2OTJP

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2otjP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 2otjP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 2otjP02
3CCQP 3CCVP 1YHQP 3CD6P 1VQPP 3G6EP 3G4SP 1KC8Q 3CCRP 1M90Q 3CCSP 3CCJP 1Q86Q 3CXCO 1VQOP 1VQLP 1QVFO 2OTJP 1VQ8P 1Q7YQ 1VQ6P 1K9MQ 1YIJP 1YITP 1K8AQ 3CC2P 1VQ4P 3CCUP 1NJIQ 3CMAP 2QA4P 1YJWP 1YJ9P 3CPWO 3I56P 1W2BO 3CMEP 2QEXP 1VQMP 1K73Q 1JJ2O 1VQKP 3I55P 3CCEP 3G71P 1M1KQ 1KD1Q 3OW2O 3CCMP 3CC7P 2OTLP 3CC4P 1VQ5P 1VQ9P 1KQSO 3CCLP 1N8RQ 1Q82Q 1Q81Q 1QVGO 1VQNP 1YI2P 1VQ7P 1YJNP 1S72P
chains in the Genus database with same CATH superfamily
2K3RA 2WSCJ 4EYYQ 2EIAA 3M0DA 3D71A 2KSEA 4NEOA 1AFOA 1IMQA 3LRYA 3MGEA 1MKMA 3SWFA 2NPSB 3MGNA 1GL2B 2KOSA 2H43A 2WSFH 4H13B 5JPAA 1EQ7A 2ZXXA 1NTMG 2P10A 4C7NA 2W27A 2FFDB 1VQ8P 2KOGA 2CPSA 3SSUA 2O1KA 4HKZH 1SLQA 5APTA 3KDPB 3H25A 2XZ0D 2AEMA 3BVHA 3AE6C 1OVUA 1G1JA 2HODB 1FU1A 1SQQE 4M0IA 2LR2A 1KB9I 3Q5SA 2ZT9B 1YQ4C 2AEFA 2YMKA 3GHGC 3P32A 2KS1B 1SQBE 4U3FD 4W7YA 3VOPA 1T8ZA 1L0LG 4H2YC 4DCKA 2KNCA 1RE3C 1VKUA 5APUA 2N1TD 1N2DC 2N50A 4HKGA 1KILC 4C46A 1YI2P 5KJ7C 2JYGA 1KLPA 3L75G 5AW0B 2Y0CA 2ZVNB 3FXDA 2YIUB 2KZJA 1OXZA 2FQ2A 3RL0D 4H0LB 3RL0g 2GUVA 3H1KD 2QA4P 2PEOA 2B9BA 1QEXA 2WSCH 2B87B 2KLVA 3GF7A 5HV8A 3RK3D 1RY3A 3HE4B 1PV3A 5GTIH 1L0NJ 2IZ1A 2PEJA 5AVVB 3CX5D 1L0NK 4WY4A 3RK2D 2PFXA 4ZKPA 2Q6QA 2EG5A 4XA4A 3B5ND 1YBKA 1JM0A 2ITAA 1ZV8A 1N73C 4PH1A 1ZXGA 4U3FE 4U0CA 2GDXA 5KAFE 4H44C 2E75B 1RF0A 3FWNA 2Z44A 2QE7H 2A06G 2KYVA 3V4WA 5BU5A 2WPQA 5F2KA 5KLVG 1IO4A 3H1KE 5AW6B 3LIDA 2D2CB 2FXOA 1JCDA 1M56D 1KB9H 1EXIA 3G3ZA 2LIUA 1AF8A 1ZMEC 2LIWA 3IF4A 