2OTJP

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2otjP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 2otjP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 2otjP02
3I55P 3CMAP 3OW2O 1VQ7P 3CPWO 1Q81Q 3CCQP 1VQMP 1S72P 1YJNP 3I56P 1VQ6P 1VQ5P 3CC4P 1VQOP 1Q86Q 1N8RQ 1K8AQ 3CXCO 1YHQP 1QVGO 1YJ9P 1VQ8P 1VQLP 1YI2P 1Q7YQ 1VQPP 1KC8Q 1VQNP 2OTJP 1NJIQ 1KD1Q 1M1KQ 3CMEP 1K73Q 1VQ4P 3G6EP 1VQ9P 2QA4P 1Q82Q 1JJ2O 3G71P 1YJWP 1M90Q 1W2BO 3CCRP 3CCSP 3CCEP 1QVFO 3CC2P 3CCLP 1K9MQ 1KQSO 2QEXP 3CD6P 3CCVP 3CC7P 1VQKP 3CCMP 3CCUP 3CCJP 1YITP 1YIJP 3G4SP 2OTLP
chains in the Genus database with same CATH superfamily
3L72J 3WMM0 1NU1J 4L73A 3CC4P 1EZVE 2JWDA 4UB8H 1KILD 1HVVA 4EIJA 3H1KD 4XA4A 1QVFO 3B5NB 1EZVI 4AQRD 1NWQA 3MUDA 1K05A 4N3YB 1S5LE 3K5BA 2WPSA 1DV5A 1PP9E 1EZVG 3GW6A 3AEDC 5AW4B 3FXDA 3HZQA 2XV6A 2Y9YA 1S3JA 2H7HA 1RE3A 4CA3A 3NFQA 1N7SA 2LKMA 3VMZA 1SQQD 2K88A 3WU2H 3JCUH 2MVVA 3L74E 2FAEA 5AW3B 2JQ4A 1NJIQ 1K73Q 2O01N 2VLPA 2P7JA 3TGUJ 1PP9G 3LMOA 3P32A 3L75D 1H0TA 1U57A 2E74C 5KP7B 3E7KA 5DJTB 3L72D 3V5BA 3VP9A 4IPYA 1QL2A 2OTJP 3DS4A 1NTMG 1W2EA 2QE7H 2ROQA 4PH1A 3RBXA 1YJWP 5AVUB 4UB8E 2N5HA 3HUSC 2E76D 1DX7A 1RY3A 3MIWA 2KGEA 2QJKC 1GL2A 3CXHI 1FAVA 3A7OA 3S9OA 2YO2A 1KD1Q 2FYUG 2RH0A 3HTKB 3MHVA 5APSA 3LIEA 1P84D 1FZFA 4GOFA 5HGOA 2ZVNB 3KXDA 1VF5D 2WSFJ 2IBZE 4BXLA 1Q90D 4PJ0H 1VQ6P 1M1JC 5B5EH 1KILA 2NPSC 3VRLC 1KC8Q 3A0BE 2Y0EA 1M1JA 2YKQA 1LNQA 3VTPC 2GZIA 3U1AA 1KQFB 3CCJP 2QSIA 3Q5RA 2Q7CA 1GD2E 4RESB 2M8NA 4H44B 1BSHA 1RNIA 1OX3A 3AEGC 1J1EB 4OWFA 3HD7A 4H0LC 3G28A 3WBHA 3CCRP 3M0DC 1JB0J 4DT0A 4A7PA 5BVZA 2L0QA 1L0IA 1ACPA 1L0LE 1RF1B 2Q6QA 1Z56A 3T97A 1ZNVA 3G1GA 3AE5C 2LXCB 5I4TG 2QJYC 4R0MA 4DZOA 2FXMA 2OARA 4O9BA 3MGNA 1SQXK 4IL6E 3EJBA 5B66E 2KG8A 5AW1B 1KORA 1SQPE 2IYPA 1NH4A 3KZIH 1YHQP 1HF9A 4H44C 2M8RA 4U3FD 1HUCA 4JYBA 2KLVA 4OH8B 2N98A 2ERHA 3A0BH 1JY3P 1ZRTE 2OQQA 2QRXA 3IR9A 1AJYA 2N1TC 3B4SA 4WY4C 3V2PA 2E75B 2K1AA 1PGOA 3TGUD 3KDPB 2W6AA 3L71G 4HJGH 5E79E 1X3OA 1ZMEC 2AXTE 1BGYD 1JTHB 1GW3A 4JPZB 2E74B 4C7RA 1IFNA 2FYNC 2E5YA 5AVRB 3M9HA 5KKZC 1DH3A 1FOSE 4D6TD 1BGYE 2MR7A 4U0FA 2AEFA 1AQ5A 1KB9I 4IFFA 1OWAA 1GU4A 3DS0A 4H0LB 1USDA 1VQPP 1VQNP 3L71E 3GHGB 5GTIH 1SVFA 3JCUE 4ZMDA 2Q3EA 3SWKA 3G4SP 1L4AD 1FJPA 1LWUC 3CMAP 1H88A 2XV5A 3TGUG 2KOOA 2D2CD 3M9BA 2WWWA 2GDYA 4HB1A 1HWTC 1AUMA 2BCCG 3RK2B 1E79H 4BWNA 3HD7B 3IF4A 2AF8A 2GZEA 1Q2NA 1G2CB 3HTKA 3RG6C 4HYTB 2P1JA 3W68A 2E42A 1NHLA 2I8DA 3BCCG 2J58A 1Q81Q 1K04A 1RO0A 2R3CA 2N50A 3TYYA 5AW7B 2ZT9C 3MGEA 2KZIA 4K35A 1SQVG 1DIPA 1VQKP 2YKOA 1MZ8A 2B89A 1HQBA 3R4YA 3AEBC 3QH9A 1URQC 3AEFC 2PNGA 1YQ4C 1S9KD 2JGPA 3L73J 5AW2B 4TT3H 3DS1A 3FWLA 2WPVB 3SWYA 1SQBD 4NPEA 2R32A 4QNBA 5B5EE 2A45H 1N7SD 1K30A 4EYYQ 1S1CX 2VLOA 3F89A 1IO4A 1M7LA 2FFDA 1L0LJ 1H89A 3L36A 1LGHB 1JO5A 4WYMA 1LP1B 1DD4A 4GODA 1LTTC 1IMQA 5CCGA 2W27A 1SQVD 2KORA 4HKGA 1N7SC 4IL6X 4YPCA 4PV1C 1RE4A 1GK6A 4NPDA 2PENA 2A45G 1AYIA 5KLIC 3G0VA 4PXHB 2KNCA 4PD4D 5APTA 3LW5H 3RG2A 4WVZA 4M3LA 4H13B 3AE6C 1OVVA 4W7YA 2FACA 2AVAA 4N6JA 5H2FE 2K9YA 2QM7A 3C1LA 1IK7A 1M56D 3LRYA 1BXIA 2KS1A 2R3SA 4C7NB 5AW5B 1L4AB 2RN0A 1KTMA 1GK4A 3FWNA 1Z6MA 3A0HE 2IFMA 1VDFA 3HD7C 3L73G 4GT1A 2BCCE 1S4XA 2KZJA 4BPHA 2A06E 1RF1A 3VP8A 2CNRA 4N78D 4GKGA 5CCHD 2YNYA 1AF8A 1PEMA 4C7NA 2XT1A 1U7JA 2GZFA 2OYIB 1KILE 4EDFA 3P8MC 4U3FE 5AVYB 1RHZB 1M1JB 2FQ1A 4HKZH 1HTLC 3HUSB 3OAKA 1X8YA 5AVSB 3MP7B 3AE4C 5HV8A 5AW6B 1LTJB 2P58A 3CPWO 1OW8A 3TGUE 2N1TB 5KJ7A 1OIPA 2FVAA 3NTNA 3CCEP 2ZT9B 3OA7A 3RL0g 3U59A 3L71J 1BSNA 4C46A 1KFMA 2OYHA 4D6TE 2LOLA 1FC2C 2KW2A 1NTZK 2ZYAA 2BUOA 4COPA 5KLVJ 1CEIA 2FYUJ 4RO0A 1AFOA 4PH0A 2M3EA 3C9IA 2JR8A 2FYUK 3AE2C 