1K9MQ

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1k9mQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1k9mQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1k9mQ03
1M1KQ 3CXCO 3OW2O 1Q7YQ 3CCUP 2QEXP 1VQMP 1YHQP 1W2BO 1KQSO 1VQKP 3CCJP 3CC2P 1K73Q 3CCVP 1VQPP 1VQNP 3CCSP 1N8RQ 1QVGO 1YITP 1YI2P 3G4SP 3CPWO 1VQ7P 3CCMP 1VQ4P 1KD1Q 1YJ9P 1K8AQ 1VQ5P 1YJNP 1Q82Q 3CCQP 2OTJP 1VQOP 3I56P 1NJIQ 1VQ9P 3CMEP 3CCLP 3I55P 2QA4P 1JJ2O 3CCEP 3CC4P 1S72P 3G71P 1K9MQ 1VQLP 3CD6P 1YIJP 1YJWP 3G6EP 1KC8Q 1VQ8P 3CC7P 3CMAP 1QVFO 1M90Q 1VQ6P 1Q81Q 2OTLP 1Q86Q 3CCRP
chains in the Genus database with same CATH superfamily
1Q2NA 3WUVA 3NXSA 1N7SC 2KIKA 4UHPB 1NTKJ 5K5GB 1QVGO 1GW3A 2JYGA 2Q7CA 2IZ1A 1CSBA 2WT7B 4H13C 5AW0B 2QA4P 1DH3A 5CCGA 2KW2A 5BS2A 2J58A 2L22A 3U1CA 3AECC 1SQBE 1NTMD 4GKGA 3RGUA 4H2YC 1LWUA 2QRXA 1M57D 2KG9A 4H0LB 1OR5A 1FR2A 4ASWA 2E43A 3CX5E 2O1KA 2PEQA 5HGNA 2HR3A 5E79H 4HH2A 2LPKA 2K92A 1NO4A 1N2DC 4RKUJ 5EJDA 4U0EA 4RESB 2BEQD 2A06E 3SWKA 2YXRB 2C9LY 4XFYA 1NTMJ 3JC22 4I2LC 1S5LX 2OYHC 1KILA 3KPEA 1BCCD 1KD1Q 3RK2B 5KLIB 2E5YA 2KZIA 2XV6A 2BCCG 1DV5A 2GZIA 1SFCC 3KZIE 1M1JA 1L0LK 2FADA 1NU1G 5GTHE 2VLQA 2R44A 1Q7YQ 1KQFB 1OIPA 2FFDB 5CCHA 1X3OA 4HKGA 1IZNB 3TDKA 1HGVA 1RF1C 1S5LH 5APYA 4WVZA 3PJSK 1BCCJ 1KYOE 1JY3P 1YTZT 1W5CE 2BCCD 2MVVA 2SPZA 3VMYA 1JCCA 1LT9B 3SFEC 1JY2O 1X79B 1AYIA 3GF3A 2K0XA 1ZNVA 3CCSP 3G28A 1SQQK 1GD2E 1GZLA 1IFPA 1MV8A 4UB6H 3CWBE 1J1DC 3JCUH 3R2PA 1RF0C 2RMZA 2IYPA 1HTLC 2V4HA 3RK3C 1A02J 2YKQA 3V2QA 3R4YA 1ZN5A 1HJ0A 2H43A 3G21A 2KGCA 1FDIA 3LW5J 2BCCJ 3W67A 1N7SD 1PL5A 3PRJA 1JB0J 2A45H 3L72D 3P05A 2PEMA 4N6JA 1QGKB 2MKVA 3QWOC 1FOSE 5AVZB 1EMVA 2IBZG 1T8ZA 3TNUB 1AVYA 1CZQA 4IFFA 2RN0A 3H1IG 1LT1A 1G1IA 2E74B 3T97B 2FKWB 1BCCE 1KV4A 2N9BA 2P9XA 2EHTA 4O9BA 3MGEA 4RJTA 2EIAA 1AQTA 2CPSA 3PLNA 2P2UA 3L72J 3SWFA 2CNRA 2M8NA 2YKPA 2FYUD 3AE9C 3NMDA 4EIJA 2PENA 1RQVA 2QNWA 2K0YA 1T3UA 2QJPC 2LF4A 3A3YB 3TK1A 3H1ID 1YJNP 2XU6A 2M8PA 4D6TG 2Q9IA 4PD4I 2N9YB 1SFCD 1L0HA 2JDIH 2W27A 1L4AB 1JY2P 2QEXP 2FYUJ 4OH8B 2JWDA 3HTKA 3BASA 1E5WA 2FAEA 1QL1A 3BCCG 3D70A 2QSIA 4QMAA 4U0FA 3H1IJ 2ITAA 3F89A 1URQC 3CI9A 1FZBA 4YPCA 2N5HA 1ZR2A 1RQUA 3BRTB 3L72E 1JEKA 4D6TD 1OVUA 1LT9A 2OYOA 2KGEA 2WZ7A 1EXJA 1N86A 2W83C 3AEBC 3M91A 3RG2A 2PEJA 3HE5A 3DS3A 1MFZA 3L73G 3GF7A 3L74G 3BCCD 3EJBA 3N7NA 1M6NA 4WY4C 4WBAA 1HY8A 3CCUP 2R3CA 5H2FH 3RK3D 5KJ7C 2K0DX 2NPSB 4EOTA 5BU8B 1VKUA 2KLUA 4D6TJ 1FC2C 4JYBA 2OTJP 1DIPA 3RG6C 1QEXA 2FYUE 1JMBA 5TISE 2FYNC 1KFMA 1L0NK 3RL0D 3OAKA 5KLVK 3TNUA 1RO2A 2WMMA 2HPCB 5KAIE 3BCCJ 3H1IE 4PV1C 1JNMA 3L73D 3LMOA 1YITP 4JF7A 5AW4B 2WSEJ 4C46A 4IFDK 1EIAA 5AW5B 2H88C 1LP1A 2UWJE 1SQQD 2GA1A 3EFGA 2Y9ZA 4HB1A 3RBXA 1E79H 1S4XA 3A0BE 3B8EB 5AVWB 1E0HA 3L73J 3ABVC 5APSA 2FBWC 5CJ4A 2YMKA 3Q5PA 1GL2C 2M8RA 1FZEA 4DCKA 1M74A 5CJ0A 1SQQJ 5F2NA 1S1CX 1RE4A 2WSCH 3CX5H 3DPHA 2WWWA 1VF5B 3L36A 3OJAB 3MUDA 1DX7A 1VL2A 3BCCE 4H44C 3I56P 3CCLP 1SQPG 4GR6A 3RK3E 2LL8A 5DJTB 1YIJP 4KJMA 1N7SA 1PEMA 2OTLP 4XE5B 3ZDMA 2O1JA 1URQD 3O8ZA 1KQSO 1EZVE 3KQGA 3RL0B 2WPRA 1YTZI 3II6A 3LIEA 2C9NY 3KZIH 2D2CB 1NKZB 2OTKE 1NH4A 1USDA 1SQVG 1FDOA 2E76C 3C8VA 2K93A 2LXCB 5HV8A 1SQPD 2OGUA 5KJ7D 2VLOA 1ZRTE 1L0IA 2KYVA 3V2NA 1SQQE 1KYOH 3P7KA 2KG8A 2POHA 5B66E 2K9JB 3CL3D 3AE2C 4KT0J 5KKZC 5APTA 1VQNP 2M0BA 1H88A 2VSQA 3IN6A 1SQVD 4I7ZC 1SQPJ 1SFCA 3CCMP 1LTIC 1JM0A 4COCA 4HJGH 3CXHD 4XROA 1ZP0C 3W68A 1LTGC 2KXPB 2I1KA 2QJKB 5AW1B 4MN4C 2LKIA 3M9HA 1LWUB 3WUUA 1JTHA 2B9BA 4M3LA 4IPYA 1SQVJ 5KAFE 2YNYA 3CD6P 4C7NA 3DS0A 2A06G 5AVQB 2FVFA 1K30A 3VRLC 1KLPA 2FHSC 3U59A 1KILB 2N1TC 2N50A 2LIUA 4BPGA 1RF0A 1G1JA 2ZJSE 1RNIA 2IBZI 1SQXK 1KB9E 2GM4A 2FQ2A 