5APQA 3RK3E 1QX8A 1UIXA 2O01J 2XKMA 1NTKJ 3T97A 1WMKA 2FYUD 1M1JC 1LT9C 3LW5J 1HJBA 4JQ0D 1NTKK 1NVOA 4R4LA 2GA1A 1BCCJ 1G2CA 3O6QB 2E5TA 4BRYA 2E5YA 1S9KD 3MUDC 1H0TB 2FADA 2R5BA 2BQ1E 2DGYA 5AVSB 4Y99B 5EFWB 3AEGC 3L72G 3B4SA 3GW6A 3KZIE 4AYCA 3V4QA 2LXBA 3HE5A 2MD9A 2IBZE 2Q1KA 1IC2A 1OIPA 4NPEA 2GDYA 2P9XA 2QNWA 1P84I 3L71G 4A7PA 3C8VA 3A0HE 3G71P 2K9YA 2FYNC 2KORA 1SQPD 3L4FA 3USSA 3UIAA 1LP1B 4U0EA 5F2NA 4HB1A 1PPJG 3RG6C 2PAJA 1Q86Q 4XE5B 3L36A 3C1LA 3CLQA 2L0QA 2FYUE 5AVRB 1SQVE 1BE3G 1BDCA 3VP9A 2BCCD 3HRNA 3A0BH 4N6JA 1WT6A 3OA7A 5KLIC 1USDA 2O01H 4CA3A 1S9KE 1E0HA 1M6NA 1IMPA 3LW5H 4DJGA 1HH0A 2B89A 1SQQJ 3M0AA 2N1TA 1M6EX 2R5DA 1X9VA 4U0BA 2HLOA 1VQ9P 1SQQK 3KPEA 1Q82Q 1SQBJ 2VRSA 5TJHA 1IFPA 3L74J 1AQ5A 3HUSC 1MZ9A 3II6A 3G1GA 1BGYD 3GZMA 3GG2A 1X8YA 2FQ0A 1LTIC 1SQBK 1RF1A 1LJ2A 2NRGA 3HD7D 1FZGA 3VMXA 3Q5RA 3H32A 2IZ0A 4WBAA 1NH4A 1ZNVA 2E74D 4LLHA 3CC4P 2K37A 1SQPE 4L74A 2WMMA 1NOHA 3PHLA 2ZT9C 2EHSA 1EZVG 3H1LG 3R4YA 2E43A 4GKGA 2WTYA 2O1JA 3VMZA 1K04A 2QJKC 1S4XA 3S1KA 2M8RA 1XTCC 3BCCD 2BCCE 3CI9A 1KILD 1PGPA 5KJ7D 3B5NA 1NU1E 1OW8A 1M7LA 1P84H 2KGAA 2FVFA 1GK4A 3TGUD 4H0LC 1PFIA 5KAIE 2JU2A 3DS0A 2QRXA 1Q2NA 7CEIA 2M8LA 2JP3A 3CWBG 4D6TG 2OYHC 4U3FJ 2C9NY 3AEBC 2IFNA 1VQ6P 1L0NG 2X2BA 2I1JA 1BGYE 3EJBA 2QG4A 2DW3A 3LMOA 2JB0A 2WPTA 2LF4A 4IOIH 1N73B 4HH2A 1HBWA 2Z46A 1AA0A 5CCGC 3M9HA 2J58A 3A2AA 2WT7A 1EDJA 1VQNP 3F5HA 4H44B 4QMAA 3H1KJ 3AE7C 5CCHC 5AW9B 2IFMA 5B5EE 1HUCA 1QVFO 3B8EB 1J1DB 5KP6B 1IFIA 2JBGA 3A5TA 3F89A 3P05A 4L76A 4IL6E 3Q3DA 2PP6A 3BCCE 2JEEA 4IFMA 4WY4D 1S72P 1FDOA 5APSA 5DCKA 3EJDA 3GLMA 3TGUE 4JYCA 4XFXA 2L22A 1T2KC 2VLOA 3VMAA 1M1JB 1S2EA 2IBZI 