A;  3DS4 A;  1M1J C;  1U7J A;  3RL0 g;  4DZO A;  2BCC J;  2RKL A;  2M8N A;  2O3J A;  3FXD A;  3CCV P;  2PEJ A;  1LTJ A;  2R5D A;  3L71 E;  3H1J J;  2ZYA A;  2GDY A;  3G3Z A;  5AVU B;  2KOO A;  4U0C A;  3AE7 C;  5AVV B;  2IBZ D;  2FYU G;  3ABV C;  1AQT A;  2FAC A;  3HE5 B;  1EC5 A;  3L36 A;  1BXI A;  3G26 A;  1SQP J;  1IUQ A;  3GF7 A;  2E74 D;  1MFZ A;  1KYO D;  2FY8 A;  2WPV B;  3TNU A;  3A0H H;  3KYQ A;  2CWO A;  1IO4 A;  1R8E A;  3KDP B;  1URQ D;  5EW5 E;  3QH9 A;  5KAI H;  1KLP A;  3HYB A;  2QG4 A;  3L74 J;  2QIW A;  3MGE A;  2LKM A;  2Q5U A;  1S5L E;  1PZQ A;  1L0N K;  4N3Y B;  2FAE A;  1RF1 B;  1KIL B;  5AVY B;  2EIA A;  1KIL E;  2I1K A;  2W6B A;  1LT9 A;  1YHQ P;  5GTI E;  2YXR B;  1WRG A;  1JY3 P;  2AFE A;  1AF8 A;  1L0N J;  3Q5S A;  1VL2 A;  2FVE A;  3C1L A;  1SVF A;  4XRO A;  2ITA A;  3U1A A;  3NMD A;  1M8O B;  2PEO A;  3T97 A;  3H1I D;  2GZJ A;  2XXM A;  1VQO P;  3TDK A;  1URQ A;  3HE4 A;  3I55 P;  1KD1 Q;  2KOP A;  1T6A A;  2R32 A;  1KB9 I;  1WT6 A;  1OZH A;  1SQV D;  3GZM A;  1FS0 E;  2KG6 A;  3H1H J;  2JDI H;  1NHL A;  2HOD A;  4LC1 A;  1NTZ E;  3HD7 D;  2L0Q A;  2VLO A;  3H32 B;  2Q1K A;  1JY2 O;  2KNC A;  2PAJ A;  5AW4 B;  1AUM A;  4R4L A;  1QLE D;  3AEC C;  2HFE D;  4COC A;  1PP9 G;  1P84 E;  1JY2 N;  2P58 A;  2FYZ A;  1BCC J;  2N1T B;  3VTP C;  5KTB A;  3IF4 A;  1SS1 A;  2FYN B;  3BCC E;  5BS1 A;  2JYG A;  3NXS A;  3TK1 A;  3A2A A;  2AF8 A;  4PH0 A;  1K05 A;  2W90 A;  2W27 A;  3CD6 P;  3R2P A;  3SFE C;  2E5Y A;  5KLI C;  2KS1 B;  4XFX A;  2XZ0 D;  2IBZ G;  1U57 A;  1PL5 A;  1L0L K;  1XTG B;  1M6N A;  1IC2 A;  3Q5R A;  2KOG A;  4UB8 H;  3FX0 A;  1S2E A;  2FXO A;  1W2E A;  1FZG A;  2KZJ A;  3GKL C;  5AVQ B;  1DH3 A;  1J1D B;  1L0L J;  3H1L J;  2PEN A;  1VF5 D;  1GPJ A;  3IN6 A;  4F37 A;  1PGQ A;  1UNK A;  2JEE A;  2FQ2 A;  1NU1 D;  1VQP P;  3VMY A;  3MIW A;  1KFM A;  5F2O A;  1NTM J;  3IAO A;  3SWY A;  1EDL A;  2RN0 A;  1FDI A;  3OAK A;  2WTY A;  2Y0D A;  5B66 E;  1QL1 A;  4DOJ A; 
#chains in the Genus database with same CATH homology
 5HGL A;  3CCS P;  1AUM A;  2Z45 A;  3NTE A;  1VQ6 P;  1PEO A;  3CCJ P;  3E2D A;  1EIA A;  1M6E X;  3G26 A;  5HGN A;  1IUQ A;  4XFY A;  4COC A;  1Q82 Q;  4U0D A;  4XFZ A;  2P9X A;  3H4E A;  1JJ2 O;  4U0E A;  4GR2 A;  3G29 A;  5I4T G;  1QVF O;  3OW2 O;  2CWO A;  1Q81 Q;  1VQ7 P;  1KQS O;  5BS1 A;  1RO2 A;  2JYG A;  1W2B O;  1KC8 Q;  2ONT A;  1K9M Q;  2M8P A;  2PY8 A;  3DTJ A;  3RG6 C;  2KOD A;  1A8O A;  3HYB A;  5HGM A;  3CPW O;  2BQ1 E;  5F2K A;  2EG5 A;  1YIJ P;  4PH0 A;  1RNI A;  1YJW P;  3G6E P;  1NJI Q;  1YJ9 P;  3P05 A;  1VQ9 P;  2OAR A;  3MGE A;  1A43 A;  3CCE P;  4M0I A;  3CCU P;  3CD6 P;  2PEI A;  4U0A A;  1K73 Q;  2PEK A;  4U0B A;  2JYL A;  3M1M A;  3Q20 A;  1K8A Q;  4COP A;  4U0F A;  3CMA P;  1Q86 Q;  1VQN P;  1VQL P;  3LRY A;  4XFX A;  2EIA A;  1VQ5 P;  2DGY A;  2QEX P;  3CC4 P;  1PEU A;  2LF4 A;  1D1D A;  2M8L A;  2OTJ P;  2PEM A;  3B5I A;  3I56 P;  3CCQ P;  3DPH A;  5BS2 A;  1M6N A;  4XRQ A;  1YHQ P;  1Q7Y Q;  3G1I A;  3DS0 A;  3WBH A;  1YIT P;  3CCR P;  3CXC O;  3CC7 P;  1RO0 A;  3CC2 P;  5DCK A;  3G1G A;  1QVG O;  4XRO A;  2EFJ A;  1YI2 P;  1M1K Q;  1QRJ A;  2JO0 A;  4WYM A;  2PEO A;  5F2N A;  3VRL C;  2PEN A;  5HGO A;  3DS4 A;  2XXM A;  3CME P;  1VQO P;  3DS2 A;  1PEQ A;  2L6E A;  2BUO A;  1S72 P;  3HZQ A;  3I55 P;  1KD1 Q;  2E1M A;  1K30 A;  1YJN P;  1PEM A;  1VQK P;  1M74 A;  2M8N A;  3G0V A;  2Z46 A;  3CCV P;  1BAJ A;  2PEJ A;  1VQM P;  3G28 A;  4IPY A;  2OTL P;  1VQP P;  3G4S P;  4PH1 A;  3H0D A;  3G21 A;  3DS5 A;  1M90 Q;  1VQ8 P;  5F2O A;  1EOQ A;  2XV6 A;  1N8R Q;  3G71 P;  3DS1 A;  2XT1 A;  3DS3 A;  1E6J P;  1ZMB A;  4GR6 A;  5JPA A;  4QNB A;  4U0C A;  3H47 A;  3CCM P;  2PEQ A;  3CCL P;  2BHV A;  2QA4 P;  2Z44 A;  1VQ4 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...