1SQPE 3CX5D 5AVVB 1FZCC 3HUSC 1FJPA 3M0DC 1YYCA 4GDOA 2DGYA 2B89A 3VYIA 1M6EX 1N7LA 1MKMA 4U0BA 2FYNB 1UIIA 2IFNA 2A06D 2AXTE 2YO3A 1QLED 2IFMA 2MF4A 3LW5H 2K3RA 2GDXA 4AYCA 2IYOA 3CMAP 4OGQD 1VQ6P 3B5ND 1Q81Q 1R5LA 2WPSA 2WSSH 1SQVE 5CZDB 2E76D 4IOIH 3CXHE 1Y8AA 3MIWA 2PP6A 3CWBG 3D6YA 4U7JA 2ERHA 3VOPA 1EDLA 1KZUB 2N98A 3HRNA 1RE3C 1JY3O 2MY5A 2KOGA 2ZFCA 2B88A 3PTZA 2NO8A 4BRYA 1VQKP 1ZMBA 2HLOA 3CLQA 3GZMA 3TGUD 2P1JA 2JWAA 1NYHA 2KODA 3A0HE 2KNCA 2K88A 3L37A 1PEQA 1K9MQ 3L71G 1CEIA 3Q1MA 1L0NE 2Q3EA 3CWBD 4PXHB 1BCCG 4R4LA 1RO0A 1OZHA 2IDBA 3IAOA 2A45I 2LOLA 1AVOA 4PJ0E 4LLHA 1NTZK 5TISH 1EOQA 2KWLA 3TGUJ 4GOFA 1J1EC 1URQA 4KHXA 1SS1A 3KDPB 1KMIZ 1PGJA 3TYYA 5KAIH 2C0WA 3CCRP 2WPVB 3Q2YA 3CWBJ 2MD9A 3L71D 4OGQB 3B5NB 2N1TD 3E2DA 4M0IA 5BS1A 3VN0A 2CK3H 3SWYA 2K37A 5CBNA 2K94A 5KJ7A 1SVFA 2JYLA 2OARA 3HTKB 3A0BH 3H1KD 4L76A 4Y99C 3B71A 1U57A 3MHVA 1Q82Q 1XTGB 3L71J 2PGDA 4B86A 5KP8B 3GKLC 2KOSA 2LR2A 3FGAD 2Y0EA 3TGUE 3L72G 2Y9YA 2IPPA 2KLVA 3GHGC 1FZFA 2YIUB 3B5IA 5AW8B 3AE8C 3G0VA 3H1KJ 3KXDA 1DEBA 3HE5B 2WSEH 1CW5A 4UB8E 4EDFA 2BASA 2AEFA 1OVRA 2E75D 2KSJA 3I5CA 2N6ZA 1T2KC 4L74A 2WSFJ 5F2KA 1NOHA 3A7OA 1BDDA 3P32A 3LRYA 2FYUG 2WITA 3E1RA 2KGDA 4H13D 1PPJD 3FWNA 3NFQA 3L71E 2ROQA 3V6IA 1DNYA 2ONTA 1N73B 4U0DA 1NAYA 1GU5A 4ZNCA 3CCQP 2B87A 1RY3A 1FJKA 5AVRB 5B66H 1LP1B 2HODA 1AF8A 3H1KE 2VLNA 3SSUA 4H2XC 4PH1A 3H32A 1OXZA 1VQPP 1P84D 2Y0DA 3HD7C 2GZGA 2L6EA 4QKOA 3B5NA 3G9RA 2M5AA 2XT1A 2WQYC 2XDJA 5B5EE 2Z4EA 3L70G 4K35A 2X2BA 1R8EA 4ZKUA 2FVAA 5CHXA 2E75B 3VMXA 3B4SA 2RKLA 1IO4A 4NEOA 3D71A 2AEJA 2C0XA 1L0LG 4BPFA 1N7SB 1NTZD 2ZYGA 1PEOA 2XXMA 3OW2O 5AVTB 1EZVG 2MVUA 3L75G 3CX5I 3N4XA 2XZRA 3CC2P 4H13B 3NTEA 2AFDA 3H4EA 1Z6MA 3RBZA 5I4TG 4L75A 1PPJE 3L70D 2Q5UA 1KB9H 2RH0A 2IX7C 2KOQA 1GK6A 2YKOA 1NTZJ 2AXTH 2R5BA 1L0LD 3M9QA 1OWAA 1SQQG 1T2KD 2L9FA 3KYQA 3H1HD 2AXCA 1FU1A 1VPCA 1EZVD 3L75D 4JBZA 1LTTC 3G1IA 2G8YA 3L70J 3G1GA 2AEMA 3FX0A 2OYHB 1M1JC 1P84E 2N1TA 3CXHH 5APQA 4GOEA 2BQ1E 3VMAA 1N73A 1SFCB 3G29A 1KYOI 1PP9E 2OYIC 1L0LJ 2DNWA 4BXLA 4GODA 4ZMDA 1BDCA 5E79E 1FZCA 1ZRTD 2Z45A 2KUBA 3M0DA 1SQBK 3H1HJ 2JGPA 4PWVB 3U1AA 3L75J 2XZ1C 2ZT9C 2HG5D 5C39A 1LTJC 1DEEG 1VDFA 3AE7C 1RF1B 2JKVA 1KQGB 1GW4A 2R32A 1PGPA 1X22A 1U7MA 5L8RJ 1JTHB 2QJYC 3A0HH 4EI2A 1LTSC 3HD7D 2QG4A 1NTZE 4C7NB 4Y28J 3HYBA 1Q86Q 4WYMA 1PGOA 4HYTB 2JP3A 3L70E 1J1DB 4PJ0H 3GW6A 3G4SP 1ZV8A 1NTKK 1S9KD 4JYCA 3RK3B 5CMZA 3WUTA 5APUA 2LTEA 1KN7A 1RE3A 1D7MA 1KC8Q 1L0LE 3A2AA 3H1HE 1EDJA 3GLMA 1HBWA 3DTJA 3L75E 2ZVNB 2XZ0D 4DZOA 2BHVA 3S4RA 1CI6A 3AEEC 2QM7A 4U0CA 4JPZB 4N3YB 1DD3A 4H0LC 2NRGA 3EFFK 2G3AA 4WWIA 5GTHH 2EHSA 3TSIA 1KB9D 4WY4D 3CE7A 4N78D 1OW8A 2ZYDA 1NTMK 4R0MA 1UIXA 1WMKA 3U43A 5KLIC 3RK2C 4YTPC 3MTUE 1G2CA 2QJPB 1FBMA 1JO5A 4BRYB 1FZAA 2OYHA 2GYKA 1EC5A 1N8RQ 5HGMA 1T8KA 4PV1D 4IZ6A 3MP7B 2ZXEB 2K9YA 2P58A 2KNCB 2FFDC 4UB8H 1FS0E 3V5BA 2FYZA 1KFNA 1L0NG 5APVA 5F2OA 1LNQA 1BGYG 1EDKA 4PH0A 2XV5A 4IFMA 2GUVA 1S9KE 2CG5B 1RF1A 2JAZA 2GDYA 4I6MC 1LT9C 1URQB 1PEUA 4ASVA 2N5IA 1BXIA 2EG5A 3S1KA 3EJEA 2QE7H 3GHGA 1GL2D 1VQMP 3Q5RA 4XFXA 2N6YA 1K73Q 1L0ND 1FE6A 3H25A 2R5DA 5KLVD 4PD4D 2QVAA 3DS5A 1YJ9P 1BGYD 1VQ9P 3CMEP 2DW3A 3HE4B 1S3JA 4WY4B 2YXQB 1HWTC 4W80A 4H44D 3H1JE 3EJDA 1NU1K 3O6QB 1BSNA 2KR5A 4N78E 3GJNA 1M1KQ 1K05A 1ZOYC 3AE5C 1EQ7A 4XFZA 2E74C 1L0NJ 1IK7A 1KQLA 2WSFH 1IFMA 5KLVJ 5B5EH 2KGAA 1BGYJ 4PV1B 4H0LD 3IF4A 3TGUG 1GMJA 4GR2A 4NPFX 1MZ9A 3OA7A 4IL6E 4C7RA 2O01N 2GUSA 2Y0CA 1MFTA 3CCEP 2BUOA 3RK2D 4ZKPA 2FXOA 4QNBA 3HD7A 3H1LD 1L4AC 1GTWA 1H89A 2MR7A 1JOCA 1GL2B 2J5UA 1IMQA 4U3FE 2WTYA 1EZVI 1AJYA 1BSHA 2Z5IA 5KLVE 4PD4E 4H44B 1BGYE 4I1LA 2ZAEB 5AW6B 2CWOA 2FXMA 1XTCC 1RHZB 2B87B 