3L70D 2Z5IA 4JPZB 4EI2A 3G26A 3DS2A 2L5GB 4EDFA 3TSIA 1NTKG 3HTKA 1XTGB 3A7OA 3PRJA 4U0FA 4I1LA 1L4AD 5EJDA 3U1AA 2ROQA 2GZEA 1JMBA 3K5BA 1SFCC 1ZRTE 2W6AA 5KAFH 1LTJA 1KYOI 3FX0A 1KQFB 1HTLC 3H1JD 2K9JB 2AFDA 2JKVA 1AYIA 2AVAA 1VPCA 3NMDA 1EDLA 2E76C 1FE6A 1SQXD 3G6EP 2JO1A 1X3OA 3PLNA 3TDKA 4XFJA 1NYHA 1NTZD 2CK3H 3H1IE 1JEKA 3IN6A 1KD1Q 3MP7B 1JB0J 2BUOA 2FYUJ 1EC5A 1AQTA 1SQVJ 2WVRA 2FYNB 4JBZA 1RE4C 2WWWA 3BASA 2FYUK 3LIEA 1SQVK 3C9IA 1JTHA 2XT1A 1IFJA 2ZVOB 1E79H 1G1IA 2N9BA 1GW4A 4NPFX 3I55P 1FZCB 4ZNCA 1KQLA 4RESB 2N9YB 1LTTC 3L70E 3M9QA 1NTMD 3HD7A 5KLIB 3G4SP 4WB4A 2KZIA 4GOFA 1AJYA 3AE4C 3P7KA 1NAYA 1OX3A 2FHSC 2OYIA 1QL1A 2FKWB 2ERHA 5AW8B 4COCA 5TISE 4EOTA 3KZIH 5F2OA 1BDDA 3H1JE 2H7HA 3L73J 1SQXE 4JYBA 1IFDA 4KJMA 2MF4A 3HUSB 4OGQD 4DOJA 1L0LD 3D6ZA 1SQPJ 3JCUE 5C39A 2AF8A 1KILA 1NTZE 2VLNA 2L6EA 3Q1MA 5KJ7A 2NPSD 1GL2D 2VLPA 3WUVA 1SQPK 2M3EA 1QL2A 1JY2P 4H13D 3L74G 3A0HH 3L75D 1NGMB 2BCCJ 1HY8A 1VDFA 1R5SA 1EDKA 2K0DX 1Y8AA 1UNKA 1NU1J 2FBWC 1X79B 1BSHA 1KYOH 1ZN5A 4WWIA 1ZR2A 1M57D 2I8DA 1NU1K 1NHLA 2QJKB 1JUNA 2ZT9D 4F37A 1NTME 3WMM0 1MFZA 2BEZF 1JNMA 2XNXA 1BGYJ 2H88C 3I56P 2KW2A 3EWKA 1RF1B 2O3JA 1JO5A 2N5HA 3FWLA 3FXEA 1NO4A 4AQRD 5BS2A 2OYHB 4H0LD 1FZAA 3AE2C 3TNUA 5CZDB 1L0LE 1PIXA 2FXPA 2JDIH 1A43A 3Q5PA 1K8AQ 3RK3B 3NXSA 3NTEA 3P8CD 2P67A 1Y9BA 2A06D 1YQ3C 3TK1A 5DJTB 1OR5A 4LC1A 3L75E 2FACA 3L35A 4GIFA 3H1HG 2K0YA 1PGQA 3BCCJ 1FOSE 4RJTA 5GTHE 5KLVD 2OTJP 1NAFA 3CXHD 2RH0A 1W2EA 1LWUB 2C0WA 3TGUJ 3W67A 3B71A 3CL3D 5BU8B 2QJYB 4PV1C 1L4AA 1LT9A 1J1DC 2R3CA 2XV5A 1D1DA 3CXCO 5AW7B 3VP8A 1YYCA 2E75D 2WITA 1RO0A 5KAIH 1YTZI 2PEKA 2FVAA 1W2BO 3PH0A 1PP9G 4UB6E 3MUDA 