2JO1A 3GMAA 3WUTA 1M1KQ 1FZAA 3B8EB 2WMMA 3AE9C 3KPEA 4W7ZA 2ITAA 1YIJP 1FZEA 1CZQA 3G1IA 2HODB 3QWOC 2KSEA 1JEKA 3I5CA 2Y0DA 2Y0CA 5HGNA 1PEOA 2QJKB 1JY3N 1G1IA 1T8KA 2ZJSE 2KNCB 3FX0A 3TNUA 1EDJA 3CC2P 3L70G 3H1LG 1IFIA 1IFPA 3RK2D 2PY8A 2QJPB 3CLQA 4U0AA 1J2JB 2LMLA 1MFTA 3AE1C 2VRSA 1PGQA 1R8EA 2DW3A 1E0HA 2MKVA 2HLOA 1HH0A 3RBZA 1SQXD 1PZQA 3UIAA 2GUSA 2O1JA 2DNWA 1N86A 2H8PD 2Y9ZA 3S4RA 1P84E 1OVUA 5KLVG 1NYHA 2H88C 3H1JG 2YMKA 2Z4EA 5CBOA 1SQQE 2EHSA 2YO3A 2FY8A 1NGMB 3PP5A 1RF0A 4PD4H 2E43A 3HE4A 3PTZA 1NTMK 2FQ0A 5F2NA 1JTHA 3LW5J 2GZGA 2ZVOB 5L8RJ 3WU2E 1PEQA 1BE3E 2GUVA 5TISH 2JP3A 5AW0B 1R5SA 5HVCA 1QLED 3B5NC 2N6ZA 1P84I 2FKWB 5F2OA 1Y9BA 4H2XC 4XFXA 2KOPA 3I55P 4Y99C 2CPBA 1DD3A 2IYOA 4IOIH 2JYLA 1EDIA 1UJZA 4Y99B 5AVWB 2YKPA 1LT9C 1SFCA 2V4HA 5CBNA 1BE3D 2GZJA 3FGAD 3CXHH 2OYOA 3GZLA 2Q3IA 2E75C 2FXPA 4WBAA 2K0YA 2GDWA 3Q20A 3B71A 4OGQD 1ZOYC 2GDXA 3G21A 2PEQA 3DTJA 1M6NA 2IPPA 5TJHA 1PL5A 1VQ8P 1VQLP 4U0EA 2BHVA 1SLQA 2JYGA 2JB0A 2QIWA 1WMKA 1BGYJ 4OGQB 2IX7C 3N4XA 2EIAA 2IFNA 4AYCA 3L4FA 1N73C 1AVOA 2CQ8A 1E5WA 2D2CB 1SQPD 3CI9A 5KLIB 5AW9B 4LLHA 4JF7A 1NTZJ 3HRNA 3B5ND 1BDCA 1RF0C 3H1ID 1PGJA 3V2QA 3DS3A 1UNKA 1LTBC 2FXOA 4W80A 4BRYA 2XNXA 2ZYGA 3H1IE 4H2YC 2E5TA 5KAIH 2W90A 2EHTA 3RL0D 1N7LA 1MUUA 1IZNB 1EZVD 2QEXP 2GA1A 2ZXEB 3PJSK 4I7ZC 4EOTA 4ZKUA 2C9LY 2HPCB 2WZ7A 1QVGO 4EI2A 1AV1A 1FU1A 3E1IA 1Q7YQ 2KGAA 1YTZI 2P67A 3NY7B 1JY3O 3DS5A 3G3ZA 3U1CA 2BQ1E 2NPSD 1GU5A 2POHA 5APXA 2ONTA 2OGUA 5H2FH 3IFMA 1BCCJ 4H13C 1N73A 3O6QB 1HJBA 2CWOA 2N6YA 3M1MA 1L0HA 2K94A 2KWLA 2K2QA 4NPFX 5AVTB 3G26A 4DG9A 1NAFA 1DEBA 1FZCA 3H4EA 4U7JA 3L70J 2O1KA 2KOQA 3E2DA 5GTHE 1BE3G 2MJZA 5DJUB 1FS0E 1SQBE 3BVHA 3WUUA 3EJDA 2R44A 1SFCC 3RL0C 4ASVA 1E6JP 4XFJA 3TSIA 2LF4A 2P9XA 3H1KG 2XDJA 1WRGA 2MY5A 2KP8A 2IZ0A 2L4BA 3KZIE 1IC2A 1S72P 2AFEA 3EJEA 1M74A 2WSSH 1GL2D 3H1HD 1EC5A 2N5IA 1KILC 1KQGB 2NPSA 4L75A 4UB6E 1JJ2O 2RMZA 3V4QA 3LIDA 5KLVK 1SQQK 2FYZA 3CD6P 1FJKA 3H1HE 3CCMP 1SQBK 1KB9H 3GF3A 1D1DA 2E76B 5CMZA 1VPCA 1N8RQ 3H32A 3RK3C 5CZDB 2ZYDA 2JBGA 1SQXJ 4GR2A 2WSFH 1HGZA 3CX5E 2EG5A 2OYHB 4MN4C 1H8AA 1PEUA 1T3UA 1QX8A 3GZMA 2CPSA 2PEOA 1RQVA 2C0XA 1NTKE 5APWA 3TDKA 1L0NK 1S2EA 1PV3A 3I56P 1FZBA 2PEIA 4DOJA 1OZHA 2ZFCA 3GHGC 1NTKD 4PV1B 1IUQA 1LTJC 1VQ9P 5CJ4A 3H1JJ 2J5UA 2N1TA 1ZN5A 3O8ZA 1OMIA 3E1RA 1QRJA 2PRRA 3CX5D 3H1JE 2Q1KA 1Y8AA 1G2CA 2QJPC 1L0LG 3Q5SA 1WT6A 5KP8B 3G29A 2QA4P 2L6EA 4RKUJ 2KOSA 3SSUA 3KYQA 1OW6A 1X9VA 1NTZE 1NVOA 3P05A 1NTMJ 2KI7B 2YXRB 1JMMA 4NEOA 5E79H 5KP6B 3W67A 3KHUA 2W6BA 4JYCA 3MUDC 2B9BA 4H0LD 4HH2A 1BCCD 1ZMBA 3CWBG 1JY2P 4JQ0D 2LKIA 2LTEA 1VF5B 2K9JB 2N1TD 3CXHE 1EQ7A 2QVAA 4U3FG 2HG5D 2OYHC 4IL6H 3BCCJ 3CXHD 1FDOA 2Q5UA 3M06A 1PP9D 2PAJA 3CCSP 1HGVA 3AEEC 4OVNF 5CJ0A 2FVEA 2C9NY 3CE7A 4QMAA 2OYIC 3M91A 1G1JA 2FYUE 2OTLP 4XE5B 5APQA 1VQ5P 1VQOP 2JWAA 1YBKA 2KB7P 1NQ4A 3H0DA 4H13D 2XZ0D 1OR5A 1L0NE 3H25A 1XTCC 5CHXA 1CSBA 4I7ZB 2JU1A 1SQVK 4CPGA 1T2KC 3PRJA 3EFGA 3D6ZA 1N73B 1GXGA 4GIFA 1SQXE 3H1IG 1YI2P 1URQB 1OVRA 2IDBA 3G71P 1KYOE 3CCLP 3DPHA 3TF5A 2WSCH 1NTKG 1BE3J 1FOSF 2M8PA 2CG5B 1NU1D 3HD7D 1SQQJ 4ASWA 2KS1B 4LGDE 2KODA 1U7MA 2LL8A 4BPFA 1VQ4P 1IJDB 4XRQA 2ZAEB 3R2PA 1W2BO 4L76A 1KLPA 1SQPK 3HE5B 3SFEC 2W83C 3P7KA 2QG4A 4M0IA 2KYVA 4WWIA 3CX5I 3HYBA 2M5RA 4D6TJ 2G3AA 2V7QH 5BU8B 1Q86Q 2GYKA 2PEMA 2I1KA 1LWUB 1SFCB 1R5LA 1YYCA 5DCKA 4BPGA 3PHLA 1NU1E 1KQSO 2EFJA 3CC7P 2QM8A 2YIUC 1NU1G 2M3BA 2HPCA 3CX5H 2WITA 2FADA 3OJAB 3VMAA 1NTMD 4IZ6A 2M0BA 2FFDC 1LTJA 2O3JA 3L75J 1AA0A 4IFDK 1PFIA 3RK3B 2L91A 5KAFH 2Z46A 4U3FJ 2KUBA 1OXZA 4ZNCA 1AQTA 5CCGC 4PWVB 1X22A 3V2NA 3C8VA 4YXDC 2W6JH 1YJNP 1RE3C 4XROA 4L74A 2Q9IA 3BASA 5CCHA 1PPJG 1SP4A 2JDIH 