1K9MQ

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1k9mQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1k9mQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1k9mQ03
3CCVP 1KC8Q 1NJIQ 2OTLP 3CCQP 1YJWP 1VQOP 3CCJP 1VQ9P 1VQNP 3G4SP 1K73Q 3CPWO 1M1KQ 3G6EP 2QA4P 1YJ9P 1Q7YQ 1VQLP 3CCUP 3CCEP 3CC2P 3CCLP 3G71P 1Q81Q 2QEXP 3CXCO 1YIJP 1VQ5P 2OTJP 1KD1Q 3CCRP 1K9MQ 1VQ4P 1QVGO 3I56P 3OW2O 1VQ6P 1VQMP 3CC4P 1QVFO 1JJ2O 1YI2P 1YJNP 1VQ8P 1N8RQ 3CCMP 1K8AQ 3CC7P 1VQKP 3CMAP 1VQPP 1YHQP 1Q86Q 1KQSO 3CMEP 3CCSP 1M90Q 1VQ7P 1YITP 3I55P 1Q82Q 3CD6P 1W2BO 1S72P
chains in the Genus database with same CATH superfamily
5KJ7C 4PD4E 3D71A 3G28A 5AW8B 1NKZB 1W5CE 3DS1A 4N3YB 1FZAA 3B8EB 1PGQA 3A0BE 2WT7B 3V4WA 3LIEA 3VMAA 3JSVC 2WSCH 3L72E 3KZIE 1HQBA 3RK3C 1KILC 1YYCA 2K9YA 1EQ7A 2FYUK 3KXDA 2E74B 1L4AB 5KAIE 1BE3J 4WYMA 4WB4A 4U0AA 5AVUB 1SQPG 5M1BA 2W27A 3H1HG 5APSA 2P7JA 2JWAA 2A06E 4NPFX 1QLED 1ZMEC 3N7NA 3H1HE 1OW7A 2B87B 2MR7A 5KAFH 3L74D 4ZKUA 5TISH 4IL6H 3MGNA 2AXTH 3G0VA 1H88A 3SWFA 1HF9A 1L0NJ 3CWBJ 3H1JD 2Y9ZA 2ZYAA 3Q5SA 4H44B 1WT6A 2YO2A 3CL3D 1NOHA 1L4AA 3P8CE 1N73C 3HE4A 1HTLC 1VQ4P 4LC1A 2KSEA 2W6AA 2VRSA 1H89A 5AW0B 2K9JB 1LWUC 4OGQC 4BPGA 1EZVD 1RH5B 1LTTC 2RH0A 1Q2NA 2QJPB 3B5NA 3NXSA 3V2NA 1BCCJ 3OJAB 1PP9E 3SFDC 2D2CB 1P84H 1QL1A 1L0HA 2OYHC 2KP8A 3B5NC 2GZIA 2ZVNB 2BASA 3B4QA 4I7ZC 5AW4B 2JGPA 3Q5PA 2P58A 1DD4A 4UB6E 3AEBC 4WWIA 1EDIA 2KGDA 5B5EE 2E5YA 1PGOA 5KP6B 1SQVE 2V7QH 2B9BA 2E75D 2MVUA 2YXQB 2G3AA 1N73A 1L4AC 2AXTE 3D70A 2KUBA 1OMIA 1Q81Q 2M3BA 2BUOA 2JU2A 3AE9C 5CHXA 3CWBE 5HV8A 3DPHA 2L6EA 3E2DA 3G9RA 1S5LE 5APXA 2IFNA 3L71J 2QSIA 4PWVB 3I55P 1QRJA 3HE5B 1OVRA 1EIAA 2YKQA 2AFEA 1AV1A 3HYBA 3EJBA 2K94A 2JP3A 1NH4A 4RJTA 1IFJA 1BSNA 4GODA 1P84I 2PEKA 4YPCA 5KP7B 1GW4A 1WRGA 4GKGA 1GD2E 1PEOA 1VQPP 1IFNA 3BRTB 1IJDB 1BXIA 3H1HJ 2FY8A 4HKZH 1BE3E 1UNKA 3RK2D 2ZYGA 2XZ0D 4CPGA 1BGYG 3W67A 3TGUG 1NWQA 1SQVK 5APVA 1SS1A 2C0WA 1T6AA 1UIIA 1SQPD 1FZEA 1E0HA 2LIWA 1FDOA 1GZLA 1S4XA 1IFPA 1FOSF 1KB9D 3G1GA 2LXBA 1IUQA 2MD9A 2CQ8A 2FXPA 1NTMD 2LKMA 4COPA 3G3ZA 3CCJP 1N7SD 1L0LD 3JCUE 2JQ4A 1KFNA 5EFWB 4W7YA 5GTIH 4H0LC 3E7KA 4WY4D 5B5EH 4EI2A 2L5GB 1OWAA 2FFDC 1ZN5A 4H2WC 1RY3A 3EJDA 3GHGB 4U0FA 4GR2A 3QH9A 1VPCA 2IFMA 3HRNA 1IFDA 1FZCB 1JO5A 3LW5H 2H89C 3GW6A 2N1TC 4GR6A 3L36A 4R0MA 1NU1K 3TF5A 1OW6A 3VOPA 1RO0A 4U0EA 2Q1KA 1OXZA 3USSA 4U0BA 3CXHD 4H2XC 3AE2C 2PGDA 1S5LX 2XKMA 3PP5A 2KWLA 4D6TJ 3WUVA 1FZCA 3DTJA 3GHGC 2JEEA 2N98A 2CGQA 1EZVE 1IFIA 1JY2P 1YJ9P 2FADA 2Y0EA 3MUDC 3CC2P 2PAJA 5KLVE 1NTKK 1YIJP 1S5LH 3L4FA 2WZ7A 1LTAC 1M1JC 2QJYC 1PEUA 5AVSB 1LGHB 1QX8A 2XZ1C 2EIAA 2FXOA 3JCUH 4MN4C 4PV1B 3U59A 2JB0A 5F2OA 7CEIA 3T97B 4Y28J 1M1JA 2Z4EA 1SQPK 2MY5A 3AEDC 4WY4B 2N50A 3M0DC 1PFIA 2QE7H 3RK2C 4LGDE 1RF1C 2WPTA 2P10A 1N7SC 1K8AQ 3CD6P 5E79H 2M5RA 3L71G 4UB6H 1JMBA 2LF4A 2BHVA 3EFGA 5CCHC 4OWFA 2KZJA 1MV8A 1S9KE 2M8NA 1NTKE 2K37A 1NTZG 3FWNA 5CBOA 4F37A 4B86A 1BE3G 1SQBG 3CI9A 2A45I 1LTIC 3V2QA 3M1MA 2Z44A 5HGLA 2KB7P 2HG5D 2HR3A 1KD1Q 1M6EX 1M74A 2HPCA 1SP4A 1FZBA 3CXHH 2MVVA 3L74J 1X3OA 3Q2YA 2O01H 1KQSO 5B66H 1VDFA 3WUUA 2P2UA 4ZMDA 3CCVP 2H7HA 2ZJSE 5AVQB 2PY8A 2PEIA 2KGCA 1T2KD 3L70G 3CCUP 2A06D 1L0LG 3H1IJ 2Q6QA 4JYBA 4BRYA 1AF8A 5AVYB 4PD4D 3L74E 3WUTA 3H1KE 2E76D 5E79E 1AFOA 1GXGA 1LT9C 3CCQP 2CG5B 1R5LA 1VQNP 2KNCB 3H1KG 1MKMA 2KZIA 4EIJA 4RO0A 5HGNA 1A43A 1JMMA 4IFDK 4DOJA 5AVVB 2FHSC 3O6QB 3G1IA 5KLVK 2BCCE 1EDLA 2E1MA 5BU5A 4H2YC 4U3FE 3VN0A 4JBZA 3CPWO 1GMJA 1VF5D 1Y8AA 3TGUE 1T8KA 3MP7B 1Z56A 1KYOD 1RF1A 5GTHE 3RK3B 1A8OA 3M0DA 1PGJA 1DV5A 4AYCA 1S9KD 1NTKG 1USEA 2W8ZA 2N5IA 5H2FE 1S2EA 1LJ2A 3PHLA 5AVXB 2DNWA 4M0IA 3H25A 4I1LA 2A45H 2WPVB 