3H1LJ 1JY2N 2HODB 1M56D 4H2WC 3I55P 3KHUA 4DOJA 2QIWA 3H1KG 3V4QA 1IMPA 1P84H 3AEFC 1OMIA 2FVEA 2HFED 4DJGA 3H32B 5M1BA 5DCKA 4HKZH 5AVYB 5GTIE 1AA0A 2LKMA 1OW7A 2FACA 2WPQA 2K5XA 1K8AQ 2O3JA 3TF5A 2M5AB 1K04A 3Q20A 2NPSC 3V2RA 2E76B 2PRRA 3AEAC 3AE1C 3HE4A 4WY4A 5AVXB 1VQ8P 3AE3C 1X9VA 3BATA 3O6QA 3Q5SA 4W7YA 2W6JH 3E1IA 1VHNA 1GDTA 2CGQA 3AE6C 2E74D 2AFEA 2XNXA 1NTKE 2Z5HA 1SQXG 4A7PA 5KKZB 3M06A 1YJWP 3H1LE 5KP6B 2KS1B 2Q3IA 3LIDA 4I7ZB 2MJZA 2PEOA 5JPAA 3CCJP 2OYIA 3CCVP 1IFJA 2J59M 1IFNA 1PPJG 2YMYA 4BWNA 3DS4A 4COPA 1LTJA 1GXHA 1PGQA 4CA3A 4XA4A 3VTPC 5EW5E 2O01H 2JU1A 2GZEA 1SQXD 1OW6A 3AEGC 3VP8A 1NU1D 1KB9I 1R5SA 2KZJA 1L4AD 1GL2A 1NTME 1JUNA 1VF5C 1H8AA 3BRVB 2JJLA 2N1TB 2KSEA 3NY7B 2JO0A 1UNKA 1WRGA 5HVCA 2KI7B 1PP9G 3BVHA 1IK9A 1SQXJ 1FZCB 3HUSB 1NU1J 3RL0C 1NHLA 2WT7A 2GZJA 4RO0A 2M3BA 3G3ZA 3V4WA 3WU2E 2JU2A 4MRTC 1QVFO 3CXHI 2D2CC 3HZQA 5APXA 5BU5A 2KG6A 1AV1A 2V7QH 3WMM0 1L2PA 1NTZG 3L4FA 1Q90D 2L0QA 1GU4A 2NPSD 1PP9D 1GPJA 1FOSF 1PV3A 2L5GB 4W7ZA 2ZXXA 1YHQP 1FAVA 3FXEA 2IBZD 2AF8A 2MR8A 1HVVA 3MD0A 5EFWB 4NPDA 1PFIA 5TJHA 3MGNA 2JQ4A 2OQQA 1SQPK 2BCCE 5KAFH 2P7JA 2Z44A 2E42A 5AW3B 4XRQA 1SQXE 5CCGC 1UJZA 1NU1E 1EDIA 1PP9J 3H1HG 2K1AA 2KS1A 2QJKC 1SP4A 3NTNA 2FFDA 1LWUC 2PFXA 1CI6B 3P8MC 3B4QA 1A02F 2FY8A 2W6AA 1OX3A 1SQVK 3CC7P 1NAFA 4IL6X 3H0DA 3CXCO 1PZQA 1W2EA 2Q1KA 1QX8A 1J1EB 4TT3H 4L73A 4WB4A 3V2PA 3M9BA 2PEIA 2A45G 2K2QA 2XNDH 2JB0A 1Y9BA 1KILC 1AFOA 2M5RA 3PH0A 2ZVOB 1S72P 1G2CB 5AVSB 2KP8A 1VF5D 4JQ0D 1NKNA 3A5TA 1IC2A 2Q6QA 2PEKA 1W2BO 2IZ0A 4AQRD 2WPTA 4IL6H 2PY8A 4YXWH 2R3SA 5CCHC 3VP9A 3S9OA 1U7JA 3HUSA 2VRSA 1VQLP 5HGOA 3USSA 1M7LA 2IBZE 2O01J 3C9IA 3Q3DA 4GT1A 4Y99B 2ZYAA 1ZMEC 3MZWB 2D2CD 3VMZA 3T97A 3FWLA 4CPGA 3L74D 2JEEA 1ACPA 1HGZA 1YI2P 1HUCA 1AQ5A 2LMLA 1A8OA 2FQ1A 5AW7B 3JSVC 2LXBA 3GHGB 2L4BA 4PD4H 1WT6A 2PAJA 1M8OB 2P67A 3E7KA 3SFDC 2KB7P 4LC1A 2CPBA 1HJBA 1NVOA 3DS2A 2YO2A 3L35A 3CPWO 1VQ4P 2AVAA 2KOPA 1AUMA 3L74J 1VQOP 2H8PD 1YQ4C 3H1JG 1S5LE 1F80D 2WVRA 4D6TE 3M1MA 1S2EA 3WBHA 5GTIH 2EFJA 3CC4P 4LGDE 5KTBA 5CCGD 1L4AA 2V7QJ 1ZLLA 1J2JB 1H0TB 4OVNF 3GZLA 2LIWA 1MUUA 1E6JP 1NJIQ 4UB6E 4YXDC 2NZ2A 3UIAA 3JCUE 2W90A 1ZXGA 1IFIA 3P8CD 2M3EA 3PHLA 4OWFA 4GIFA 3H1JD 1X8YA 5BVZA 1USEA 4AUWA 1LTBC 1BAJA 2JO1A 1JMMA 2I1JA 4OGQC 1GK4A 1KILD 2JR8A 3B5NC 1ZR4A 4F37A 4U0AA 3L73E 3L74E 5DJUB 3HD7B 1PIXA 1KORA 3K5BA 4K3AA 3IR9A 4EYYQ 2NPSA 3AEDC 1BE3G 4U3FG 1A43A 1OFCX 3H1JJ 2Z46A 1HF9A 3RL0g 2W6BA 1FDMA 1NQ4A 5CCHD 4Z1MH 1Z56A 2E1MA 5KLVG 1MZ8A 5AW9B 3QH9A 2HPCA 1X0TA 2FXPA 2ZT9D 1IJDB 2KK7A 2JBGA 4R4MA 2W8ZA 2VLPA 3H6PA 3IFMA 3H47A 2H89C 2XKMA 2YIUC 1JJ2O 1GXGA 2GDWA 2M8LA 1SQBG 3C1LA 1IUQA 3G6EP 1BE3D 4U3FD 3G26A 3M0AA 3ITKA 5APWA 1QRJA 3PP5A 3FXDA 2KOOA 1VQ7P 1JY3N 1DD4A 3EWKA 1T3JA 5AW2B 3P8CE 2H7HA 1JCDA 3WU2H 4XFJA 1P84I 3G71P 2BEZF 3GG2A 2P10A 5HGLA 4DG9A 2CQ8A 1BE3J 4U3FJ 5CBOA 1YQ3C 1SQBD 3DS1A 5AVUB 1H0TA 1Y47A 1KILE 2QM8A 1QL2A 3F5HA 1N73C 4BPHA 1NTKG 1YBKA 4TLFA 1KTMA 1OVVA 1M1JB 1NGMB 1T6AA 2PNGA 3H1LG 1TU3F 1HH0A 1D1DA 2I8DA 2OYIB 2E5TA 1SLQA 5KP7B 5H2FE 2HYNA 1IFDA 3EQ2A 2GZFA 4DT0A 1SQBJ 1VQ5P 1LGHB 4NPEA 7CEIA 3GMAA 2ZT9B 1LTJB 1EXIA 1LTAC 3D6ZA 1M90Q 2WSCJ 1NTKD 1FZGA 3AE4C 2QJYB 1RH5B 1LJ2A 1ZW0A 1NWQA 2FYUK 1NTMG 1RE4C 2L91A 1BE3E 1HQBA 3MUDC 2E75C 2FQ0A 2K9JA 2KORA 1KYOD
chains in the Genus database with same CATH topology