3SWFA 3GHGA 4YTPC 7CEIA 2KSJA 1HY8A 2PGDA 3H47A 2A45I 1FR2A 1YTZT 3ZDMA 3OW2O 1ZP0C 4B86A 1VQMP 1SQVE 2YMYA 1NOHA 3L35A 1PIXA 2M5AB 2JJLA 2YXQB 2K0XA 5APUA 2KR5A 5AVQB 2VSQA 1QL1A 3AE8C 5KJ7C 1NTKK 3NMDA 3BATA 3BRVB 2HYNA 4BRYB 1KV4A 2WPRA 4GOEA 1RF1C 2A06D 2KGDA 3F5HA 4JBZA 2XU6A 2FHSC 5KKZB 3H1KJ 1BCCE 1NU1K 2K5XA 3Q5PA 1JCDA 1VL2A 2SPZA 2CK3H 1ZR4A 1L2PA 1UIIA 1IK9A 1EXIA 3BCCE 2B87B 1ZRTD 1EDKA 2ZT9D 5APYA 5C39A 1MKMA 3CWBE 3BCCD 3CCVP 3L71D 5BU5A 2MVUA 1KYOI 5EW5E 1VKUA 4R4MA 1GL2C 1BGYG 1JM0A 1RO2A 2WSCJ 4PJ0E 5APVA 5M1BA 1YJ9P 3Q3DA 1N2DC 4I2LC 5AVXB 3L75G 3H1KE 2LIUA 2O01H 1YQ3C 1L0ND 5KJ7D 1FZGA 1IMPA 3GLMA 1KQLA 3L75E 3P8CE 1W5CE 2KG9A 2PEKA 3L70D 1M6EX 1LTGC 1LT9B 3CWBD 5KTBA 4F37A 4UB6H 1JY2N 1EOQA 3TNUB 1A8OA 2K0DX 1D7MA 1L4AC 1URQD 3V2RA 2K93A 3T97B 2JKVA 1KFNA 1JMBA 3IN6A 2LR2A 3CWBJ 2FQ2A 2P2UA 1FZCB 4XFYA 4U0DA 2A06G 2B87A 1IFJA 3L70E 1ZR2A 3JSVC 5GTIE 3L73E 3A5TA 2WT7B 1YITP 2IBZD 1LTAC 1GPJA 2H89C 3S1KA 2XXMA 3TK1A 3RGUA 1N7SB 1FE6A 3L74D 1SS1A 2L9FA 1LTIC 1USEA 2Z5HA 2HR3A 2M8LA 3U43A 3RK3D 1S9KE 2B88A 2FBWC 4TLFA 3H32B 2AEMA 1A02J 3RK2C 2G8YA 3D70A 1NTME 2MF4A 3AECC 1SQVJ 2OYIA 4UHPB 2WSEH 4U0BA 3RL0B 2K92A 3L73D 1F80D 1ZXGA 2QJYB 2LXBA 2UWJE 3AE7C 4KHXA 3USSA 2R5DA 1VHNA 3VN0A 2KK7A 5CCGD 1GMJA 4PD4E 3D71A 5B66H 1ZV8A 1PGPA 1M57D 2FFDB 2K9JA 1SQBG 2DGYA 1FZCC 3L74G 2WT7A 5KAIE 2FYNB 3GKLC 5F2KA 1DEEG 1JOCA 3G9RA 3HUSA 2OTKE 1JUNA 2RKLA 2XNDH 1EXJA 2PP6A 1NTZD 2Z44A 2X2BA 4PV1D 5HGMA 3GG2A 1S5LH 4WY4A 4KT0J 4U0CA 2GM4A 4WY4B 1OFCX 3H1JD 3GF7A 1VF5C 2FVFA 5EFWB 3N7NA 1DNYA 1S5LX 1L0NJ 1M90Q 1RE4C 1QGKB 4RJTA 1RH5B 1TU3F 2KGCA 3VMXA 2L5GB 4YXWH 1K8AQ 2E76C 4AUWA 1GDTA 1KB9D 2J59M 1MV8A 1L0LK 3GJNA 1M8OB 4Z1MH 1HBWA 1FBMA 3L74J 1RQUA 4LC1A 2BCCJ 2JO0A 1PPJD 5AW8B 2BEZF 1LP1A 2IZ1A 2WQYC 3HE5A 1A43A 1A02F 3M0AA 2KLUA 3A2AA 1CI6B 2QNWA 1T2KD 2N9YB 4KJMA 1MZ9A 3B5IA 3A0HH 1KB9E 3L37A 1EMVA 1GL2B 1GW4A 3PH0A 2WTYA 2NO8A 4GDOA 1JY2O 2AXCA 3VMYA 3CL3D 2H43A 3VYIA 2O01J 1J1DC 1IFDA 4ZKPA 1JCCA 1BDDA 2WSEJ 5AVZB 2V7QJ 4H2WC 1LT9A 1BAJA 1KN7A 1XTGB 1T8ZA 2M5AA 2W8ZA 3EFFK 2CGQA 2KG6A 3H1LE 1K9MQ 1NKZB 4H44D 1KZUB 5K5GB 3PLNA 2K3RA 2FYUD 1VQ7P 3H1LD 3H1LJ 4QKOA 3CCQP 1P84H 1NTZG 2MD9A 3KQGA 1T3JA 2NRGA 3NTEA 1Q82Q 5KAFE 2BEQD 2D2CC 1SQXG 4WY4D 2P10A 3H6PA 1NO4A 2BASA 1LTSC 2Z5IA 5HGLA 1J1EC 4OGQC 3H1IJ 1ZLLA 3WUVA 1GXHA 5CCHC 3FXEA 5KLVD 2E74D 3V6IA 3L72E 1L0NG 3ABVC 3B5NA 2AEJA 2E1MA 2HODA 2KOGA 4PD4I 1JNMA 2I1JA 4I6MC 3HE4B 1GZLA 1KYOD 1NKNA 1L4AA 3SFDC 3RK3E 5TISE 3D6YA 2VLNA 1Y47A 4R4LA 3Q1MA 5BS1A 2XKMA 1EDLA 4XFZA 1FDIA 1AVYA 3AE3C 1H0TB 2C0WA 3H1HJ 2ZXXA 1J1DB 1SFCD 2R5BA 1HJ0A 3MD0A 1SQPJ 3JC22 5JPAA 5KLVE 2AXTH 1UIXA 1LT1A 2Z45A 4GR6A 2E75D 1SQPG 1T6AA 2IBZI 3DS2A 1PP9J 2KIKA 2PEJA 2KXPB 3CMEP 2IBZG 4DJGA 3IAOA 4DCKA 5BS2A 2WVRA 2L22A 2WPTA 3NXSA 1FDMA 3O6QA 2N9BA 3CXCO 1EIAA 2PFXA 4I1LA 3AEAC 2LIWA 1MFZA 2MR8A 1KYOH 3G6EP 3EQ2A 3EWKA 1CI6A 4Y28J 1URQA 3M9QA 3H1HG 2XZRA 3L72G 3CCUP 1SQQG 4COCA 2YIUB 1GTWA 2XZ1C 3MZWB 3M0DA 1L0LD 1OW7A 5AVVB 1IFMA 3B4QA 3BRTB 3V4WA 3VOPA 1X0TA 4D6TG 2AFDA 2NPSB 1CW5A 4MRTC 4IFMA 3ITKA 4WB4A 1LJ2A 2JU2A 2K37A 2LPKA 4N78E 1X79B 3II6A 1PPJE 1ZW0A 1QEXA 1NTKJ 2WPQA 2JAZA 1BCCG 5EJDA 1NAYA 3Q2YA 1KMIZ 2JEEA 2NZ2A 1LWUA 1SQBJ 2BCCD 1KILB 4K3AA 3MTUE 5GTHH 2HFED 2VLQA 3P8CD 3A3YB
chains in the Genus database with same CATH topology