3L73J 4I7ZB 1EZVI 2JDIH 1URQB 1NTZE 2YO3A 1SQXE 2C9NY 1DEBA 1GTWA 3T97A 1IK7A 2MF4A 4BPHA 3AECC 1N86A 1VQ7P 1SQBD 1EZVG 3GF3A 3D6YA 1FJPA 3M9QA 4WY4A 4D6TG 2GA1A 4DZOA 1NTMK 3R4YA 2LPKA 2WSFJ 3S4RA 5TJHA 2N1TD 2JU1A 2NRGA 3A0HE 3VTPC 1NVOA 3IF4A 2K0YA 2Q7CA 1QVGO 2OYIC 5KAFE 2O3JA 1AVOA 1M1JB 4RKUJ 2E74C 1D7MA 2KLUA 3L70E 3DS5A 2QRXA 1RNIA 3L72J 2A06G 4JYCA 1HGVA 2E42A 3NFQA 3K5BA 2IDBA 3I5CA 3L75D 2YXRB 2ZAEB 4I2LC 4JF7A 3VRLC 5KLIC 4WBAA 2QIWA 4TT3H 1RHZB 1KLPA 2OYHA 3E1IA 3EWKA 5AW5B 3GZLA 2UWJE 2AVAA 3A7OA 2BCCD 2P9XA 2W83C 4PD4H 2JBGA 3AE5C 3CX5E 3H47A 2Y0DA 5HVCA 1HJBA 2HFED 4U0CA 1CZQA 2K0DX 3DS4A 1M57D 1LTSC 2ITAA 3H6PA 1RE3C 3D6ZA 1ZMBA 1L0NE 3KDPB 2FFDA 3OAKA 1GK4A 5B66E 2OYIB 1YHQP 2EG5A 1P84D 1ZRTE 2DW3A 1NTZJ 5APWA 2KOPA 1KZUB 2KR5A 3Q5RA 1EXIA 2BEZF 2FYZA 3KHUA 2MKVA 3B5IA 3VMXA 4NEOA 2K0XA 4KHXA 2HODB 1KB9I 2XNDH 2WPSA 2B87A 1OFCX 1Q86Q 1L4AD 4PJ0E 4COCA 3V6IA 3Q20A 2ZT9D 1RQUA 3FXDA 1NU1D 3KPEA 2FQ2A 2H88C 1NQ4A 2LOLA 2WMMA 4C7RA 4WY4C 1HUCA 2XV6A 1BGYD 1NGMB 1FZFA 2OARA 1PEQA 1S72P 5APTA 1SQQK 4D6TD 1RO2A 1PPJD 1VQOP 2HLOA 3HUSC 2L4BA 2K92A 2VLQA 1M7LA 4RESB 4XA4A 3RG2A 1HJ0A 1EDKA 1JY3N 3V4QA 3H1KJ 2EHSA 3H1LJ 3L73G 3HTKB 4AUWA 4OVNF 2CWOA 2XDJA 2KOOA 4HH2A 2JKVA 1KC8Q 1NJIQ 2OTKE 2QJKC 3AE6C 1X9VA 1H0TA 2K5XA 2WVRA 3WU2E 3G6EP 3A0BH 4EDFA 3ABVC 3CXHE 1PP9D 4JQ0D 4CA3A 1QGKB 2QJYB 2IPPA 3IFMA 2CNRA 1EXJA 2H43A 3VYIA 4C7NA 2NPSB 1FDMA 2IYOA 1ZNVA 2IBZD 1XTCC 2FYNB 2W6JH 2CPSA 3BCCG 3IN6A 2KYVA 1SQQE 1E5WA 1UIXA 4GOFA 2N6ZA 1SFCC 5DJUB 5KTBA 2GZEA 3AEFC 1YQ4C 3II6A 2WPQA 4OGQD 1EMVA 2POHA 2FQ0A 4XE5B 1GPJA 2FACA 1VQ9P 3CWBD 1Y47A 3TSIA 4ZKPA 1UJZA 2Z46A 1KQLA 2E76B 3JC22 2LKIA 2KSJA 1U7JA 5TISE 4UHPB 2R5DA 1BGYE 1T3JA 2QNWA 1DH3A 2WWWA 3LMOA 1AQTA 5CJ0A 3VMZA 2E43A 1U57A 2QM8A 3CC4P 4IL6E 3AEGC 1VQKP 3TDKA 4ZNCA 3OA7A 2R44A 2J58A 1LTGC 2QJPC 4QKOA 1OW8A 2GZFA 1GL2B 4MRTC 2FQ1A 1KB9H 3L73D 3AE3C 3KZIH 1RE3A 1JCDA 1BDDA 1GU4A 1N7SA 4PJ0H 4Y99C 2Q5UA 4XFYA 3CCSP 4IZ6A 3Q3DA 3TNUB 3L71D 2GM4A 1T2KC 2GZJA 2FYUJ 2CK3H 2GUVA 1X8YA 5KKZB 1G1IA 2KG8A 1CW5A 2YIUB 4H44C 3B4SA 1QL2A 1JUNA 5AVWB 2D2CC 1PL5A 2GDXA 1KORA 3CLQA 3GF7A 3SWKA 1GXHA 1JB0J 3RL0D 1AUMA 3H1LG 4PD4I 2IBZG 4DG9A 2AEFA 1HBWA 5F2NA 5CCGA 2KOGA 3NMDA 2AXCA 3GHGA 2FFDB 3AEEC 2OYIA 1AA0A 2FKWB 1L0NK 2X2BA 4YXDC 1JEKA 2K3RA 4UB8E 2L9FA 1J1DB 1ZXGA 2YMKA 2JR8A 3W68A 4IFMA 3CX5H 4EYYQ 4HYTB 1NTKJ 1ZRTD 1K30A 1SQXJ 2NPSA 3L74G 3AE7C 3HD7C 4HJGH 1N2DC 4H13D 1SFCD 3PRJA 2LR2A 1IFMA 3H1JJ 2H8PD 1HGZA 3B5NB 5APYA 2LMLA 2N1TA 3CMEP 1J1EB 3H1JG 2JO0A 1KYOE 2KS1B 3PTZA 2J59M 1L0NG 2SPZA 1Z6MA 3HUSA 1ZR4A 3VP8A 2L0QA 5JPAA 3P7KA 2KNCA 2W6BA 1HH0A 1SQXD 4QMAA 1BE3D 1TU3F 4N6JA 3VP9A 1HVVA 2XNXA 1SLQA 4H44D 2N5HA 1SQBE 4BXLA 2VLOA 1OR5A 1VL2A 2XT1A 2E74D 2R3SA 5AVZB 5CZDB 3U43A 3S9OA 3F89A 3DS2A 2RN0A 3CCMP 1NAFA 1URQA 1L0LK 2I8DA 3AE1C 3GMAA 1MFZA 2B89A 1RF1B 3L70D 3G71P 1XTGB 1CSBA 1FE6A 4C7NB 2JYGA 3RL0C 4GDOA 1R5SA 2JYLA 4M3LA 2PENA 1RF0C 2FVAA 1KYOH 1OX3A 2Y9YA 1FAVA 3IR9A 3KYQA 2NZ2A 3IAOA 2IBZI 3CX5D 4ASWA 2OYHB 2QM7A 1FJKA 2EFJA 2QG4A 1GK6A 4KJMA 3NTNA 3H32A 3HD7B 5KP8B 2PEQA 5BVZA 3NTEA 2KORA 2M8LA 3V2PA 1FOSE 3L75G 1DX7A 3CCRP 5KLVJ 2FYNC 2ZT9C 1ZV8A 3KQGA 1QVFO 2O01J 1YTZI 4DJGA 1LT9B 3UIAA 4AQRD 2WQYC 2BEQD 4C46A 3H1LD 4L73A 1BAJA 2LIUA 2IX7C 2YKPA 3U1AA 1G1JA 1IC2A 4XROA 1KFMA 2M5AB 2Q3EA 1GU5A 2KLVA 3H1KD 1SQXG 1DEEG 3WBHA 1YBKA 5AW1B 1H8AA 1LTJB 3WU2H 1BGYJ 2QJKB 3H1IE 1PEMA 2XXMA 3AE4C 3WMM0 2ONTA 3DS0A 3V2RA 1KILA 1SQBK 2ERHA 1JNMA 2KG9A 3MUDA 2OYOA 1NTMG 2IYPA 1N8RQ 1NU1E 5AW9B 3MTUE 1NTMJ 2IZ0A 2HODA 2ZFCA 1RF0A 1KYOI 1SQVJ 1CI6A 1VHNA 3RL0g 3HTKA 1SQQG 2PRRA 5CMZA 1SQVG 5DJTB 2P67A 2Q9IA 1JY2N 5I4TG 1LWUA 