1M1KQ 3CXCO 2JO0A 5DCKA 4PH1A 2QEXP 2JYLA 2OARA 1QRJA 1VQPP 1VQNP 2BQ1E 3CCSP 4XFZA 3G28A 1QVGO 3G29A 2PEIA 2L6EA 3CCMP 1VQ7P 1K8AQ 2JYGA 4COCA 1Q82Q 1E6JP 4U0FA 3Q20A 1NJIQ 2QA4P 4XROA 2XT1A 2Z45A 1S72P 3G71P 5BS2A 1VQ8P 1QVFO 5HGLA 1M74A 4GR2A 3HZQA 5F2NA 3G21A 2PEKA 1W2BO 1VQKP 1ZMBA 3DS1A 1N8RQ 5HGMA 3B5IA 3DPHA 2PY8A 3G0VA 2PEQA 3P05A 5HGNA 2PEMA 2KODA 3I56P 4IPYA 3CCLP 1BAJA 2PEJA 3CCEP 4GR6A 1PEQA 3DS3A 1K9MQ 1VQLP 3CD6P 1YIJP 5HGOA 1YJWP 3DS0A 4U0EA 4U0AA 5F2OA 1M6NA 3HYBA 2BUOA 1PEMA 2OTLP 1PEOA 1K30A 1Q86Q 4WYMA 2XXMA 3OW2O 1D1DA 3VRLC 3CCUP 1RO0A 2PEOA 4QNBA 1YHQP 4PH0A 1KQSO 4XFYA 5JPAA 3CCJP 3CC2P 3CCVP 3NTEA 3H4EA 5F2KA 2P9XA 1YI2P 5I4TG 3G4SP 1KD1Q 1A43A 3LRYA 3MGEA 2Z46A 1VQ5P 2XV6A 2OTJP 1EOQA 2EIAA 3RG6C 1PEUA 1A8OA 1RNIA 2Z44A 3DS4A 4COPA 2M8NA 1KC8Q 2E1MA 4XRQA 2EG5A 1M90Q 2DGYA 1RO2A 3CCRP 1Q7YQ 1VQMP 1M6EX 2PENA 4XFXA 2ONTA 1K73Q 2LF4A 4U0BA 4U0DA 3DTJA 2CWOA 3DS2A 1YITP 3CPWO 3DS5A 1VQ4P 1YJ9P 2BHVA 1AUMA 3E2DA 1YJNP 3CCQP 2M8PA 1VQOP 4M0IA 3H47A 1VQ9P 4U0CA 3CMEP 3I55P 1EIAA 5BS1A 1JJ2O 3G1IA 2M8LA 3G1GA 1IUQA 3G6EP 3M1MA 3CC7P 3CMAP 1VQ6P 3G26A 1Q81Q 3WBHA 2EFJA 3H0DA 3CC4P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K Q;  3CXC O;  3OW2 O;  1Q7Y Q;  3CCU P;  2QEX P;  1VQM P;  1YHQ P;  1W2B O;  1KQS O;  1VQK P;  3CCJ P;  3CC2 P;  1K73 Q;  3CCV P;  1VQP P;  1VQN P;  3CCS P;  1N8R Q;  1QVG O;  1YIT P;  1YI2 P;  3G4S P;  3CPW O;  1VQ7 P;  3CCM P;  1VQ4 P;  1KD1 Q;  1YJ9 P;  1K8A Q;  1VQ5 P;  1YJN P;  1Q82 Q;  3CCQ P;  2OTJ P;  1VQO P;  3I56 P;  1NJI Q;  1VQ9 P;  3CME P;  3CCL P;  3I55 P;  2QA4 P;  1JJ2 O;  3CCE P;  3CC4 P;  1S72 P;  3G71 P;  1K9M Q;  1VQL P;  3CD6 P;  1YIJ P;  1YJW P;  3G6E P;  1KC8 Q;  1VQ8 P;  3CC7 P;  3CMA P;  1QVF O;  1M90 Q;  1VQ6 P;  1Q81 Q;  2OTL P;  1Q86 Q;  3CCR P; 
#chains in the Genus database with same CATH topology
 1Q2N A;  3WUV A;  3NXS A;  1N7S C;  2KIK A;  4UHP B;  1NTK J;  5K5G B;  1QVG O;  1GW3 A;  2JYG A;  2Q7C A;  2IZ1 A;  1CSB A;  2WT7 B;  4H13 C;  5AW0 B;  2QA4 P;  1DH3 A;  5CCG A;  2KW2 A;  5BS2 A;  2J58 A;  2L22 A;  3U1C A;  3AEC C;  1SQB E;  1NTM D;  4GKG A;  3RGU A;  4H2Y C;  1LWU A;  2QRX A;  1M57 D;  2KG9 A;  4H0L B;  1OR5 A;  1FR2 A;  4ASW A;  2E43 A;  3CX5 E;  2O1K A;  2PEQ A;  5HGN A;  2HR3 A;  5E79 H;  4HH2 A;  2LPK A;  2K92 A;  1NO4 A;  1N2D C;  4RKU J;  5EJD A;  4U0E A;  4RES B;  2BEQ D;  2A06 E;  3SWK A;  2YXR B;  2C9L Y;  4XFY A;  1NTM J;  3JC2 2;  4I2L C;  1S5L X;  2OYH C;  1KIL A;  3KPE A;  1BCC D;  1KD1 Q;  3RK2 B;  5KLI B;  2E5Y A;  2KZI A;  2XV6 A;  2BCC G;  1DV5 A;  2GZI A;  1SFC C;  3KZI E;  1M1J A;  1L0L K;  2FAD A;  1NU1 G;  5GTH E;  2VLQ A;  2R44 A;  1Q7Y Q;  1KQF B;  1OIP A;  2FFD B;  5CCH A;  1X3O A;  4HKG A;  1IZN B;  3TDK A;  1HGV A;  1RF1 C;  1S5L H;  5APY A;  4WVZ A;  3PJS K;  1BCC J;  1KYO E;  1JY3 P;  1YTZ T;  1W5C E;  2BCC D;  2MVV A;  2SPZ A;  3VMY A;  1JCC A;  1LT9 B;  3SFE C;  1JY2 O;  1X79 B;  1AYI A;  3GF3 A;  2K0X A;  1ZNV A;  3CCS P;  3G28 A;  1SQQ K;  1GD2 E;  1GZL A;  1IFP A;  1MV8 A;  4UB6 H;  3CWB E;  1J1D C;  3JCU H;  3R2P A;  1RF0 C;  2RMZ A;  2IYP A;  1HTL C;  2V4H A;  3RK3 C;  1A02 J;  2YKQ A;  3V2Q A;  3R4Y A;  1ZN5 A;  1HJ0 A;  2H43 A;  3G21 A;  2KGC A;  1FDI A;  3LW5 J;  2BCC J;  3W67 A;  1N7S D;  1PL5 A;  3PRJ A;  1JB0 J;  2A45 H;  3L72 D;  3P05 A;  2PEM A;  4N6J A;  1QGK B;  2MKV A;  3QWO C;  1FOS E;  5AVZ B;  1EMV A;  2IBZ G;  1T8Z A;  3TNU B;  1AVY A;  1CZQ A;  4IFF A;  2RN0 A;  3H1I G;  1LT1 A;  1G1I A;  2E74 B;  3T97 B;  2FKW B;  1BCC E;  1KV4 A;  2N9B A;  2P9X A;  2EHT A;  4O9B A;  3MGE A;  4RJT A;  2EIA A;  1AQT A;  2CPS A;  3PLN A;  2P2U A;  3L72 J;  3SWF A;  2CNR A;  2M8N A;  2YKP A;  2FYU D;  3AE9 C;  3NMD A;  4EIJ A;  2PEN A;  1RQV A;  2QNW A;  2K0Y A;  1T3U A;  2QJP C;  2LF4 A;  3A3Y B;  3TK1 A;  3H1I D;  1YJN P;  2XU6 A;  2M8P A;  4D6T G;  2Q9I A;  4PD4 I;  2N9Y B;  1SFC D;  1L0H A;  2JDI H;  2W27 A;  1L4A B;  1JY2 P;  2QEX P;  2FYU J;  4OH8 B;  2JWD A;  3HTK