4U0CA 3HYBA 3I55P 1D1DA 1Q81Q 3DS2A 3LRYA 1RO0A 3CC4P 1BAJA 1Q86Q 1N8RQ 1YHQP 2PEJA 2PEMA 2JYLA 1QVGO 5HGNA 1PEOA 1Q7YQ 4GR2A 1KD1Q 2EG5A 3CMEP 4XFYA 5DCKA 3DS5A 3MGEA 4U0DA 1M90Q 1PEUA 3CCSP 5BS2A 2BQ1E 1QVFO 3CC2P 1K9MQ 2PEOA 1KQSO 2EFJA 3CC7P 5HGOA 1VQKP 1YITP 2PY8A 3Q20A 2ONTA 4U0AA 2OTLP 1VQ7P 1PEMA 3CCQP 2XXMA 2XT1A 3I56P 1VQ6P 1VQ5P 3G21A 2PEIA 2PEQA 3DTJA 1VQOP 1K8AQ 3CXCO 1M6NA 1EIAA 1VQ8P 1VQLP 3DS1A 2CWOA 4U0EA 3VRLC 3M1MA 2BHVA 1KC8Q 1IUQA 2JYGA 3H0DA 3HZQA 3NTEA 3G6EP 1VQ9P 4QNBA 1Q82Q 2XV6A 2M8LA 1K30A 3G26A 2EIAA 2Z46A 3CCVP 3CCUP 4COCA 3CCJP 1QRJA 5HGLA 2JO0A 3H4EA 4U0FA 3CPWO 1RO2A 1YJNP 3DS0A 4U0BA 2M8NA 3E2DA 1A43A 4XROA 1RNIA 4WYMA 1YJ9P 1YI2P 2E1MA 1VQPP 1VQNP 1NJIQ 1K73Q 3G29A 3G28A 2L6EA 2QA4P 3G71P 3WBHA 3CCRP 1E6JP 5F2NA 3CCEP 3CCLP 3H47A 3B5IA 2LF4A 3DPHA 2P9XA 3DS3A 3P05A 2PENA 3G4SP 5BS1A 2M8PA 3OW2O 3CMAP 2DGYA 4XFZA 2BUOA 4COPA 1VQMP 1S72P 1PEQA 2PEKA 1M6EX 4PH0A 1AUMA 5F2KA 4IPYA 1M74A 2KODA 3G0VA 3G1GA 2OTJP 3DS4A 1EOQA 1M1KQ 1VQ4P 5I4TG 4PH1A 4XRQA 1JJ2O 1YJWP 1W2BO 5JPAA 1ZMBA 2OARA 1A8OA 2Z44A 2Z45A 2QEXP 4GR6A 3CD6P 5HGMA 5F2OA 3RG6C 3CCMP 4XFXA 4M0IA 1YIJP 3G1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 P;  3CMA P;  3OW2 O;  1VQ7 P;  3CPW O;  1Q81 Q;  3CCQ P;  1VQM P;  1S72 P;  1YJN P;  3I56 P;  1VQ6 P;  1VQ5 P;  3CC4 P;  1VQO P;  1Q86 Q;  1N8R Q;  1K8A Q;  3CXC O;  1YHQ P;  1QVG O;  1YJ9 P;  1VQ8 P;  1VQL P;  1YI2 P;  1Q7Y Q;  1VQP P;  1KC8 Q;  1VQN P;  2OTJ P;  1NJI Q;  1KD1 Q;  1M1K Q;  3CME P;  1K73 Q;  1VQ4 P;  3G6E P;  1VQ9 P;  2QA4 P;  1Q82 Q;  1JJ2 O;  3G71 P;  1YJW P;  1M90 Q;  1W2B O;  3CCR P;  3CCS P;  3CCE P;  1QVF O;  3CC2 P;  3CCL P;  1K9M Q;  1KQS O;  2QEX P;  3CD6 P;  3CCV P;  3CC7 P;  1VQK P;  3CCM P;  3CCU P;  3CCJ P;  1YIT P;  1YIJ P;  3G4S P;  2OTL P; 
#chains in the Genus database with same CATH topology
 3L72 J;  3WMM 0;  1NU1 J;  4L73 A;  3CC4 P;  1EZV E;  2JWD A;  4UB8 H;  1KIL D;  1HVV A;  4EIJ A;  3H1K D;  4XA4 A;  1QVF O;  3B5N B;  1EZV I;  4AQR D;  1NWQ A;  3MUD A;  1K05 A;  4N3Y B;  1S5L E;  3K5B A;  2WPS A;  1DV5 A;  1PP9 E;  1EZV G;  3GW6 A;  3AED C;  5AW4 B;  3FXD A;  3HZQ A;  2XV6 A;  2Y9Y A;  1S3J A;  2H7H A;  1RE3 A;  4CA3 A;  3NFQ A;  1N7S A;  2LKM A;  3VMZ A;  1SQQ D;  2K88 A;  3WU2 H;  3JCU H;  2MVV A;  3L74 E;  2FAE A;  5AW3 B;  2JQ4 A;  1NJI Q;  1K73 Q;  2O01 N;  2VLP A;  2P7J A;  3TGU J;  1PP9 G;  3LMO A;  3P32 A;  3L75 D;  1H0T A;  1U57 A;  2E74 C;  5KP7 B;  3E7K A;  5DJT B;  3L72 D;  3V5B A;  3VP9 A;  4IPY A;  1QL2 A;  2OTJ P;  3DS4 A;  1NTM G;  1W2E A;  2QE7 H;  2ROQ A;  4PH1 A;  3RBX A;  1YJW P;  5AVU B;  4UB8 E;  2N5H A;  3HUS C;  2E76 D;  1DX7 A;  1RY3 A;  3MIW A;  2KGE A;  2QJK C;  1GL2 A;  3CXH I;  1FAV A;  3A7O A;  3S9O A;  2YO2 A;  1KD1 Q;  2FYU G;  2RH0 A;  3HTK B;  3MHV A;  5APS A;  3LIE A;  1P84 D;  1FZF A;  4GOF A;  5HGO A;  2ZVN B;  3KXD A;  1VF5 D;  2WSF J;  2IBZ E;  4BXL A;  1Q90 D;  4PJ0 H;  1VQ6 P;  1M1J C;  5B5E H;  1KIL A;  2NPS C;  3VRL C;  1KC8 Q;  3A0B E;  2Y0E A;  1M1J A;  2YKQ A;  1LNQ A;  3VTP C;  2GZI A;  3U1A A;  1KQF B;  3CCJ P;  2QSI A;  3Q5R A;  2Q7C A;  1GD2 E;  4RES B;  2M8N A;  4H44 B;  1BSH A;  1RNI A;  1OX3 A;  3AEG C;  1J1E B;  4OWF A;  3HD7 A;  4H0L C;  3G28 A;  3WBH A;  3CCR P;  3M0D C;  1JB0 J;  4DT0 A;  4A7P A;  5BVZ A;  2L0Q A;  1L0I A;  1ACP A;  1L0L E;  1RF1 B;  2Q6Q A;  1Z56 A;  3T97 A;  1ZNV A;  3G1G A;  3AE5 C;  2LXC B;  5I4T G;  2QJY C;  4R0M A;  4DZO A;  2FXM A;  2OAR A;  4O9B A;  3MGN A;  1SQX K;  4IL6 E;  3EJB A;  5B66 E;  2KG8 A;  5AW1 B;  1KOR A;  1SQP E;  2IYP A;  1NH4 A;  3KZI H;  1YHQ P;  1HF9 A;  4H44 C;  2M8R A;  4U3F D;  1HUC A;  4JYB A;  2KLV A;  4OH8 B;  2N98 A;  2ERH A;  3A0B H;  1JY3 P;  1ZRT E;  2OQQ A;  2QRX A;  3IR9 A;  1AJY A;  2N1T C;  3B4S A;  4WY4 C;  3V2P A;  2E75 B;  2K1A A;  1PGO A;  3TGU D;  3KDP B;  2W6A A;  3L71 G;  4HJG H;  5E79 E;  1X3O A;  1ZME C;  2AXT E;  1BGY D;  1JTH B;  1GW3 A;  4JPZ B;  2E74 B;  4C7R A;  1IFN A;  2FYN