2AEMA 1YTZT 1JJ2O 2KS1A 1CEIA 3MZWB 1H0TB 1GL2A 2FVFA 2R5BA 1SVFA 5HGMA 1LT1A 5BS2A 1W2EA 2JO1A 3H1IG 2IBZE 1Q7YQ 2AEJA 2QEXP 1PZQA 2R32A 2E5TA 1ACPA 3BCCE 4EOTA 5HGOA 4YXWH 4PV1C 2E76C 2YMYA 3H1HD 3TK1A 3SSUA 3SWYA 1M90Q 2D2CD 3M9HA 2I1KA 5AW6B 1W2BO 3L75E 1K73Q 1ZLLA 2AFDA 3CCLP 3H1LE 2N1TB 3E1RA 3FGAD 1YJNP 1VQ8P 3RBXA 3AE8C 1OVVA 1M8OB 3RK3D 1SFCA 1LP1B 1FS0E 2KOQA 1NU1J 2FXMA 1MUUA 5APQA 3CXCO 3M91A 3H0DA 3H32B 3HD7A 4DT0A 2YIUC 1RE4A 1A02J 4PH0A 1DNYA 2PEJA 2FVEA 3FXEA 2XU6A 3Q1MA 1MZ8A 1BCCD 1E6JP 4N78D 5CCHA 2ROQA 2M8PA 1AQ5A 4PH1A 2AF8A 1QEXA 5APUA 3DS3A 5CCGD 4U0DA 1JTHA 5CCGC 1EOQA 2JJLA 2ZYDA 3TGUJ 1WMKA 2BCCJ 1M1KQ 1S1CX 3O8ZA 3CXHI 1PP9G 3A0HH 3GZMA 3I56P 3OW2O 2WITA 1KQGB 1IO4A 1NYHA 2QVAA 3L75J 2PEMA 3MHVA 1T8ZA 2WPRA 4A7PA 1KILB 4LLHA 2WSEH 2M5AA 4PXHB 4OH8B 2O1JA 1FZCC 3P8MC 3C9IA 2PP6A 5AW7B 4O9BA 4D6TE 3S1KA 2WSCJ 1S3JA 4I6MC 1N7SB 3G26A 3CWBG 4IFFA 1X0TA 3GKLC 3RK2B 3RBZA 1JCCA 2N9BA 3L70J 3ITKA 3V5BA 3BRVB 3R2PA 2OGUA 3M0AA 4Z1MH 2GUSA 1HWTC 5KJ7D 1EDJA 2IZ1A 2N6YA 5CBNA 2JWDA 5GTIE 3H1JE 4HB1A 3G29A 4QNBA 3H1ID 1BCCE 4H13C 1VF5B 4K3AA 2KGAA 1ZOYC 4R4MA 1M6NA 5K5GB 3P8CD 3EFFK 4L75A 2Y0CA 1ZP0C 2GYKA 2KODA 2WT7A 1BCCG 2M3EA 2FYUD 4XFZA 2MJZA 2W90A 4H0LD 3PJSK 2K93A 1YQ3C 3F5HA 2WSFH 1G2CB 3CCEP 2MR8A 1DIPA 1SQPE 2Z5HA 1IMPA 3HE5A 1P84E 5CJ4A 3G21A 3FX0A 2O01N 1MZ9A 3BCCJ 1KILD 1NTKD 1LTBC 2G8YA 2B88A 2YNYA 3M06A 3MGEA 1LTJA 4IOIH 4YTPC 1LNQA 5DCKA 1HY8A 1MFTA 2WSSH 1VQ5P 1T3UA 2OTJP 4GOEA 4BWNA 1K05A 1LP1A 4KT0J 4W80A 1AYIA 1Q82Q 2NPSD 2RKLA 2XZRA 3L73E 4DCKA 3PH0A 4GIFA 1J1EC 3TYYA 2K9JA 1NHLA 1ZW0A 3EJEA 2PNGA 4JPZB 5EW5E 2Z5IA 3L72G 3A5TA 1OZHA 1AVYA 1GW3A 1PIXA 5BS1A 2VSQA 1PV3A 1YJWP 4BPFA 2M0BA 2QA4P 1KN7A 1JY3O 2KK7A 2RMZA 1OIPA 1N7LA 1K9MQ 3CE7A 5F2KA 2Z45A 2LXCB 1LTJC 2K2QA 3L71E 4GT1A 1USDA 2P1JA 4PV1D 5KAIH 1AJYA 2KXPB 3B71A 1URQC 1SQXK 1URQD 1KTMA 3RK3E 3CX5I 2XV5A 4XFXA 3PLNA 2E75C 1LT9A 2DGYA 4IL6X 4U3FD 1JY3P 1PP9J 2Q3IA 3CC7P 3TGUD 3HUSB 1FU1A 2FYUG 3RL0B 2VLPA 5H2FH 3A2AA 1KQFB 1VQLP 3TNUA 1JTHB 2WSEJ 2WTYA 4W7ZA 3HZQA 5BU8B 2PEOA 2JAZA 2V4HA 3U1CA 2KG6A 1SQQJ 3L37A 1KB9E 4R4LA 4H0LB 1BSHA 1F80D 1D1DA 3G4SP 2L91A 5KLVG 1FC2C 5KLIB 1NTZK 3GJNA 1J2JB 1L2PA 2NPSC 1SQPJ 1L0LJ 3VMYA 2C0XA 5KKZC 1VQ6P 2GZGA 4NPEA 3NY7B 4Y99B 1CI6B 3B5ND 3SFEC 1ZR2A 4U7JA 2EHTA 1RQVA 1IMQA 1JM0A 1VKUA 3QWOC 3GG2A 2A45G 1EC5A 1VQMP 2LTEA 1N73B 2YKOA 2LL8A 3H4EA 1Q90D 1G2CA 4WVZA 4ASVA 1R8EA 2HYNA 3RGUA 2C9LY 1PGPA 2FBWC 4XRQA 2BQ1E 1NU1G 3P05A 1IZNB 3FWLA 1SQVD 3LIDA 3ZDMA 1SFCB 4XFJA 5CCHD 3LW5J 2L22A 4OGQB 1J1DC 2ZT9B 3HE4B 1L0IA 1K04A 3C8VA 3N4XA 2KGEA 2KOSA 2FYUE 3BCCD 4U3FJ 1JOCA 1DD3A 1PPJG 3AEAC 5GTHH 5KJ7A 1FDIA 4U3FG 2V7QJ 4IPYA 1A02F 5AW2B 1OVUA 2I1JA 1YITP 2K1AA 3L72D 3M9BA 1M56D 1NAYA 3BASA 4L76A 1KILE 4N78E 2N9YB 1FBMA 3MD0A 1KMIZ 2GDWA 4HKGA 1KV4A 2O1KA 2K88A 5L8RJ 1NO4A 3EQ2A 1U7MA 1LWUB 2ZXXA 5KLVD 4BRYB 1SQBJ 2KW2A 5AVTB 1PPJE 5C39A 3RG6C 2J5UA 4TLFA 1Y9BA 1GDTA 4NPDA 5AW3B 3C1LA 1YI2P 1NTZD 5AVRB 1BDCA 3A3YB 4K35A 4L74A 2FAEA 3O6QA 1JY2O 3GLMA 3L35A 1NTME 2M8RA 2GDYA 3BATA 2R3CA 2CPBA 1VF5C 4H13B 2KIKA 4UB8H 3LRYA 3CMAP 1E79H 2NO8A 1L0LE 1X22A 2ZXEB 5EJDA 3HD7D 2ZVOB 2KI7B 2OTLP 2OQQA 3P32A 2E75B 2HPCB 1GL2C 1GL2D 2VLNA 2PFXA 1NKNA 3BVHA 1IK9A 1SQQD 3MIWA 1RE4C 1FZGA 1FR2A 1X79B 2BCCG 1L0ND
chains in the Genus database with same CATH topology