1HGVA 2Y9YA 3G0VA 1EMVA 2JWAA 3L72D 4MN4C 2KOQA 4Z1MH 2D2CD 1KTMA 4NPDA 1DEBA 5CBOA 2K1AA 2M5AB 4BWNA 3P8CE 3CX5E 2A06E 2ZXEB 5CHXA 1U7JA 1SFCB 2QJPC 2N5IA 4PD4D 3M91A 3H1IJ 1JY2O 2QIWA 1IZNB 5KLVE 1RF0C 3L71D 4UHPB 1FZFA 3MHVA 1VF5B 2WPRA 2MJZA 2E76B 1USEA 1U57A 3G9RA 3U1CA 3CXHE 3S9OA 2OTLP 4XRQA 2PEMA 4IL6H 1PPJD 1URQD 4H2XC 1ZP0C 2MVUA 4IPYA 3L70J 1BE3D 1VQOP 2M0BA 4HJGH 2QVAA 4Y28J 2K92A 3WUTA 2UWJE 5BS1A 1IK7A 1SQVG 4RKUJ 3NY7B 4DT0A 3CCLP 2DNWA 2K0XA 2NPSA 2IPPA 1GL2A 3H1JJ 4BPFA 2JR8A 3E7KA 2OTKE 1T3JA 4WVZA 1FZCC 1CEIA 1SQXJ 2FFDA 3E2DA 3PJSK 4K35A 1N7SB 1SQXK 2OQQA 4PD4E 1VQ7P 2N98A 3RG2A 5L8RJ 3V2PA 3HZQA 3WUUA 1L2PA 3CCSP 3L71E 2Q7CA 3KQGA 1KN7A 2HODA 2C0XA 2IDBA 2Z5HA 3WBHA 1NKZB 2ONTA 4I2LC 5AVXB 2I1KA 4YXWH 1GU4A 3L73G 3IAOA 1EZVD 1ZLLA 2GZGA 1PPJE 2WSEJ 3H1LD 4W80A 4I7ZC 1JOCA 1LT1A 1BE3E 1R5LA 1Q7YQ 4IZ6A 1PL5A 3RBXA 5H2FE 2W83C 4CPGA 1JY3P 2RN0A 3U59A 3OW2O 1HWTC 2MVVA 3KHUA 2KOOA 5AVZB 3EFFK 2PNGA 1AVOA 2WQYC 3IR9A 3CCRP 2CG5B 1DIPA 3CWBD 2B87A 2AXCA 4D6TD 3M06A 1H88A 1GK6A 2PRRA 3HE4A 2KODA 1IJDB 1L0ND 4C7NB 2N1TC 2PEQA 3SWYA 2M8NA 3AEAC 4IL6X 1L0LK 5TISH 1HJ0A 3L75J 2G8YA 1RQVA 1LTAC 4XFZA 3R2PA 3RL0C 1RF1C 2W8ZA 4U7JA 3V2NA 3OJAB 2SPZA 2PY8A 1EZVE 1RHZB 1GW3A 1YTZT 3H1LE 2KLUA 3CD6P 2CPBA 3E1IA 2XV6A 2KNCB 3RK3C 1N86A 1QRJA 3H0DA 5CMZA 1GDTA 1S5LX 2WSEH 2KIKA 1M8OB 1DEEG 3RK2C 3DS4A 3EJEA 1PEMA 2W6BA 2KB7P 1KC8Q 3B5NC 1BAJA 4PV1B 1Z56A 1HGZA 3CX5I 2LKIA 3EFGA 1LWUC 3CWBE 2KP8A 4D6TE 4H44D 2QEXP 2P1JA 2QJYC 1KILE 1NTKD 2KWLA 1CI6A 2R3SA 1L0NE 2BASA 1HVVA 1RNIA 2H8PD 2YO2A 5APVA 3CXHI 1SS1A 2M3BA 5K5GB 2YXQB 4WY4B 3O6QA 1T6AA 3E1RA 1NJIQ 5KKZB 2YKPA 1H0TA 4GODA 