A;  3BAS A;  1E5W A;  2FAE A;  1QL1 A;  3BCC G;  3D70 A;  2QSI A;  4QMA A;  4U0F A;  3H1I J;  2ITA A;  3F89 A;  1URQ C;  3CI9 A;  1FZB A;  4YPC A;  2N5H A;  1ZR2 A;  1RQU A;  3BRT B;  3L72 E;  1JEK A;  4D6T D;  1OVU A;  1LT9 A;  2OYO A;  2KGE A;  2WZ7 A;  1EXJ A;  1N86 A;  2W83 C;  3AEB C;  3M91 A;  3RG2 A;  2PEJ A;  3HE5 A;  3DS3 A;  1MFZ A;  3L73 G;  3GF7 A;  3L74 G;  3BCC D;  3EJB A;  3N7N A;  1M6N A;  4WY4 C;  4WBA A;  1HY8 A;  3CCU P;  2R3C A;  5H2F H;  3RK3 D;  5KJ7 C;  2K0D X;  2NPS B;  4EOT A;  5BU8 B;  1VKU A;  2KLU A;  4D6T J;  1FC2 C;  4JYB A;  2OTJ P;  1DIP A;  3RG6 C;  1QEX A;  2FYU E;  1JMB A;  5TIS E;  2FYN C;  1KFM A;  1L0N K;  3RL0 D;  3OAK A;  5KLV K;  3TNU A;  1RO2 A;  2WMM A;  2HPC B;  5KAI E;  3BCC J;  3H1I E;  4PV1 C;  1JNM A;  3L73 D;  3LMO A;  1YIT P;  4JF7 A;  5AW4 B;  2WSE J;  4C46 A;  4IFD K;  1EIA A;  5AW5 B;  2H88 C;  1LP1 A;  2UWJ E;  1SQQ D;  2GA1 A;  3EFG A;  2Y9Z A;  4HB1 A;  3RBX A;  1E79 H;  1S4X A;  3A0B E;  3B8E B;  5AVW B;  1E0H A;  3L73 J;  3ABV C;  5APS A;  2FBW C;  5CJ4 A;  2YMK A;  3Q5P A;  1GL2 C;  2M8R A;  1FZE A;  4DCK A;  1M74 A;  5CJ0 A;  1SQQ J;  5F2N A;  1S1C X;  1RE4 A;  2WSC H;  3CX5 H;  3DPH A;  2WWW A;  1VF5 B;  3L36 A;  3OJA B;  3MUD A;  1DX7 A;  1VL2 A;  3BCC E;  4H44 C;  3I56 P;  3CCL P;  1SQP G;  4GR6 A;  3RK3 E;  2LL8 A;  5DJT B;  1YIJ P;  4KJM A;  1N7S A;  1PEM A;  2OTL P;  4XE5 B;  3ZDM A;  2O1J A;  1URQ D;  3O8Z A;  1KQS O;  1EZV E;  3KQG A;  3RL0 B;  2WPR A;  1YTZ I;  3II6 A;  3LIE A;  2C9N Y;  3KZI H;  2D2C B;  1NKZ B;  2OTK E;  1NH4 A;  1USD A;  1SQV G;  1FDO A;  2E76 C;  3C8V A;  2K93 A;  2LXC B;  5HV8 A;  1SQP D;  2OGU A;  5KJ7 D;  2VLO A;  1ZRT E;  1L0I A;  2KYV A;  3V2N A;  1SQQ E;  1KYO H;  3P7K A;  2KG8 A;  2POH A;  5B66 E;  2K9J B;  3CL3 D;  3AE2 C;  4KT0 J;  5KKZ C;  5APT A;  1VQN P;  2M0B A;  1H88 A;  2VSQ A;  3IN6 A;  1SQV D;  4I7Z C;  1SQP J;  1SFC A;  3CCM P;  1LTI C;  1JM0 A;  4COC A;  4HJG H;  3CXH D;  4XRO A;  1ZP0 C;  3W68 A;  1LTG C;  2KXP B;  2I1K A;  2QJK B;  5AW1 B;  4MN4 C;  2LKI A;  3M9H A;  1LWU B;  3WUU A;  1JTH A;  2B9B A;  4M3L A;  4IPY A;  1SQV J;  5KAF E;  2YNY A;  3CD6 P;  4C7N A;  3DS0 A;  2A06 G;  5AVQ B;  2FVF A;  1K30 A;  3VRL C;  1KLP A;  2FHS C;  3U59 A;  1KIL B;  2N1T C;  2N50 A;  2LIU A;  4BPG A;  1RF0 A;  1G1J A;  2ZJS E;  1RNI A;  2IBZ I;  1SQX K;  1KB9 E;  2GM4 A;  2FQ2 A;  1SQP E;  3CX5 D;  5AVV B;  1FZC C;  3HUS C;  1FJP A;  3M0D C;  1YYC A;  4GDO A;  2DGY A;  2B89 A;  3VYI A;  1M6E X;  1N7L A;  1MKM A;  4U0B A;  2FYN B;  1UII A;  2IFN A;  2A06 D;  2AXT E;  2YO3 A;  1QLE D;  2IFM A;  2MF4 A;  3LW5 H;  2K3R A;  2GDX A;  4AYC A;  2IYO A;  3CMA P;  4OGQ D;  1VQ6 P;  3B5N D;  1Q81 Q;  1R5L A;  2WPS A;  2WSS H;  1SQV E;  5CZD B;  2E76 D;  4IOI H;  3CXH E;  1Y8A A;  3MIW A;  2PP6 A;  3CWB G;  3D6Y A;  4U7J A;  2ERH A;  3VOP A;  1EDL A;  1KZU B;  2N98 A;  3HRN A;  1RE3 C;  1JY3 O;  2MY5 A;  2KOG A;  2ZFC A;  2B88 A;  3PTZ A;  2NO8 A;  4BRY A;  1VQK P;  1ZMB A;  2HLO A;  3CLQ A;  3GZM A;  3TGU D;  2P1J A;  2JWA A;  1NYH A;  2KOD A;  3A0H E;  2KNC A;  2K88 A;  3L37 A;  1PEQ A;  1K9M Q;  3L71 G;  1CEI A;  3Q1M A;  1L0N E;  2Q3E A;  3CWB D;  4PXH B;  1BCC G;  4R4L A;  1RO0 A;  1OZH A;  2IDB A;  3IAO A;  2A45 I;  2LOL A;  1AVO A;  4PJ0 E;  4LLH A;  1NTZ K;  5TIS H;  1EOQ A;  2KWL A;  3TGU J;  4GOF A;  1J1E C;  1URQ A;  4KHX A;  1SS1 A;  3KDP B;  1KMI Z;  1PGJ A;  3TYY A;  5KAI H;  2C0W A;  3CCR P;  2WPV B;  3Q2Y A;  3CWB J;  2MD9 A;  3L71 D;  4OGQ B;  3B5N B;  2N1T D;  3E2D A;  4M0I A;  5BS1 A;  3VN0 A;  2CK3 H;  3SWY A;  2K37 A;  5CBN A;  2K94 A;  5KJ7 A;  1SVF A;  2JYL A;  2OAR A;  3HTK