3CCVP 3G28A 3DTJA 1D1DA 1PEMA 3DS1A 5F2NA 3G26A 1VQ9P 2PY8A 2PEIA 3G4SP 1YJ9P 2XXMA 3CCUP 3CC2P 3G71P 3CXCO 1YIJP 2ONTA 3DS0A 3H0DA 3G1GA 1IUQA 2JYGA 2Z46A 1QVGO 1VQ6P 2XV6A 2JYLA 4WYMA 1N8RQ 2PENA 1PEUA 4U0AA 4PH0A 2PEJA 2OARA 2EIAA 1PEQA 1S72P 5BS1A 1E6JP 5F2OA 1RO2A 3DS5A 3CCQP 1YJWP 4COPA 1VQOP 1RNIA 3CCJP 1VQNP 2QA4P 2M8PA 3G29A 4QNBA 4PH1A 1K30A 1Q81Q 2BUOA 5HGNA 1A43A 3RG6C 1M6NA 1K9MQ 5I4TG 3DPHA 3VRLC 2L6EA 3E2DA 5F2KA 3G0VA 1VQMP 2EFJA 3DS3A 3CC4P 4U0DA 2Z45A 3G1IA 1JJ2O 1YI2P 2KODA 1K8AQ 1EOQA 1VQKP 2CWOA 3CMEP 3H4EA 2JO0A 3I55P 1QRJA 3CD6P 4U0FA 2E1MA 4XFZA 1KC8Q 1NJIQ 4GR2A 5HGMA 2PEQA 1EIAA 3NTEA 5BS2A 2LF4A 2P9XA 3H47A 3CPWO 1M1KQ 3HYBA 2M8LA 3G6EP 1Q7YQ 3CCEP 2BHVA 4XFXA 5JPAA 4U0CA 4XRQA 2BQ1E 3P05A 3DS4A 2QEXP 2DGYA 3CCRP 2PEKA 1ZMBA 1VQ4P 5HGOA 4GR6A 3I56P 3OW2O 2M8NA 3G21A 3LRYA 1QVFO 1PEOA 2PEMA 3CC7P 3CMAP 4XFYA 1VQPP 1YHQP 3CCSP 2EG5A 1A8OA 1M90Q 1W2BO 1RO0A 4U0EA 2OTLP 1BAJA 3M1MA 2Z44A 5HGLA 4U0BA 1K73Q 3MGEA 1VQLP 4M0IA 3CCLP 3B5IA 5DCKA 3HZQA 4XROA 1VQ5P 2OTJP 2XT1A 1KD1Q 1M6EX 1M74A 2PEOA 4IPYA 3WBHA 3DS2A 1YJNP 1VQ8P 3CCMP 1Q86Q 1KQSO 1AUMA 4COCA 1VQ7P 1YITP 1Q82Q 3Q20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV P;  1KC8 Q;  1NJI Q;  2OTL P;  3CCQ P;  1YJW P;  1VQO P;  3CCJ P;  1VQ9 P;  1VQN P;  3G4S P;  1K73 Q;  3CPW O;  1M1K Q;  3G6E P;  2QA4 P;  1YJ9 P;  1Q7Y Q;  1VQL P;  3CCU P;  3CCE P;  3CC2 P;  3CCL P;  3G71 P;  1Q81 Q;  2QEX P;  3CXC O;  1YIJ P;  1VQ5 P;  2OTJ P;  1KD1 Q;  3CCR P;  1K9M Q;  1VQ4 P;  1QVG O;  3I56 P;  3OW2 O;  1VQ6 P;  1VQM P;  3CC4 P;  1QVF O;  1JJ2 O;  1YI2 P;  1YJN P;  1VQ8 P;  1N8R Q;  3CCM P;  1K8A Q;  3CC7 P;  1VQK P;  3CMA P;  1VQP P;  1YHQ P;  1Q86 Q;  1KQS O;  3CME P;  3CCS P;  1M90 Q;  1VQ7 P;  1YIT P;  3I55 P;  1Q82 Q;  3CD6 P;  1W2B O;  1S72 P; 
#chains in the Genus database with same CATH topology
 5KJ7 C;  4PD4 E;  3D71 A;  3G28 A;  5AW8 B;  1NKZ B;  1W5C E;  3DS1 A;  4N3Y B;  1FZA A;  3B8E B;  1PGQ A;  3A0B E;  2WT7 B;  3V4W A;  3LIE A;  3VMA A;  3JSV C;  2WSC H;  3L72 E;  3KZI E;  1HQB A;  3RK3 C;  1KIL C;  1YYC A;  2K9Y A;  1EQ7 A;  2FYU K;  3KXD A;  2E74 B;  1L4A B;  5KAI E;  1BE3 J;  4WYM A;  4WB4 A;  4U0A A;  5AVU B;  1SQP G;  5M1B A;  2W27 A;  3H1H G;  5APS A;  2P7J A;  2JWA A;  2A06 E;  4NPF X;  1QLE D;  1ZME C;  3N7N A;  3H1H E;  1OW7 A;  2B87 B;  2MR7 A;  5KAF H;  3L74 D;  4ZKU A;  5TIS H;  4IL6 H;  3MGN A;  2AXT H;  3G0V A;  1H88 A;  3SWF A;  1HF9 A;  1L0N J;  3CWB J;  3H1J D;  2Y9Z A;  2ZYA A;  3Q5S A;  4H44 B;  1WT6 A;  2YO2 A;  3CL3 D;  1NOH A;  1L4A A;  3P8C E;  1N73 C;  3HE4 A;  1HTL C;  1VQ4 P;  4LC1 A;  2KSE A;  2W6A A;  2VRS A;  1H89 A;  5AW0 B;  2K9J B;  1LWU C;  4OGQ C;  4BPG A;  1EZV D;  1RH5 B;  1LTT C;  2RH0 A;  1Q2N A;  2QJP B;  3B5N A;  3NXS A;  3V2N A;  1BCC J;  3OJA B;  1PP9 E;  3SFD C;  2D2C B;  1P84 H;  1QL1 A;  1L0H A;  2OYH C;  2KP8 A;  3B5N C;  2GZI A;  2ZVN B;  2BAS A;  3B4Q A;  4I7Z C;  5AW4 B;  2JGP A;  3Q5P A;  2P58 A;  1DD4 A;  4UB6 E;  3AEB C;  4WWI A;  1EDI A;  2KGD A;  5B5E E;  2E5Y A;  1PGO A;  5KP6 B;  1SQV E;  2V7Q H;  2B9B A;  2E75 D;  2MVU A;  2YXQ B;  2G3A A;  1N73 A;  1L4A C;  2AXT E;  3D70 A;  2KUB A;  1OMI A;  1Q81 Q;  2M3B A;  2BUO A;  2JU2 A;  3AE9 C;  5CHX A;  3CWB E;  5HV8 A;  3DPH A;  2L6E A;  3E2D A;  3G9R A;  1S5L E;  5APX A;  2IFN A;  3L71 J;  2QSI A;  4PWV B;  3I55 P;  1QRJ A;  3HE5 B;  1OVR A;  1EIA A;  2YKQ A;  2AFE A;  1AV1 A;  3HYB A;  3EJB A;  2K94 A;  2JP3 A;  1NH4 A;  4RJT A;  1IFJ A;  1BSN A;  4GOD A;  1P84 I;  2PEK A;  4YPC A;  5KP7 B;  1GW4 A;  1WRG A;  4GKG A;  1GD2 E;  1PEO A;  1VQP P;  1IFN A;  3BRT B;  1IJD B;  1BXI A;  3H1H J;  2FY8 A;  4HKZ H;  1BE3 E;  1UNK A;  3RK2 D;  2ZYG A;  2XZ0 D;  4CPG A;  1BGY G;  3W67 A;  3TGU G;  1NWQ A;  1SQV K;  5APV A;  1SS1 A;  2C0W A;  1T6A A;  1UII A;  1SQP D;  1FZE A;  1E0H A;  2LIW A;  1FDO A;  1GZL A;  1S4X A;  1IFP A;  1FOS F;  1KB9 D;  3G1G A;  2LXB A;  1IUQ A;  2MD9 A;  2CQ8 A;  2FXP A;  1NTM D;  2LKM