C;  2E5Y A;  5AVR B;  3M9H A;  5KKZ C;  1DH3 A;  1FOS E;  4D6T D;  1BGY E;  2MR7 A;  4U0F A;  2AEF A;  1AQ5 A;  1KB9 I;  4IFF A;  1OWA A;  1GU4 A;  3DS0 A;  4H0L B;  1USD A;  1VQP P;  1VQN P;  3L71 E;  3GHG B;  5GTI H;  1SVF A;  3JCU E;  4ZMD A;  2Q3E A;  3SWK A;  3G4S P;  1L4A D;  1FJP A;  1LWU C;  3CMA P;  1H88 A;  2XV5 A;  3TGU G;  2KOO A;  2D2C D;  3M9B A;  2WWW A;  2GDY A;  4HB1 A;  1HWT C;  1AUM A;  2BCC G;  3RK2 B;  1E79 H;  4BWN A;  3HD7 B;  3IF4 A;  2AF8 A;  2GZE A;  1Q2N A;  1G2C B;  3HTK A;  3RG6 C;  4HYT B;  2P1J A;  3W68 A;  2E42 A;  1NHL A;  2I8D A;  3BCC G;  2J58 A;  1Q81 Q;  1K04 A;  1RO0 A;  2R3C A;  2N50 A;  3TYY A;  5AW7 B;  2ZT9 C;  3MGE A;  2KZI A;  4K35 A;  1SQV G;  1DIP A;  1VQK P;  2YKO A;  1MZ8 A;  2B89 A;  1HQB A;  3R4Y A;  3AEB C;  3QH9 A;  1URQ C;  3AEF C;  2PNG A;  1YQ4 C;  1S9K D;  2JGP A;  3L73 J;  5AW2 B;  4TT3 H;  3DS1 A;  3FWL A;  2WPV B;  3SWY A;  1SQB D;  4NPE A;  2R32 A;  4QNB A;  5B5E E;  2A45 H;  1N7S D;  1K30 A;  4EYY Q;  1S1C X;  2VLO A;  3F89 A;  1IO4 A;  1M7L A;  2FFD A;  1L0L J;  1H89 A;  3L36 A;  1LGH B;  1JO5 A;  4WYM A;  1LP1 B;  1DD4 A;  4GOD A;  1LTT C;  1IMQ A;  5CCG A;  2W27 A;  1SQV D;  2KOR A;  4HKG A;  1N7S C;  4IL6 X;  4YPC A;  4PV1 C;  1RE4 A;  1GK6 A;  4NPD A;  2PEN A;  2A45 G;  1AYI A;  5KLI C;  3G0V A;  4PXH B;  2KNC A;  4PD4 D;  5APT A;  3LW5 H;  3RG2 A;  4WVZ A;  4M3L A;  4H13 B;  3AE6 C;  1OVV A;  4W7Y A;  2FAC A;  2AVA A;  4N6J A;  5H2F E;  2K9Y A;  2QM7 A;  3C1L A;  1IK7 A;  1M56 D;  3LRY A;  1BXI A;  2KS1 A;  2R3S A;  4C7N B;  5AW5 B;  1L4A B;  2RN0 A;  1KTM A;  1GK4 A;  3FWN A;  1Z6M A;  3A0H E;  2IFM A;  1VDF A;  3HD7 C;  3L73 G;  4GT1 A;  2BCC E;  1S4X A;  2KZJ A;  4BPH A;  2A06 E;  1RF1 A;  3VP8 A;  2CNR A;  4N78 D;  4GKG A;  5CCH D;  2YNY A;  1AF8 A;  1PEM A;  4C7N A;  2XT1 A;  1U7J A;  2GZF A;  2OYI B;  1KIL E;  4EDF A;  3P8M C;  4U3F E;  5AVY B;  1RHZ B;  1M1J B;  2FQ1 A;  4HKZ H;  1HTL C;  3HUS B;  3OAK A;  1X8Y A;  5AVS B;  3MP7 B;  3AE4 C;  5HV8 A;  5AW6 B;  1LTJ B;  2P58 A;  3CPW O;  1OW8 A;  3TGU E;  2N1T B;  5KJ7 A;  1OIP A;  2FVA A;  3NTN A;  3CCE P;  2ZT9 B;  3OA7 A;  3RL0 g;  3U59 A;  3L71 J;  1BSN A;  4C46 A;  1KFM A;  2OYH A;  4D6T E;  2LOL A;  1FC2 C;  2KW2 A;  1NTZ K;  2ZYA A;  2BUO A;  4COP A;  5KLV J;  1CEI A;  2FYU J;  4RO0 A;  1AFO A;  4PH0 A;  2M3E A;  3C9I A;  2JR8 A;  2FYU K;  3AE2 C;  2JO1 A;  3GMA A;  3WUT A;  1M1K Q;  1FZA A;  3B8E B;  2WMM A;  3AE9 C;  3KPE A;  4W7Z A;  2ITA A;  1YIJ P;  1FZE A;  1CZQ A;  3G1I A;  2HOD B;  3QWO C;  2KSE A;  1JEK A;  3I5C A;  2Y0D A;  2Y0C A;  5HGN A;  1PEO A;  2QJK B;  1JY3 N;  1G1I A;  1T8K A;  2ZJS E;  2KNC B;  3FX0 A;  3TNU A;  1EDJ A;  3CC2 P;  3L70 G;  3H1L G;  1IFI A;  1IFP A;  3RK2 D;  2PY8 A;  2QJP B;  3CLQ A;  4U0A A;  1J2J B;  2LML A;  1MFT A;  3AE1 C;  2VRS A;  1PGQ A;  1R8E A;  2DW3 A;  1E0H A;  2MKV A;  2HLO A;  1HH0 A;  3RBZ A;  1SQX D;  1PZQ A;  3UIA A;  2GUS A;  2O1J A;  2DNW A;  1N86 A;  2H8P D;  2Y9Z A;  3S4R A;  1P84 E;  1OVU A;  5KLV G;  1NYH A;  2H88 C;  3H1J G;  2YMK A;  2Z4E A;  5CBO A;  1SQQ E;  2EHS A;  2YO3 A;  2FY8 A;  1NGM B;  3PP5 A;  1RF0 A;  4PD4 H;  2E43 A;  3HE4 A;  3PTZ A;  1NTM K;  2FQ0 A;  5F2N A;  1JTH A;  3LW5 J;  2GZG A;  2ZVO B;  5L8R J;  3WU2 E;  1PEQ A;  1BE3 E;  2GUV A;  5TIS H;  2JP3 A;  5AW0 B;  1R5S A;  5HVC A;  1QLE D;  3B5N C;  2N6Z A;  1P84 I;  2FKW B;  5F2O A;  1Y9B A;  4H2X C;  4XFX A;  2KOP A;  3I55 P;  4Y99 C;  2CPB A;  1DD3 A;  2IYO A;  4IOI H;  2JYL A;  1EDI A;  1UJZ A;  4Y99 B;  5AVW B;  2YKP A;  1LT9 C;  1SFC A;  2V4H A;  5CBN A;  1BE3 D;  2GZJ A;  3FGA D;  3CXH H;  2OYO A;  3GZL A;  2Q3I A;  2E75 