B;  3A0B H;  3H1K D;  4L76 A;  4Y99 C;  3B71 A;  1U57 A;  3MHV A;  1Q82 Q;  1XTG B;  3L71 J;  2PGD A;  4B86 A;  5KP8 B;  3GKL C;  2KOS A;  2LR2 A;  3FGA D;  2Y0E A;  3TGU E;  3L72 G;  2Y9Y A;  2IPP A;  2KLV A;  3GHG C;  1FZF A;  2YIU B;  3B5I A;  5AW8 B;  3AE8 C;  3G0V A;  3H1K J;  3KXD A;  1DEB A;  3HE5 B;  2WSE H;  1CW5 A;  4UB8 E;  4EDF A;  2BAS A;  2AEF A;  1OVR A;  2E75 D;  2KSJ A;  3I5C A;  2N6Z A;  1T2K C;  4L74 A;  2WSF J;  5F2K A;  1NOH A;  3A7O A;  1BDD A;  3P32 A;  3LRY A;  2FYU G;  2WIT A;  3E1R A;  2KGD A;  4H13 D;  1PPJ D;  3FWN A;  3NFQ A;  3L71 E;  2ROQ A;  3V6I A;  1DNY A;  2ONT A;  1N73 B;  4U0D A;  1NAY A;  1GU5 A;  4ZNC A;  3CCQ P;  2B87 A;  1RY3 A;  1FJK A;  5AVR B;  5B66 H;  1LP1 B;  2HOD A;  1AF8 A;  3H1K E;  2VLN A;  3SSU A;  4H2X C;  4PH1 A;  3H32 A;  1OXZ A;  1VQP P;  1P84 D;  2Y0D A;  3HD7 C;  2GZG A;  2L6E A;  4QKO A;  3B5N A;  3G9R A;  2M5A A;  2XT1 A;  2WQY C;  2XDJ A;  5B5E E;  2Z4E A;  3L70 G;  4K35 A;  2X2B A;  1R8E A;  4ZKU A;  2FVA A;  5CHX A;  2E75 B;  3VMX A;  3B4S A;  2RKL A;  1IO4 A;  4NEO A;  3D71 A;  2AEJ A;  2C0X A;  1L0L G;  4BPF A;  1N7S B;  1NTZ D;  2ZYG A;  1PEO A;  2XXM A;  3OW2 O;  5AVT B;  1EZV G;  2MVU A;  3L75 G;  3CX5 I;  3N4X A;  2XZR A;  3CC2 P;  4H13 B;  3NTE A;  2AFD A;  3H4E A;  1Z6M A;  3RBZ A;  5I4T G;  4L75 A;  1PPJ E;  3L70 D;  2Q5U A;  1KB9 H;  2RH0 A;  2IX7 C;  2KOQ A;  1GK6 A;  2YKO A;  1NTZ J;  2AXT H;  2R5B A;  1L0L D;  3M9Q A;  1OWA A;  1SQQ G;  1T2K D;  2L9F A;  3KYQ A;  3H1H D;  2AXC A;  1FU1 A;  1VPC A;  1EZV D;  3L75 D;  4JBZ A;  1LTT C;  3G1I A;  2G8Y A;  3L70 J;  3G1G A;  2AEM A;  3FX0 A;  2OYH B;  1M1J C;  1P84 E;  2N1T A;  3CXH H;  5APQ A;  4GOE A;  2BQ1 E;  3VMA A;  1N73 A;  1SFC B;  3G29 A;  1KYO I;  1PP9 E;  2OYI C;  1L0L J;  2DNW A;  4BXL A;  4GOD A;  4ZMD A;  1BDC A;  5E79 E;  1FZC A;  1ZRT D;  2Z45 A;  2KUB A;  3M0D A;  1SQB K;  3H1H J;  2JGP A;  4PWV B;  3U1A A;  3L75 J;  2XZ1 C;  2ZT9 C;  2HG5 D;  5C39 A;  1LTJ C;  1DEE G;  1VDF A;  3AE7 C;  1RF1 B;  2JKV A;  1KQG B;  1GW4 A;  2R32 A;  1PGP A;  1X22 A;  1U7M A;  5L8R J;  1JTH B;  2QJY C;  3A0H H;  4EI2 A;  1LTS C;  3HD7 D;  2QG4 A;  1NTZ E;  4C7N B;  4Y28 J;  3HYB A;  1Q86 Q;  4WYM A;  1PGO A;  4HYT B;  2JP3 A;  3L70 E;  1J1D B;  4PJ0 H;  3GW6 A;  3G4S P;  1ZV8 A;  1NTK K;  1S9K D;  4JYC A;  3RK3 B;  5CMZ A;  3WUT A;  5APU A;  2LTE A;  1KN7 A;  1RE3 A;  1D7M A;  1KC8 Q;  1L0L E;  3A2A A;  3H1H E;  1EDJ A;  3GLM A;  1HBW A;  3DTJ A;  3L75 E;  2ZVN B;  2XZ0 D;  4DZO A;  2BHV A;  3S4R A;  1CI6 A;  3AEE C;  2QM7 A;  4U0C A;  4JPZ B;  4N3Y B;  1DD3 A;  4H0L C;  2NRG A;  3EFF K;  2G3A A;  4WWI A;  5GTH H;  2EHS A;  3TSI A;  1KB9 D;  4WY4 D;  3CE7 A;  4N78 D;  1OW8 A;  2ZYD A;  1NTM K;  4R0M A;  1UIX A;  1WMK A;  3U43 A;  5KLI C;  3RK2 C;  4YTP C;  3MTU E;  1G2C A;  2QJP B;  1FBM A;  1JO5 A;  4BRY B;  1FZA A;  2OYH A;  2GYK A;  1EC5 A;  1N8R Q;  5HGM A;  1T8K A;  4PV1 D;  4IZ6 A;  3MP7 B;  2ZXE B;  2K9Y A;  2P58 A;  2KNC B;  2FFD C;  4UB8 H;  1FS0 E;  3V5B A;  2FYZ A;  1KFN A;  1L0N G;  5APV A;  5F2O A;  1LNQ A;  1BGY G;  1EDK A;  4PH0 A;  2XV5 A;  4IFM A;  2GUV A;  1S9K E;  2CG5 B;  1RF1 A;  2JAZ A;  2GDY A;  4I6M C;  1LT9 C;  1URQ B;  1PEU A;  4ASV A;  2N5I A;  1BXI A;  2EG5 A;  3S1K A;  3EJE A;  2QE7 H;  3GHG A;  1GL2 D;  1VQM P;  3Q5R A;  4XFX A;  2N6Y A;  1K73 Q;  1L0N D;  1FE6 A;  3H25 A;  2R5D A;  5KLV D;  4PD4 D;  2QVA A;  3DS5 A;  1YJ9 P;  1BGY D;  1VQ9 P;  3CME P;  2DW3 A;  3HE4 B;  1S3J A;  4WY4 B;  2YXQ B;  1HWT C;  4W80 A;  4H44 D;  3H1J E;  3EJD A;  1NU1 K;  3O6Q B;  1BSN A;  2KR5 A;  4N78 E;  3GJN A;  1M1K Q;  1K05 A;  1ZOY C;  3AE5 C;  1EQ7 