A;  4COP A;  3G3Z A;  3CCJ P;  1N7S D;  1L0L D;  3JCU E;  2JQ4 A;  1KFN A;  5EFW B;  4W7Y A;  5GTI H;  4H0L C;  3E7K A;  4WY4 D;  5B5E H;  4EI2 A;  2L5G B;  1OWA A;  2FFD C;  1ZN5 A;  4H2W C;  1RY3 A;  3EJD A;  3GHG B;  4U0F A;  4GR2 A;  3QH9 A;  1VPC A;  2IFM A;  3HRN A;  1IFD A;  1FZC B;  1JO5 A;  3LW5 H;  2H89 C;  3GW6 A;  2N1T C;  4GR6 A;  3L36 A;  4R0M A;  1NU1 K;  3TF5 A;  1OW6 A;  3VOP A;  1RO0 A;  4U0E A;  2Q1K A;  1OXZ A;  3USS A;  4U0B A;  3CXH D;  4H2X C;  3AE2 C;  2PGD A;  1S5L X;  2XKM A;  3PP5 A;  2KWL A;  4D6T J;  3WUV A;  1FZC A;  3DTJ A;  3GHG C;  2JEE A;  2N98 A;  2CGQ A;  1EZV E;  1IFI A;  1JY2 P;  1YJ9 P;  2FAD A;  2Y0E A;  3MUD C;  3CC2 P;  2PAJ A;  5KLV E;  1NTK K;  1YIJ P;  1S5L H;  3L4F A;  2WZ7 A;  1LTA C;  1M1J C;  2QJY C;  1PEU A;  5AVS B;  1LGH B;  1QX8 A;  2XZ1 C;  2EIA A;  2FXO A;  3JCU H;  4MN4 C;  4PV1 B;  3U59 A;  2JB0 A;  5F2O A;  7CEI A;  3T97 B;  4Y28 J;  1M1J A;  2Z4E A;  1SQP K;  2MY5 A;  3AED C;  4WY4 B;  2N50 A;  3M0D C;  1PFI A;  2QE7 H;  3RK2 C;  4LGD E;  1RF1 C;  2WPT A;  2P10 A;  1N7S C;  1K8A Q;  3CD6 P;  5E79 H;  2M5R A;  3L71 G;  4UB6 H;  1JMB A;  2LF4 A;  2BHV A;  3EFG A;  5CCH C;  4OWF A;  2KZJ A;  1MV8 A;  1S9K E;  2M8N A;  1NTK E;  2K37 A;  1NTZ G;  3FWN A;  5CBO A;  4F37 A;  4B86 A;  1BE3 G;  1SQB G;  3CI9 A;  2A45 I;  1LTI C;  3V2Q A;  3M1M A;  2Z44 A;  5HGL A;  2KB7 P;  2HG5 D;  2HR3 A;  1KD1 Q;  1M6E X;  1M74 A;  2HPC A;  1SP4 A;  1FZB A;  3CXH H;  2MVV A;  3L74 J;  1X3O A;  3Q2Y A;  2O01 H;  1KQS O;  5B66 H;  1VDF A;  3WUU A;  2P2U A;  4ZMD A;  3CCV P;  2H7H A;  2ZJS E;  5AVQ B;  2PY8 A;  2PEI A;  2KGC A;  1T2K D;  3L70 G;  3CCU P;  2A06 D;  1L0L G;  3H1I J;  2Q6Q A;  4JYB A;  4BRY A;  1AF8 A;  5AVY B;  4PD4 D;  3L74 E;  3WUT A;  3H1K E;  2E76 D;  5E79 E;  1AFO A;  1GXG A;  1LT9 C;  3CCQ P;  2CG5 B;  1R5L A;  1VQN P;  2KNC B;  3H1K G;  1MKM A;  2KZI A;  4EIJ A;  4RO0 A;  5HGN A;  1A43 A;  1JMM A;  4IFD K;  4DOJ A;  5AVV B;  2FHS C;  3O6Q B;  3G1I A;  5KLV K;  2BCC E;  1EDL A;  2E1M A;  5BU5 A;  4H2Y C;  4U3F E;  3VN0 A;  4JBZ A;  3CPW O;  1GMJ A;  1VF5 D;  1Y8A A;  3TGU E;  1T8K A;  3MP7 B;  1Z56 A;  1KYO D;  1RF1 A;  5GTH E;  3RK3 B;  1A8O A;  3M0D A;  1PGJ A;  1DV5 A;  4AYC A;  1S9K D;  1NTK G;  1USE A;  2W8Z A;  2N5I A;  5H2F E;  1S2E A;  1LJ2 A;  3PHL A;  5AVX B;  2DNW A;  4M0I A;  3H25 A;  4I1L A;  2A45 H;  2WPV B;  3L73 J;  4I7Z B;  1EZV I;  2JDI H;  1URQ B;  1NTZ E;  2YO3 A;  1SQX E;  2C9N Y;  1DEB A;  1GTW A;  3T97 A;  1IK7 A;  2MF4 A;  4BPH A;  3AEC C;  1N86 A;  1VQ7 P;  1SQB D;  1EZV G;  3GF3 A;  3D6Y A;  1FJP A;  3M9Q A;  4WY4 A;  4D6T G;  2GA1 A;  4DZO A;  1NTM K;  3R4Y A;  2LPK A;  2WSF J;  3S4R A;  5TJH A;  2N1T D;  2JU1 A;  2NRG A;  3A0H E;  3VTP C;  1NVO A;  3IF4 A;  2K0Y A;  2Q7C A;  1QVG O;  2OYI C;  5KAF E;  2O3J A;  1AVO A;  1M1J B;  4RKU J;  2E74 C;  1D7M A;  2KLU A;  3L70 E;  3DS5 A;  2QRX A;  1RNI A;  3L72 J;  2A06 G;  4JYC A;  1HGV A;  2E42 A;  3NFQ A;  3K5B A;  2IDB A;  3I5C A;  3L75 D;  2YXR B;  2ZAE B;  4I2L C;  4JF7 A;  3VRL C;  5KLI C;  4WBA A;  2QIW A;  4TT3 H;  1RHZ B;  1KLP A;  2OYH A;  3E1I A;  3EWK A;  5AW5 B;  3GZL A;  2UWJ E;  2AVA A;  3A7O A;  2BCC D;  2P9X A;  2W83 C;  4PD4 H;  2JBG A;  3AE5 C;  3CX5 E;  3H47 A;  2Y0D A;  5HVC A;  1HJB A;  2HFE D;  4U0C A;  1CZQ A;  2K0D X;  3DS4 A;  1M57 D;  1LTS C;  2ITA A;  3H6P A;  1RE3 C;  3D6Z A;  1ZMB A;  1L0N E;  3KDP B;  2FFD A;  3OAK A;  1GK4 A;  5B66 E;  2OYI B;  1YHQ P;  2EG5 A;  1P84 D;  1ZRT E;  2DW3 A;  1NTZ J;  5APW A;  2KOP A;  1KZU B;  2KR5 A;  3Q5R A;  1EXI A;  2BEZ F;  2FYZ A;  3KHU A;  2MKV A;  3B5I A;  3VMX A;  4NEO A;  2K0X A;  4KHX