C;  2FXP A;  4WBA A;  2K0Y A;  2GDW A;  3Q20 A;  3B71 A;  4OGQ D;  1ZOY C;  2GDX A;  3G21 A;  2PEQ A;  3DTJ A;  1M6N A;  2IPP A;  5TJH A;  1PL5 A;  1VQ8 P;  1VQL P;  4U0E A;  2BHV A;  1SLQ A;  2JYG A;  2JB0 A;  2QIW A;  1WMK A;  1BGY J;  4OGQ B;  2IX7 C;  3N4X A;  2EIA A;  2IFN A;  4AYC A;  3L4F A;  1N73 C;  1AVO A;  2CQ8 A;  1E5W A;  2D2C B;  1SQP D;  3CI9 A;  5KLI B;  5AW9 B;  4LLH A;  4JF7 A;  1NTZ J;  3HRN A;  3B5N D;  1BDC A;  1RF0 C;  3H1I D;  1PGJ A;  3V2Q A;  3DS3 A;  1UNK A;  1LTB C;  2FXO A;  4W80 A;  4BRY A;  2XNX A;  2ZYG A;  3H1I E;  4H2Y C;  2E5T A;  5KAI H;  2W90 A;  2EHT A;  3RL0 D;  1N7L A;  1MUU A;  1IZN B;  1EZV D;  2QEX P;  2GA1 A;  2ZXE B;  3PJS K;  4I7Z C;  4EOT A;  4ZKU A;  2C9L Y;  2HPC B;  2WZ7 A;  1QVG O;  4EI2 A;  1AV1 A;  1FU1 A;  3E1I A;  1Q7Y Q;  2KGA A;  1YTZ I;  2P67 A;  3NY7 B;  1JY3 O;  3DS5 A;  3G3Z A;  3U1C A;  2BQ1 E;  2NPS D;  1GU5 A;  2POH A;  5APX A;  2ONT A;  2OGU A;  5H2F H;  3IFM A;  1BCC J;  4H13 C;  1N73 A;  3O6Q B;  1HJB A;  2CWO A;  2N6Y A;  3M1M A;  1L0H A;  2K94 A;  2KWL A;  2K2Q A;  4NPF X;  5AVT B;  3G26 A;  4DG9 A;  1NAF A;  1DEB A;  1FZC A;  3H4E A;  4U7J A;  3L70 J;  2O1K A;  2KOQ A;  3E2D A;  5GTH E;  1BE3 G;  2MJZ A;  5DJU B;  1FS0 E;  1SQB E;  3BVH A;  3WUU A;  3EJD A;  2R44 A;  1SFC C;  3RL0 C;  4ASV A;  1E6J P;  4XFJ A;  3TSI A;  2LF4 A;  2P9X A;  3H1K G;  2XDJ A;  1WRG A;  2MY5 A;  2KP8 A;  2IZ0 A;  2L4B A;  3KZI E;  1IC2 A;  1S72 P;  2AFE A;  3EJE A;  1M74 A;  2WSS H;  1GL2 D;  3H1H D;  1EC5 A;  2N5I A;  1KIL C;  1KQG B;  2NPS A;  4L75 A;  4UB6 E;  1JJ2 O;  2RMZ A;  3V4Q A;  3LID A;  5KLV K;  1SQQ K;  2FYZ A;  3CD6 P;  1FJK A;  3H1H E;  3CCM P;  1SQB K;  1KB9 H;  3GF3 A;  1D1D A;  2E76 B;  5CMZ A;  1VPC A;  1N8R Q;  3H32 A;  3RK3 C;  5CZD B;  2ZYD A;  2JBG A;  1SQX J;  4GR2 A;  2WSF H;  1HGZ A;  3CX5 E;  2EG5 A;  2OYH B;  4MN4 C;  1H8A A;  1PEU A;  1T3U A;  1QX8 A;  3GZM A;  2CPS A;  2PEO A;  1RQV A;  2C0X A;  1NTK E;  5APW A;  3TDK A;  1L0N K;  1S2E A;  1PV3 A;  3I56 P;  1FZB A;  2PEI A;  4DOJ A;  1OZH A;  2ZFC A;  3GHG C;  1NTK D;  4PV1 B;  1IUQ A;  1LTJ C;  1VQ9 P;  5CJ4 A;  3H1J J;  2J5U A;  2N1T A;  1ZN5 A;  3O8Z A;  1OMI A;  3E1R A;  1QRJ A;  2PRR A;  3CX5 D;  3H1J E;  2Q1K A;  1Y8A A;  1G2C A;  2QJP C;  1L0L G;  3Q5S A;  1WT6 A;  5KP8 B;  3G29 A;  2QA4 P;  2L6E A;  4RKU J;  2KOS A;  3SSU A;  3KYQ A;  1OW6 A;  1X9V A;  1NTZ E;  1NVO A;  3P05 A;  1NTM J;  2KI7 B;  2YXR B;  1JMM A;  4NEO A;  5E79 H;  5KP6 B;  3W67 A;  3KHU A;  2W6B A;  4JYC A;  3MUD C;  2B9B A;  4H0L D;  4HH2 A;  1BCC D;  1ZMB A;  3CWB G;  1JY2 P;  4JQ0 D;  2LKI A;  2LTE A;  1VF5 B;  2K9J B;  2N1T D;  3CXH E;  1EQ7 A;  2QVA A;  4U3F G;  2HG5 D;  2OYH C;  4IL6 H;  3BCC J;  3CXH D;  1FDO A;  2Q5U A;  3M06 A;  1PP9 D;  2PAJ A;  3CCS P;  1HGV A;  3AEE C;  4OVN F;  5CJ0 A;  2FVE A;  2C9N Y;  3CE7 A;  4QMA A;  2OYI C;  3M91 A;  1G1J A;  2FYU E;  2OTL P;  4XE5 B;  5APQ A;  1VQ5 P;  1VQO P;  2JWA A;  1YBK A;  2KB7 P;  1NQ4 A;  3H0D A;  4H13 D;  2XZ0 D;  1OR5 A;  1L0N E;  3H25 A;  1XTC C;  5CHX A;  1CSB A;  4I7Z B;  2JU1 A;  1SQV K;  4CPG A;  1T2K C;  3PRJ A;  3EFG A;  3D6Z A;  1N73 B;  1GXG A;  4GIF A;  1SQX E;  3H1I G;  1YI2 P;  1URQ B;  1OVR A;  2IDB A;  3G71 P;  1KYO E;  3CCL P;  3DPH A;  3TF5 A;  2WSC H;  1NTK G;  1BE3 J;  1FOS F;  2M8P A;  2CG5 B;  1NU1 D;  3HD7 D;  1SQQ J;  4ASW A;  2KS1 B;  4LGD E;  2KOD A;  1U7M A;  2LL8 A;  4BPF A;  1VQ4 P;  1IJD B;  4XRQ A;  2ZAE B;  3R2P A;  1W2B O;  4L76 A;  1KLP A;  1SQP K;  3HE5 B;  3SFE C;  2W83 C;  3P7K A;  2QG4 A;  4M0I A;  2KYV A;  4WWI A;  3CX5 I;  3HYB A;  2M5R A;  4D6T J;  2G3A A;  2V7Q H;  5BU8 B;  1Q86 