A;  4XFZ A;  2E74 C;  1L0N J;  1IK7 A;  1KQL A;  2WSF H;  1IFM A;  5KLV J;  5B5E H;  2KGA A;  1BGY J;  4PV1 B;  4H0L D;  3IF4 A;  3TGU G;  1GMJ A;  4GR2 A;  4NPF X;  1MZ9 A;  3OA7 A;  4IL6 E;  4C7R A;  2O01 N;  2GUS A;  2Y0C A;  1MFT A;  3CCE P;  2BUO A;  3RK2 D;  4ZKP A;  2FXO A;  4QNB A;  3HD7 A;  3H1L D;  1L4A C;  1GTW A;  1H89 A;  2MR7 A;  1JOC A;  1GL2 B;  2J5U A;  1IMQ A;  4U3F E;  2WTY A;  1EZV I;  1AJY A;  1BSH A;  2Z5I A;  5KLV E;  4PD4 E;  4H44 B;  1BGY E;  4I1L A;  2ZAE B;  5AW6 B;  2CWO A;  2FXM A;  1XTC C;  1RHZ B;  2B87 B;  3H1L J;  1JY2 N;  2HOD B;  1M56 D;  4H2W C;  3I55 P;  3KHU A;  4DOJ A;  2QIW A;  3H1K G;  3V4Q A;  1IMP A;  1P84 H;  3AEF C;  1OMI A;  2FVE A;  2HFE D;  4DJG A;  3H32 B;  5M1B A;  5DCK A;  4HKZ H;  5AVY B;  5GTI E;  1AA0 A;  2LKM A;  1OW7 A;  2FAC A;  2WPQ A;  2K5X A;  1K8A Q;  2O3J A;  3TF5 A;  2M5A B;  1K04 A;  3Q20 A;  2NPS C;  3V2R A;  2E76 B;  2PRR A;  3AEA C;  3AE1 C;  3HE4 A;  4WY4 A;  5AVX B;  1VQ8 P;  3AE3 C;  1X9V A;  3BAT A;  3O6Q A;  3Q5S A;  4W7Y A;  2W6J H;  3E1I A;  1VHN A;  1GDT A;  2CGQ A;  3AE6 C;  2E74 D;  2AFE A;  2XNX A;  1NTK E;  2Z5H A;  1SQX G;  4A7P A;  5KKZ B;  3M06 A;  1YJW P;  3H1L E;  5KP6 B;  2KS1 B;  2Q3I A;  3LID A;  4I7Z B;  2MJZ A;  2PEO A;  5JPA A;  3CCJ P;  2OYI A;  3CCV P;  1IFJ A;  2J59 M;  1IFN A;  1PPJ G;  2YMY A;  4BWN A;  3DS4 A;  4COP A;  1LTJ A;  1GXH A;  1PGQ A;  4CA3 A;  4XA4 A;  3VTP C;  5EW5 E;  2O01 H;  2JU1 A;  2GZE A;  1SQX D;  1OW6 A;  3AEG C;  3VP8 A;  1NU1 D;  1KB9 I;  1R5S A;  2KZJ A;  1L4A D;  1GL2 A;  1NTM E;  1JUN A;  1VF5 C;  1H8A A;  3BRV B;  2JJL A;  2N1T B;  2KSE A;  3NY7 B;  2JO0 A;  1UNK A;  1WRG A;  5HVC A;  2KI7 B;  1PP9 G;  3BVH A;  1IK9 A;  1SQX J;  1FZC B;  3HUS B;  1NU1 J;  3RL0 C;  1NHL A;  2WT7 A;  2GZJ A;  4RO0 A;  2M3B A;  3G3Z A;  3V4W A;  3WU2 E;  2JU2 A;  4MRT C;  1QVF O;  3CXH I;  2D2C C;  3HZQ A;  5APX A;  5BU5 A;  2KG6 A;  1AV1 A;  2V7Q H;  3WMM 0;  1L2P A;  1NTZ G;  3L4F A;  1Q90 D;  2L0Q A;  1GU4 A;  2NPS D;  1PP9 D;  1GPJ A;  1FOS F;  1PV3 A;  2L5G B;  4W7Z A;  2ZXX A;  1YHQ P;  1FAV A;  3FXE A;  2IBZ D;  2AF8 A;  2MR8 A;  1HVV A;  3MD0 A;  5EFW B;  4NPD A;  1PFI A;  5TJH A;  3MGN A;  2JQ4 A;  2OQQ A;  1SQP K;  2BCC E;  5KAF H;  2P7J A;  2Z44 A;  2E42 A;  5AW3 B;  4XRQ A;  1SQX E;  5CCG C;  1UJZ A;  1NU1 E;  1EDI A;  1PP9 J;  3H1H G;  2K1A A;  2KS1 A;  2QJK C;  1SP4 A;  3NTN A;  2FFD A;  1LWU C;  2PFX A;  1CI6 B;  3P8M C;  3B4Q A;  1A02 F;  2FY8 A;  2W6A A;  1OX3 A;  1SQV K;  3CC7 P;  1NAF A;  4IL6 X;  3H0D A;  3CXC O;  1PZQ A;  1W2E A;  2Q1K A;  1QX8 A;  1J1E B;  4TT3 H;  4L73 A;  4WB4 A;  3V2P A;  3M9B A;  2PEI A;  2A45 G;  2K2Q A;  2XND H;  2JB0 A;  1Y9B A;  1KIL C;  1AFO A;  2M5R A;  3PH0 A;  2ZVO B;  1S72 P;  1G2C B;  5AVS B;  2KP8 A;  1VF5 D;  4JQ0 D;  1NKN A;  3A5T A;  1IC2 A;  2Q6Q A;  2PEK A;  1W2B O;  2IZ0 A;  4AQR D;  2WPT A;  4IL6 H;  2PY8 A;  4YXW H;  2R3S A;  5CCH C;  3VP9 A;  3S9O A;  1U7J A;  3HUS A;  2VRS A;  1VQL P;  5HGO A;  3USS A;  1M7L A;  2IBZ E;  2O01 J;  3C9I A;  3Q3D A;  4GT1 A;  4Y99 B;  2ZYA A;  1ZME C;  3MZW B;  2D2C D;  3VMZ A;  3T97 A;  3FWL A;  4CPG A;  3L74 D;  2JEE A;  1ACP A;  1HGZ A;  1YI2 P;  1HUC A;  1AQ5 A;  2LML A;  1A8O A;  2FQ1 A;  5AW7 B;  3JSV C;  2LXB A;  3GHG B;  2L4B A;  4PD4 H;  1WT6 A;  2PAJ A;  1M8O B;  2P67 A;  3E7K A;  3SFD C;  2KB7 P;  4LC1 A;  2CPB A;  1HJB A;  1NVO A;  3DS2 A;  2YO2 A;  3L35 A;  3CPW O;  1VQ4 P;  2AVA A;  2KOP A;  1AUM A;  3L74 J;  1VQO P;  2H8P D;  1YQ4 C;  3H1J G;  1S5L E;  1F80 D;  2WVR A;  4D6T E;  3M1M A;  1S2E A;  3WBH A;  5GTI H;  2EFJ A;  3CC4 P;  4LGD E;  5KTB A;  5CCG D;  1L4A A;  2V7Q J;  