A;  2HOD B;  1KB9 I;  2XND H;  2WPS A;  2B87 A;  1OFC X;  1Q86 Q;  1L4A D;  4PJ0 E;  4COC A;  3V6I A;  3Q20 A;  2ZT9 D;  1RQU A;  3FXD A;  1NU1 D;  3KPE A;  2FQ2 A;  2H88 C;  1NQ4 A;  2LOL A;  2WMM A;  4C7R A;  4WY4 C;  1HUC A;  2XV6 A;  1BGY D;  1NGM B;  1FZF A;  2OAR A;  1PEQ A;  1S72 P;  5APT A;  1SQQ K;  4D6T D;  1RO2 A;  1PPJ D;  1VQO P;  2HLO A;  3HUS C;  2L4B A;  2K92 A;  2VLQ A;  1M7L A;  4RES B;  4XA4 A;  3RG2 A;  1HJ0 A;  1EDK A;  1JY3 N;  3V4Q A;  3H1K J;  2EHS A;  3H1L J;  3L73 G;  3HTK B;  4AUW A;  4OVN F;  2CWO A;  2XDJ A;  2KOO A;  4HH2 A;  2JKV A;  1KC8 Q;  1NJI Q;  2OTK E;  2QJK C;  3AE6 C;  1X9V A;  1H0T A;  2K5X A;  2WVR A;  3WU2 E;  3G6E P;  3A0B H;  4EDF A;  3ABV C;  3CXH E;  1PP9 D;  4JQ0 D;  4CA3 A;  1QGK B;  2QJY B;  2IPP A;  3IFM A;  2CNR A;  1EXJ A;  2H43 A;  3VYI A;  4C7N A;  2NPS B;  1FDM A;  2IYO A;  1ZNV A;  2IBZ D;  1XTC C;  2FYN B;  2W6J H;  2CPS A;  3BCC G;  3IN6 A;  2KYV A;  1SQQ E;  1E5W A;  1UIX A;  4GOF A;  2N6Z A;  1SFC C;  5DJU B;  5KTB A;  2GZE A;  3AEF C;  1YQ4 C;  3II6 A;  2WPQ A;  4OGQ D;  1EMV A;  2POH A;  2FQ0 A;  4XE5 B;  1GPJ A;  2FAC A;  1VQ9 P;  3CWB D;  1Y47 A;  3TSI A;  4ZKP A;  1UJZ A;  2Z46 A;  1KQL A;  2E76 B;  3JC2 2;  2LKI A;  2KSJ A;  1U7J A;  5TIS E;  4UHP B;  2R5D A;  1BGY E;  1T3J A;  2QNW A;  1DH3 A;  2WWW A;  3LMO A;  1AQT A;  5CJ0 A;  3VMZ A;  2E43 A;  1U57 A;  2QM8 A;  3CC4 P;  4IL6 E;  3AEG C;  1VQK P;  3TDK A;  4ZNC A;  3OA7 A;  2R44 A;  2J58 A;  1LTG C;  2QJP C;  4QKO A;  1OW8 A;  2GZF A;  1GL2 B;  4MRT C;  2FQ1 A;  1KB9 H;  3L73 D;  3AE3 C;  3KZI H;  1RE3 A;  1JCD A;  1BDD A;  1GU4 A;  1N7S A;  4PJ0 H;  4Y99 C;  2Q5U A;  4XFY A;  3CCS P;  4IZ6 A;  3Q3D A;  3TNU B;  3L71 D;  2GM4 A;  1T2K C;  2GZJ A;  2FYU J;  2CK3 H;  2GUV A;  1X8Y A;  5KKZ B;  1G1I A;  2KG8 A;  1CW5 A;  2YIU B;  4H44 C;  3B4S A;  1QL2 A;  1JUN A;  5AVW B;  2D2C C;  1PL5 A;  2GDX A;  1KOR A;  3CLQ A;  3GF7 A;  3SWK A;  1GXH A;  1JB0 J;  3RL0 D;  1AUM A;  3H1L G;  4PD4 I;  2IBZ G;  4DG9 A;  2AEF A;  1HBW A;  5F2N A;  5CCG A;  2KOG A;  3NMD A;  2AXC A;  3GHG A;  2FFD B;  3AEE C;  2OYI A;  1AA0 A;  2FKW B;  1L0N K;  2X2B A;  4YXD C;  1JEK A;  2K3R A;  4UB8 E;  2L9F A;  1J1D B;  1ZXG A;  2YMK A;  2JR8 A;  3W68 A;  4IFM A;  3CX5 H;  4EYY Q;  4HYT B;  1NTK J;  1ZRT D;  1K30 A;  1SQX J;  2NPS A;  3L74 G;  3AE7 C;  3HD7 C;  4HJG H;  1N2D C;  4H13 D;  1SFC D;  3PRJ A;  2LR2 A;  1IFM A;  3H1J J;  2H8P D;  1HGZ A;  3B5N B;  5APY A;  2LML A;  2N1T A;  3CME P;  1J1E B;  3H1J G;  2JO0 A;  1KYO E;  2KS1 B;  3PTZ A;  2J59 M;  1L0N G;  2SPZ A;  1Z6M A;  3HUS A;  1ZR4 A;  3VP8 A;  2L0Q A;  5JPA A;  3P7K A;  2KNC A;  2W6B A;  1HH0 A;  1SQX D;  4QMA A;  1BE3 D;  1TU3 F;  4N6J A;  3VP9 A;  1HVV A;  2XNX A;  1SLQ A;  4H44 D;  2N5H A;  1SQB E;  4BXL A;  2VLO A;  1OR5 A;  1VL2 A;  2XT1 A;  2E74 D;  2R3S A;  5AVZ B;  5CZD B;  3U43 A;  3S9O A;  3F89 A;  3DS2 A;  2RN0 A;  3CCM P;  1NAF A;  1URQ A;  1L0L K;  2I8D A;  3AE1 C;  3GMA A;  1MFZ A;  2B89 A;  1RF1 B;  3L70 D;  3G71 P;  1XTG B;  1CSB A;  1FE6 A;  4C7N B;  2JYG A;  3RL0 C;  4GDO A;  1R5S A;  2JYL A;  4M3L A;  2PEN A;  1RF0 C;  2FVA A;  1KYO H;  1OX3 A;  2Y9Y A;  1FAV A;  3IR9 A;  3KYQ A;  2NZ2 A;  3IAO A;  2IBZ I;  3CX5 D;  4ASW A;  2OYH B;  2QM7 A;  1FJK A;  2EFJ A;  2QG4 A;  1GK6 A;  4KJM A;  3NTN A;  3H32 A;  3HD7 B;  5KP8 B;  2PEQ A;  5BVZ A;  3NTE A;  2KOR A;  2M8L A;  3V2P A;  1FOS E;  3L75 G;  1DX7 A;  3CCR P;  5KLV J;  2FYN C;  2ZT9 C;  1ZV8 A;  3KQG A;  1QVF O;  2O01 J;  1YTZ I;  4DJG A;  1LT9 B;  3UIA A;  4AQR D;  2WQY C;  2BEQ D;  4C46 A;  3H1L D;  4L73 A;  1BAJ A;  2LIU A;  2IX7 C;  2YKP A;  3U1A A;  1G1J