Q;  2GYK A;  2PEM A;  2I1K A;  1LWU B;  1SFC B;  1R5L A;  1YYC A;  5DCK A;  4BPG A;  3PHL A;  1NU1 E;  1KQS O;  2EFJ A;  3CC7 P;  2QM8 A;  2YIU C;  1NU1 G;  2M3B A;  2HPC A;  3CX5 H;  2WIT A;  2FAD A;  3OJA B;  3VMA A;  1NTM D;  4IZ6 A;  2M0B A;  2FFD C;  1LTJ A;  2O3J A;  3L75 J;  1AA0 A;  4IFD K;  1PFI A;  3RK3 B;  2L91 A;  5KAF H;  2Z46 A;  4U3F J;  2KUB A;  1OXZ A;  4ZNC A;  1AQT A;  5CCG C;  4PWV B;  1X22 A;  3V2N A;  3C8V A;  4YXD C;  2W6J H;  1YJN P;  1RE3 C;  4XRO A;  4L74 A;  2Q9I A;  3BAS A;  5CCH A;  1PPJ G;  1SP4 A;  2JDI H;  3SWF A;  3GHG A;  4YTP C;  7CEI A;  2KSJ A;  1HY8 A;  2PGD A;  3H47 A;  2A45 I;  1FR2 A;  1YTZ T;  3ZDM A;  3OW2 O;  1ZP0 C;  4B86 A;  1VQM P;  1SQV E;  2YMY A;  1NOH A;  3L35 A;  1PIX A;  2M5A B;  2JJL A;  2YXQ B;  2K0X A;  5APU A;  2KR5 A;  5AVQ B;  2VSQ A;  1QL1 A;  3AE8 C;  5KJ7 C;  1NTK K;  3NMD A;  3BAT A;  3BRV B;  2HYN A;  4BRY B;  1KV4 A;  2WPR A;  4GOE A;  1RF1 C;  2A06 D;  2KGD A;  3F5H A;  4JBZ A;  2XU6 A;  2FHS C;  5KKZ B;  3H1K J;  1BCC E;  1NU1 K;  2K5X A;  3Q5P A;  1JCD A;  1VL2 A;  2SPZ A;  2CK3 H;  1ZR4 A;  1L2P A;  1UII A;  1IK9 A;  1EXI A;  3BCC E;  2B87 B;  1ZRT D;  1EDK A;  2ZT9 D;  5APY A;  5C39 A;  1MKM A;  3CWB E;  3BCC D;  3CCV P;  3L71 D;  5BU5 A;  2MVU A;  1KYO I;  5EW5 E;  1VKU A;  4R4M A;  1GL2 C;  1BGY G;  1JM0 A;  1RO2 A;  2WSC J;  4PJ0 E;  5APV A;  5M1B A;  1YJ9 P;  3Q3D A;  1N2D C;  4I2L C;  5AVX B;  3L75 G;  3H1K E;  2LIU A;  2O01 H;  1YQ3 C;  1L0N D;  5KJ7 D;  1FZG A;  1IMP A;  3GLM A;  1KQL A;  3L75 E;  3P8C E;  1W5C E;  2KG9 A;  2PEK A;  3L70 D;  1M6E X;  1LTG C;  1LT9 B;  3CWB D;  5KTB A;  4F37 A;  4UB6 H;  1JY2 N;  1EOQ A;  3TNU B;  1A8O A;  2K0D X;  1D7M A;  1L4A C;  1URQ D;  3V2R A;  2K93 A;  3T97 B;  2JKV A;  1KFN A;  1JMB A;  3IN6 A;  2LR2 A;  3CWB J;  2FQ2 A;  2P2U A;  1FZC B;  4XFY A;  4U0D A;  2A06 G;  2B87 A;  1IFJ A;  3L70 E;  1ZR2 A;  3JSV C;  5GTI E;  3L73 E;  3A5T A;  2WT7 B;  1YIT P;  2IBZ D;  1LTA C;  1GPJ A;  2H89 C;  3S1K A;  2XXM A;  3TK1 A;  3RGU A;  1N7S B;  1FE6 A;  3L74 D;  1SS1 A;  2L9F A;  1LTI C;  1USE A;  2Z5H A;  2HR3 A;  2M8L A;  3U43 A;  3RK3 D;  1S9K E;  2B88 A;  2FBW C;  4TLF A;  3H32 B;  2AEM A;  1A02 J;  3RK2 C;  2G8Y A;  3D70 A;  1NTM E;  2MF4 A;  3AEC C;  1SQV J;  2OYI A;  4UHP B;  2WSE H;  4U0B A;  3RL0 B;  2K92 A;  3L73 D;  1F80 D;  1ZXG A;  2QJY B;  2LXB A;  2UWJ E;  3AE7 C;  4KHX A;  3USS A;  2R5D A;  1VHN A;  3VN0 A;  2KK7 A;  5CCG D;  1GMJ A;  4PD4 E;  3D71 A;  5B66 H;  1ZV8 A;  1PGP A;  1M57 D;  2FFD B;  2K9J A;  1SQB G;  2DGY A;  1FZC C;  3L74 G;  2WT7 A;  5KAI E;  2FYN B;  3GKL C;  5F2K A;  1DEE G;  1JOC A;  3G9R A;  3HUS A;  2OTK E;  1JUN A;  2RKL A;  2XND H;  1EXJ A;  2PP6 A;  1NTZ D;  2Z44 A;  2X2B A;  4PV1 D;  5HGM A;  3GG2 A;  1S5L H;  4WY4 A;  4KT0 J;  4U0C A;  2GM4 A;  4WY4 B;  1OFC X;  3H1J D;  3GF7 A;  1VF5 C;  2FVF A;  5EFW B;  3N7N A;  1DNY A;  1S5L X;  1L0N J;  1M90 Q;  1RE4 C;  1QGK B;  4RJT A;  1RH5 B;  1TU3 F;  2KGC A;  3VMX A;  2L5G B;  4YXW H;  1K8A Q;  2E76 C;  4AUW A;  1GDT A;  1KB9 D;  2J59 M;  1MV8 A;  1L0L K;  3GJN A;  1M8O B;  4Z1M H;  1HBW A;  1FBM A;  3L74 J;  1RQU A;  4LC1 A;  2BCC J;  2JO0 A;  1PPJ D;  5AW8 B;  2BEZ F;  1LP1 A;  2IZ1 A;  2WQY C;  3HE5 A;  1A43 A;  1A02 F;  3M0A A;  2KLU A;  3A2A A;  1CI6 B;  2QNW A;  1T2K D;  2N9Y B;  4KJM A;  1MZ9 A;  3B5I A;  3A0H H;  1KB9 E;  3L37 A;  1EMV A;  1GL2 B;  1GW4 A;  3PH0 A;  2WTY A;  2NO8 A;  4GDO A;  1JY2 O;  2AXC A;  3VMY A;  3CL3 D;  2H43 A;  3VYI A;  2O01 J;  1J1D C;  1IFD A;  4ZKP A;  1JCC A;  1BDD A;  2WSE J;  5AVZ B;  2V7Q J;  4H2W C;  1LT9 A;  1BAJ A;  1KN7 A;  1XTG B;  1T8Z A;  2M5A