1ZLL A;  1J2J B;  1H0T B;  4OVN F;  3GZL A;  2LIW A;  1MUU A;  1E6J P;  1NJI Q;  4UB6 E;  4YXD C;  2NZ2 A;  3UIA A;  3JCU E;  2W90 A;  1ZXG A;  1IFI A;  3P8C D;  2M3E A;  3PHL A;  4OWF A;  4GIF A;  3H1J D;  1X8Y A;  5BVZ A;  1USE A;  4AUW A;  1LTB C;  1BAJ A;  2JO1 A;  1JMM A;  2I1J A;  4OGQ C;  1GK4 A;  1KIL D;  2JR8 A;  3B5N C;  1ZR4 A;  4F37 A;  4U0A A;  3L73 E;  3L74 E;  5DJU B;  3HD7 B;  1PIX A;  1KOR A;  3K5B A;  4K3A A;  3IR9 A;  4EYY Q;  2NPS A;  3AED C;  1BE3 G;  4U3F G;  1A43 A;  1OFC X;  3H1J J;  2Z46 A;  1HF9 A;  3RL0 g;  2W6B A;  1FDM A;  1NQ4 A;  5CCH D;  4Z1M H;  1Z56 A;  2E1M A;  5KLV G;  1MZ8 A;  5AW9 B;  3QH9 A;  2HPC A;  1X0T A;  2FXP A;  2ZT9 D;  1IJD B;  2KK7 A;  2JBG A;  4R4M A;  2W8Z A;  2VLP A;  3H6P A;  3IFM A;  3H47 A;  2H89 C;  2XKM A;  2YIU C;  1JJ2 O;  1GXG A;  2GDW A;  2M8L A;  1SQB G;  3C1L A;  1IUQ A;  3G6E P;  1BE3 D;  4U3F D;  3G26 A;  3M0A A;  3ITK A;  5APW A;  1QRJ A;  3PP5 A;  3FXD A;  2KOO A;  1VQ7 P;  1JY3 N;  1DD4 A;  3EWK A;  1T3J A;  5AW2 B;  3P8C E;  2H7H A;  1JCD A;  3WU2 H;  4XFJ A;  1P84 I;  3G71 P;  2BEZ F;  3GG2 A;  2P10 A;  5HGL A;  4DG9 A;  2CQ8 A;  1BE3 J;  4U3F J;  5CBO A;  1YQ3 C;  1SQB D;  3DS1 A;  5AVU B;  1H0T A;  1Y47 A;  1KIL E;  2QM8 A;  1QL2 A;  3F5H A;  1N73 C;  4BPH A;  1NTK G;  1YBK A;  4TLF A;  1KTM A;  1OVV A;  1M1J B;  1NGM B;  1T6A A;  2PNG A;  3H1L G;  1TU3 F;  1HH0 A;  1D1D A;  2I8D A;  2OYI B;  2E5T A;  1SLQ A;  5KP7 B;  5H2F E;  2HYN A;  1IFD A;  3EQ2 A;  2GZF A;  4DT0 A;  1SQB J;  1VQ5 P;  1LGH B;  4NPE A;  7CEI A;  3GMA A;  2ZT9 B;  1LTJ B;  1EXI A;  1LTA C;  3D6Z A;  1M90 Q;  2WSC J;  1NTK D;  1FZG A;  3AE4 C;  2QJY B;  1RH5 B;  1LJ2 A;  1ZW0 A;  1NWQ A;  2FYU K;  1NTM G;  1RE4 C;  2L91 A;  1BE3 E;  1HQB A;  3MUD C;  2E75 C;  2FQ0 A;  2K9J A;  2KOR A;  1KYO D; 
#chains in the Genus database with same CATH homology
 1M1K Q;  3CXC O;  2JO0 A;  5DCK A;  4PH1 A;  2QEX P;  2JYL A;  2OAR A;  1QRJ A;  1VQP P;  1VQN P;  2BQ1 E;  3CCS P;  4XFZ A;  3G28 A;  1QVG O;  3G29 A;  2PEI A;  2L6E A;  3CCM P;  1VQ7 P;  1K8A Q;  2JYG A;  4COC A;  1Q82 Q;  1E6J P;  4U0F A;  3Q20 A;  1NJI Q;  2QA4 P;  4XRO A;  2XT1 A;  2Z45 A;  1S72 P;  3G71 P;  5BS2 A;  1VQ8 P;  1QVF O;  5HGL A;  1M74 A;  4GR2 A;  3HZQ A;  5F2N A;  3G21 A;  2PEK A;  1W2B O;  1VQK P;  1ZMB A;  3DS1 A;  1N8R Q;  5HGM A;  3B5I A;  3DPH A;  2PY8 A;  3G0V A;  2PEQ A;  3P05 A;  5HGN A;  2PEM A;  2KOD A;  3I56 P;  4IPY A;  3CCL P;  1BAJ A;  2PEJ A;  3CCE P;  4GR6 A;  1PEQ A;  3DS3 A;  1K9M Q;  1VQL P;  3CD6 P;  1YIJ P;  5HGO A;  1YJW P;  3DS0 A;  4U0E A;  4U0A A;  5F2O A;  1M6N A;  3HYB A;  2BUO A;  1PEM A;  2OTL P;  1PEO A;  1K30 A;  1Q86 Q;  4WYM A;  2XXM A;  3OW2 O;  1D1D A;  3VRL C;  3CCU P;  1RO0 A;  2PEO A;  4QNB A;  1YHQ P;  4PH0 A;  1KQS O;  4XFY A;  5JPA A;  3CCJ P;  3CC2 P;  3CCV P;  3NTE A;  3H4E A;  5F2K A;  2P9X A;  1YI2 P;  5I4T G;  3G4S P;  1KD1 Q;  1A43 A;  3LRY A;  3MGE A;  2Z46 A;  1VQ5 P;  2XV6 A;  2OTJ P;  1EOQ A;  2EIA A;  3RG6 C;  1PEU A;  1A8O A;  1RNI A;  2Z44 A;  3DS4 A;  4COP A;  2M8N A;  1KC8 Q;  2E1M A;  4XRQ A;  2EG5 A;  1M90 Q;  2DGY A;  1RO2 A;  3CCR P;  1Q7Y Q;  1VQM P;  1M6E X;  2PEN A;  4XFX A;  2ONT A;  1K73 Q;  2LF4 A;  4U0B A;  4U0D A;  3DTJ A;  2CWO A;  3DS2 A;  1YIT P;  3CPW O;  3DS5 A;  1VQ4 P;  1YJ9 P;  2BHV A;  1AUM A;  3E2D A;  1YJN P;  3CCQ P;  2M8P A;  1VQO P;  4M0I A;  3H47 A;  1VQ9 P;  4U0C A;  3CME P;  3I55 P;  1EIA A;  5BS1 A;  1JJ2 O;  3G1I A;  2M8L A;  3G1G A;  1IUQ A;  3G6E P;  3M1M A;  3CC7 P;  3CMA P;  1VQ6 P;  3G26 A;  1Q81 Q;  3WBH A;  2EFJ A;  3H0D A;  3CC4 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...