A;  1IC2 A;  4XRO A;  1KFM A;  2M5A B;  2Q3E A;  1GU5 A;  2KLV A;  3H1K D;  1SQX G;  1DEE G;  3WBH A;  1YBK A;  5AW1 B;  1H8A A;  1LTJ B;  3WU2 H;  1BGY J;  2QJK B;  3H1I E;  1PEM A;  2XXM A;  3AE4 C;  3WMM 0;  2ONT A;  3DS0 A;  3V2R A;  1KIL A;  1SQB K;  2ERH A;  1JNM A;  2KG9 A;  3MUD A;  2OYO A;  1NTM G;  2IYP A;  1N8R Q;  1NU1 E;  5AW9 B;  3MTU E;  1NTM J;  2IZ0 A;  2HOD A;  2ZFC A;  1RF0 A;  1KYO I;  1SQV J;  1CI6 A;  1VHN A;  3RL0 g;  3HTK A;  1SQQ G;  2PRR A;  5CMZ A;  1SQV G;  5DJT B;  2P67 A;  2Q9I A;  1JY2 N;  5I4T G;  1LWU A;  2AEM A;  1YTZ T;  1JJ2 O;  2KS1 A;  1CEI A;  3MZW B;  1H0T B;  1GL2 A;  2FVF A;  2R5B A;  1SVF A;  5HGM A;  1LT1 A;  5BS2 A;  1W2E A;  2JO1 A;  3H1I G;  2IBZ E;  1Q7Y Q;  2AEJ A;  2QEX P;  1PZQ A;  2R32 A;  2E5T A;  1ACP A;  3BCC E;  4EOT A;  5HGO A;  4YXW H;  4PV1 C;  2E76 C;  2YMY A;  3H1H D;  3TK1 A;  3SSU A;  3SWY A;  1M90 Q;  2D2C D;  3M9H A;  2I1K A;  5AW6 B;  1W2B O;  3L75 E;  1K73 Q;  1ZLL A;  2AFD A;  3CCL P;  3H1L E;  2N1T B;  3E1R A;  3FGA D;  1YJN P;  1VQ8 P;  3RBX A;  3AE8 C;  1OVV A;  1M8O B;  3RK3 D;  1SFC A;  1LP1 B;  1FS0 E;  2KOQ A;  1NU1 J;  2FXM A;  1MUU A;  5APQ A;  3CXC O;  3M91 A;  3H0D A;  3H32 B;  3HD7 A;  4DT0 A;  2YIU C;  1RE4 A;  1A02 J;  4PH0 A;  1DNY A;  2PEJ A;  2FVE A;  3FXE A;  2XU6 A;  3Q1M A;  1MZ8 A;  1BCC D;  1E6J P;  4N78 D;  5CCH A;  2ROQ A;  2M8P A;  1AQ5 A;  4PH1 A;  2AF8 A;  1QEX A;  5APU A;  3DS3 A;  5CCG D;  4U0D A;  1JTH A;  5CCG C;  1EOQ A;  2JJL A;  2ZYD A;  3TGU J;  1WMK A;  2BCC J;  1M1K Q;  1S1C X;  3O8Z A;  3CXH I;  1PP9 G;  3A0H H;  3GZM A;  3I56 P;  3OW2 O;  2WIT A;  1KQG B;  1IO4 A;  1NYH A;  2QVA A;  3L75 J;  2PEM A;  3MHV A;  1T8Z A;  2WPR A;  4A7P A;  1KIL B;  4LLH A;  2WSE H;  2M5A A;  4PXH B;  4OH8 B;  2O1J A;  1FZC C;  3P8M C;  3C9I A;  2PP6 A;  5AW7 B;  4O9B A;  4D6T E;  3S1K A;  2WSC J;  1S3J A;  4I6M C;  1N7S B;  3G26 A;  3CWB G;  4IFF A;  1X0T A;  3GKL C;  3RK2 B;  3RBZ A;  1JCC A;  2N9B A;  3L70 J;  3ITK A;  3V5B A;  3BRV B;  3R2P A;  2OGU A;  3M0A A;  4Z1M H;  2GUS A;  1HWT C;  5KJ7 D;  1EDJ A;  2IZ1 A;  2N6Y A;  5CBN A;  2JWD A;  5GTI E;  3H1J E;  4HB1 A;  3G29 A;  4QNB A;  3H1I D;  1BCC E;  4H13 C;  1VF5 B;  4K3A A;  2KGA A;  1ZOY C;  4R4M A;  1M6N A;  5K5G B;  3P8C D;  3EFF K;  4L75 A;  2Y0C A;  1ZP0 C;  2GYK A;  2KOD A;  2WT7 A;  1BCC G;  2M3E A;  2FYU D;  4XFZ A;  2MJZ A;  2W90 A;  4H0L D;  3PJS K;  2K93 A;  1YQ3 C;  3F5H A;  2WSF H;  1G2C B;  3CCE P;  2MR8 A;  1DIP A;  1SQP E;  2Z5H A;  1IMP A;  3HE5 A;  1P84 E;  5CJ4 A;  3G21 A;  3FX0 A;  2O01 N;  1MZ9 A;  3BCC J;  1KIL D;  1NTK D;  1LTB C;  2G8Y A;  2B88 A;  2YNY A;  3M06 A;  3MGE A;  1LTJ A;  4IOI H;  4YTP C;  1LNQ A;  5DCK A;  1HY8 A;  1MFT A;  2WSS H;  1VQ5 P;  1T3U A;  2OTJ P;  4GOE A;  4BWN A;  1K05 A;  1LP1 A;  4KT0 J;  4W80 A;  1AYI A;  1Q82 Q;  2NPS D;  2RKL A;  2XZR A;  3L73 E;  4DCK A;  3PH0 A;  4GIF A;  1J1E C;  3TYY A;  2K9J A;  1NHL A;  1ZW0 A;  3EJE A;  2PNG A;  4JPZ B;  5EW5 E;  2Z5I A;  3L72 G;  3A5T A;  1OZH A;  1AVY A;  1GW3 A;  1PIX A;  5BS1 A;  2VSQ A;  1PV3 A;  1YJW P;  4BPF A;  2M0B A;  2QA4 P;  1KN7 A;  1JY3 O;  2KK7 A;  2RMZ A;  1OIP A;  1N7L A;  1K9M Q;  3CE7 A;  5F2K A;  2Z45 A;  2LXC B;  1LTJ C;  2K2Q A;  3L71 E;  4GT1 A;  1USD A;  2P1J A;  4PV1 D;  5KAI H;  1AJY A;  2KXP B;  3B71 A;  1URQ C;  1SQX K;  1URQ D;  1KTM A;  3RK3 E;  3CX5 I;  2XV5 A;  4XFX A;  3PLN A;  2E75 C;  1LT9 A;  2DGY A;  4IL6 X;  4U3F D;  1JY3 P;  1PP9 J;  2Q3I A;  3CC7 P;  3TGU D;  3HUS B;  1FU1 A;  2FYU G;  3RL0 B;  2VLP A;  5H2F H;  3A2A A;  1KQF B;  1VQL P;  3TNU A;  1JTH B;  2WSE J;  2WTY A;  4W7Z A;  3HZQ A;  5BU8 B;  2PEO