A;  2W8Z A;  3EFF K;  2CGQ A;  2KG6 A;  3H1L E;  1K9M Q;  1NKZ B;  4H44 D;  1KZU B;  5K5G B;  3PLN A;  2K3R A;  2FYU D;  1VQ7 P;  3H1L D;  3H1L J;  4QKO A;  3CCQ P;  1P84 H;  1NTZ G;  2MD9 A;  3KQG A;  1T3J A;  2NRG A;  3NTE A;  1Q82 Q;  5KAF E;  2BEQ D;  2D2C C;  1SQX G;  4WY4 D;  2P10 A;  3H6P A;  1NO4 A;  2BAS A;  1LTS C;  2Z5I A;  5HGL A;  1J1E C;  4OGQ C;  3H1I J;  1ZLL A;  3WUV A;  1GXH A;  5CCH C;  3FXE A;  5KLV D;  2E74 D;  3V6I A;  3L72 E;  1L0N G;  3ABV C;  3B5N A;  2AEJ A;  2E1M A;  2HOD A;  2KOG A;  4PD4 I;  1JNM A;  2I1J A;  4I6M C;  3HE4 B;  1GZL A;  1KYO D;  1NKN A;  1L4A A;  3SFD C;  3RK3 E;  5TIS E;  3D6Y A;  2VLN A;  1Y47 A;  4R4L A;  3Q1M A;  5BS1 A;  2XKM A;  1EDL A;  4XFZ A;  1FDI A;  1AVY A;  3AE3 C;  1H0T B;  2C0W A;  3H1H J;  2ZXX A;  1J1D B;  1SFC D;  2R5B A;  1HJ0 A;  3MD0 A;  1SQP J;  3JC2 2;  5JPA A;  5KLV E;  2AXT H;  1UIX A;  1LT1 A;  2Z45 A;  4GR6 A;  2E75 D;  1SQP G;  1T6A A;  2IBZ I;  3DS2 A;  1PP9 J;  2KIK A;  2PEJ A;  2KXP B;  3CME P;  2IBZ G;  4DJG A;  3IAO A;  4DCK A;  5BS2 A;  2WVR A;  2L22 A;  2WPT A;  3NXS A;  1FDM A;  3O6Q A;  2N9B A;  3CXC O;  1EIA A;  2PFX A;  4I1L A;  3AEA C;  2LIW A;  1MFZ A;  2MR8 A;  1KYO H;  3G6E P;  3EQ2 A;  3EWK A;  1CI6 A;  4Y28 J;  1URQ A;  3M9Q A;  3H1H G;  2XZR A;  3L72 G;  3CCU P;  1SQQ G;  4COC A;  2YIU B;  1GTW A;  2XZ1 C;  3MZW B;  3M0D A;  1L0L D;  1OW7 A;  5AVV B;  1IFM A;  3B4Q A;  3BRT B;  3V4W A;  3VOP A;  1X0T A;  4D6T G;  2AFD A;  2NPS B;  1CW5 A;  4MRT C;  4IFM A;  3ITK A;  4WB4 A;  1LJ2 A;  2JU2 A;  2K37 A;  2LPK A;  4N78 E;  1X79 B;  3II6 A;  1PPJ E;  1ZW0 A;  1QEX A;  1NTK J;  2WPQ A;  2JAZ A;  1BCC G;  5EJD A;  1NAY A;  3Q2Y A;  1KMI Z;  2JEE A;  2NZ2 A;  1LWU A;  1SQB J;  2BCC D;  1KIL B;  4K3A A;  3MTU E;  5GTH H;  2HFE D;  2VLQ A;  3P8C D;  3A3Y B; 
#chains in the Genus database with same CATH homology
 4U0C A;  3HYB A;  3I55 P;  1D1D A;  1Q81 Q;  3DS2 A;  3LRY A;  1RO0 A;  3CC4 P;  1BAJ A;  1Q86 Q;  1N8R Q;  1YHQ P;  2PEJ A;  2PEM A;  2JYL A;  1QVG O;  5HGN A;  1PEO A;  1Q7Y Q;  4GR2 A;  1KD1 Q;  2EG5 A;  3CME P;  4XFY A;  5DCK A;  3DS5 A;  3MGE A;  4U0D A;  1M90 Q;  1PEU A;  3CCS P;  5BS2 A;  2BQ1 E;  1QVF O;  3CC2 P;  1K9M Q;  2PEO A;  1KQS O;  2EFJ A;  3CC7 P;  5HGO A;  1VQK P;  1YIT P;  2PY8 A;  3Q20 A;  2ONT A;  4U0A A;  2OTL P;  1VQ7 P;  1PEM A;  3CCQ P;  2XXM A;  2XT1 A;  3I56 P;  1VQ6 P;  1VQ5 P;  3G21 A;  2PEI A;  2PEQ A;  3DTJ A;  1VQO P;  1K8A Q;  3CXC O;  1M6N A;  1EIA A;  1VQ8 P;  1VQL P;  3DS1 A;  2CWO A;  4U0E A;  3VRL C;  3M1M A;  2BHV A;  1KC8 Q;  1IUQ A;  2JYG A;  3H0D A;  3HZQ A;  3NTE A;  3G6E P;  1VQ9 P;  4QNB A;  1Q82 Q;  2XV6 A;  2M8L A;  1K30 A;  3G26 A;  2EIA A;  2Z46 A;  3CCV P;  3CCU P;  4COC A;  3CCJ P;  1QRJ A;  5HGL A;  2JO0 A;  3H4E A;  4U0F A;  3CPW O;  1RO2 A;  1YJN P;  3DS0 A;  4U0B A;  2M8N A;  3E2D A;  1A43 A;  4XRO A;  1RNI A;  4WYM A;  1YJ9 P;  1YI2 P;  2E1M A;  1VQP P;  1VQN P;  1NJI Q;  1K73 Q;  3G29 A;  3G28 A;  2L6E A;  2QA4 P;  3G71 P;  3WBH A;  3CCR P;  1E6J P;  5F2N A;  3CCE P;  3CCL P;  3H47 A;  3B5I A;  2LF4 A;  3DPH A;  2P9X A;  3DS3 A;  3P05 A;  2PEN A;  3G4S P;  5BS1 A;  2M8P A;  3OW2 O;  3CMA P;  2DGY A;  4XFZ A;  2BUO A;  4COP A;  1VQM P;  1S72 P;  1PEQ A;  2PEK A;  1M6E X;  4PH0 A;  1AUM A;  5F2K A;  4IPY A;  1M74 A;  2KOD A;  3G0V A;  3G1G A;  2OTJ P;  3DS4 A;  1EOQ A;  1M1K Q;  1VQ4 P;  5I4T G;  4PH1 A;  4XRQ A;  1JJ2 O;  1YJW P;  1W2B O;  5JPA A;  1ZMB A;  2OAR A;  1A8O A;  2Z44 A;  2Z45 A;  2QEX P;  4GR6 A;  3CD6 P;  5HGM A;  5F2O A;  3RG6 C;  3CCM P;  4XFX A;  4M0I A;  1YIJ P;  3G1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...