A;  2JAZ A;  2V4H A;  3U1C A;  2KG6 A;  1SQQ J;  3L37 A;  1KB9 E;  4R4L A;  4H0L B;  1BSH A;  1F80 D;  1D1D A;  3G4S P;  2L91 A;  5KLV G;  1FC2 C;  5KLI B;  1NTZ K;  3GJN A;  1J2J B;  1L2P A;  2NPS C;  1SQP J;  1L0L J;  3VMY A;  2C0X A;  5KKZ C;  1VQ6 P;  2GZG A;  4NPE A;  3NY7 B;  4Y99 B;  1CI6 B;  3B5N D;  3SFE C;  1ZR2 A;  4U7J A;  2EHT A;  1RQV A;  1IMQ A;  1JM0 A;  1VKU A;  3QWO C;  3GG2 A;  2A45 G;  1EC5 A;  1VQM P;  2LTE A;  1N73 B;  2YKO A;  2LL8 A;  3H4E A;  1Q90 D;  1G2C A;  4WVZ A;  4ASV A;  1R8E A;  2HYN A;  3RGU A;  2C9L Y;  1PGP A;  2FBW C;  4XRQ A;  2BQ1 E;  1NU1 G;  3P05 A;  1IZN B;  3FWL A;  1SQV D;  3LID A;  3ZDM A;  1SFC B;  4XFJ A;  5CCH D;  3LW5 J;  2L22 A;  4OGQ B;  1J1D C;  2ZT9 B;  3HE4 B;  1L0I A;  1K04 A;  3C8V A;  3N4X A;  2KGE A;  2KOS A;  2FYU E;  3BCC D;  4U3F J;  1JOC A;  1DD3 A;  1PPJ G;  3AEA C;  5GTH H;  5KJ7 A;  1FDI A;  4U3F G;  2V7Q J;  4IPY A;  1A02 F;  5AW2 B;  1OVU A;  2I1J A;  1YIT P;  2K1A A;  3L72 D;  3M9B A;  1M56 D;  1NAY A;  3BAS A;  4L76 A;  1KIL E;  4N78 E;  2N9Y B;  1FBM A;  3MD0 A;  1KMI Z;  2GDW A;  4HKG A;  1KV4 A;  2O1K A;  2K88 A;  5L8R J;  1NO4 A;  3EQ2 A;  1U7M A;  1LWU B;  2ZXX A;  5KLV D;  4BRY B;  1SQB J;  2KW2 A;  5AVT B;  1PPJ E;  5C39 A;  3RG6 C;  2J5U A;  4TLF A;  1Y9B A;  1GDT A;  4NPD A;  5AW3 B;  3C1L A;  1YI2 P;  1NTZ D;  5AVR B;  1BDC A;  3A3Y B;  4K35 A;  4L74 A;  2FAE A;  3O6Q A;  1JY2 O;  3GLM A;  3L35 A;  1NTM E;  2M8R A;  2GDY A;  3BAT A;  2R3C A;  2CPB A;  1VF5 C;  4H13 B;  2KIK A;  4UB8 H;  3LRY A;  3CMA P;  1E79 H;  2NO8 A;  1L0L E;  1X22 A;  2ZXE B;  5EJD A;  3HD7 D;  2ZVO B;  2KI7 B;  2OTL P;  2OQQ A;  3P32 A;  2E75 B;  2HPC B;  1GL2 C;  1GL2 D;  2VLN A;  2PFX A;  1NKN A;  3BVH A;  1IK9 A;  1SQQ D;  3MIW A;  1RE4 C;  1FZG A;  1FR2 A;  1X79 B;  2BCC G;  1L0N D; 
#chains in the Genus database with same CATH homology
 3CCV P;  3G28 A;  3DTJ A;  1D1D A;  1PEM A;  3DS1 A;  5F2N A;  3G26 A;  1VQ9 P;  2PY8 A;  2PEI A;  3G4S P;  1YJ9 P;  2XXM A;  3CCU P;  3CC2 P;  3G71 P;  3CXC O;  1YIJ P;  2ONT A;  3DS0 A;  3H0D A;  3G1G A;  1IUQ A;  2JYG A;  2Z46 A;  1QVG O;  1VQ6 P;  2XV6 A;  2JYL A;  4WYM A;  1N8R Q;  2PEN A;  1PEU A;  4U0A A;  4PH0 A;  2PEJ A;  2OAR A;  2EIA A;  1PEQ A;  1S72 P;  5BS1 A;  1E6J P;  5F2O A;  1RO2 A;  3DS5 A;  3CCQ P;  1YJW P;  4COP A;  1VQO P;  1RNI A;  3CCJ P;  1VQN P;  2QA4 P;  2M8P A;  3G29 A;  4QNB A;  4PH1 A;  1K30 A;  1Q81 Q;  2BUO A;  5HGN A;  1A43 A;  3RG6 C;  1M6N A;  1K9M Q;  5I4T G;  3DPH A;  3VRL C;  2L6E A;  3E2D A;  5F2K A;  3G0V A;  1VQM P;  2EFJ A;  3DS3 A;  3CC4 P;  4U0D A;  2Z45 A;  3G1I A;  1JJ2 O;  1YI2 P;  2KOD A;  1K8A Q;  1EOQ A;  1VQK P;  2CWO A;  3CME P;  3H4E A;  2JO0 A;  3I55 P;  1QRJ A;  3CD6 P;  4U0F A;  2E1M A;  4XFZ A;  1KC8 Q;  1NJI Q;  4GR2 A;  5HGM A;  2PEQ A;  1EIA A;  3NTE A;  5BS2 A;  2LF4 A;  2P9X A;  3H47 A;  3CPW O;  1M1K Q;  3HYB A;  2M8L A;  3G6E P;  1Q7Y Q;  3CCE P;  2BHV A;  4XFX A;  5JPA A;  4U0C A;  4XRQ A;  2BQ1 E;  3P05 A;  3DS4 A;  2QEX P;  2DGY A;  3CCR P;  2PEK A;  1ZMB A;  1VQ4 P;  5HGO A;  4GR6 A;  3I56 P;  3OW2 O;  2M8N A;  3G21 A;  3LRY A;  1QVF O;  1PEO A;  2PEM A;  3CC7 P;  3CMA P;  4XFY A;  1VQP P;  1YHQ P;  3CCS P;  2EG5 A;  1A8O A;  1M90 Q;  1W2B O;  1RO0 A;  4U0E A;  2OTL P;  1BAJ A;  3M1M A;  2Z44 A;  5HGL A;  4U0B A;  1K73 Q;  3MGE A;  1VQL P;  4M0I A;  3CCL P;  3B5I A;  5DCK A;  3HZQ A;  4XRO A;  1VQ5 P;  2OTJ P;  2XT1 A;  1KD1 Q;  1M6E X;  1M74 A;  2PEO A;  4IPY A;  3WBH A;  3DS2 A;  1YJN P;  1VQ8 P;  3CCM P;  1Q86 Q;  1KQS O;  1AUM A;  4COC A;  1VQ7 P;  1YIT P;  1Q82 Q;  3Q20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...