2KXPB 2C9LY 1URQA 2HYNA 1CZQA 2GZJA 5KLVK 5AW4B 2QJPB 1DD4A 2A45I 1LTGC 2Q5UA 1S5LE 1GXHA 3BRVB 2KG9A 2PENA 1QLED 2P2UA 1BCCG 1RE4A 1UIIA 4PH0A 5I4TG 1GPJA 4QNBA 3H1IG 3ZDMA 4COPA 1T3UA 1H8AA 4IFDK 3FGAD 3GZLA 1JY3O 4DG9A 1VF5C 5AVYB 2L4BA 3A0BE 2GM4A 1LP1A 1R8EA 3CMAP 1J2JB 1YJ9P 4PD4I 3AECC 2ZYDA 2B88A 1P84D 5APXA 3T97B 2P7JA 4UB6H 4OVNF 2BHVA 1YJNP 5KP7B 2LMLA 4PJ0E 1FBMA 3U43A 2KI7B 2GUSA 5E79E 4N78D 2ZYAA 1G2CB 3AE9C 5EW5E 4OWFA 4BRYB 1K73Q 2K88A 2ZYGA 3L71J 2IYOA 1N8RQ 1ZW0A 1Q81Q 3CX5H 3EQ2A 5B66E 2WZ7A 2V4HA 2K93A 3CCVP 1YHQP 1LTJC 1WRGA 3D70A 5AW5B 2YKOA 3CE7A 3L74D 2LKMA 4IFFA 3WU2E 3HE5B 2Q3EA 1QGKB 3CXHH 1N7SC 1BE3J 3CCMP 2Y9ZA 2LL8A 3AE3C 3VRLC 1ZR4A 4YTPC 2HFED 3GHGA 1RO2A 1BSNA 2NZ2A 3DS5A 1LTBC 1SQQG 3MD0A 3Q20A 4I7ZB 1RE3A 4I6MC 3GMAA 1KV4A 4OGQB 4R4MA 2M5RA 1VQKP 2HPCA 1SQBG 4MRTC 1P84E 1RQUA 2A45H 1JY2N 3O8ZA 2JWDA 5AVUB 5APWA 4OH8B 3CCQP 1EDIA 5AVTB 3V6IA 1T8KA 2O01N 4N78E 2KG8A 1HF9A 3HD7C 2K5XA 1OZHA 4UB8E 3MIWA 1AV1A 1NQ4A 2WPSA 1A02J 1EZVI 1Q90D 3AEFC 3A3YB 2JJLA 3AE5C 3M0DC 2E74C 2OYIC 2FAEA 3BATA 1GMJA 2N1TB 1FJKA 3H4EA 4PD4H 3G1IA 2Y0DA 4ASWA 3H1LJ 3CCUP 2GDWA 3L74E 4GR6A 4C7RA 1DH3A 2XNDH 3RL0B 3H1HD 5HGOA 1LGHB 3V2QA 1N73A 4JF7A 3H32B 1FS0E 2L9FA 1PEOA 2JYLA 3RBZA 4ZMDA 4XROA 4DZOA 1EOQA 2ZJSE 1BXIA 1VL2A 5H2FH 3CC7P 4U3FG 1LNQA 5CJ0A 1OW7A 3CWBJ 4D6TJ 2AXTE 3VMYA 3RK2B 2FXMA 1OW6A 4R0MA 1GU5A 3B5NB 2J5UA 1PP9D 4LGDE 1FDMA 3P8MC 2FY8A 2IYPA 5CCGD 3G29A 2KSJA 3H1KG 5CCHD 1KMIZ 3QWOC 3M1MA 3SFEC 1M1JA 3QH9A 2V7QJ 3W68A 4KT0J 2FVEA 1OVVA 2XZRA 1S1CX 3PP5A 2YNYA 1N7LA 5CJ4A 3G21A 1LTSC 2JGPA 3H1HE 1KFMA 1X22A 2IBZD 4WY4C 2JO0A 1DNYA 5KKZC 1T2KD 2K9JA 1J1EB 1M74A 2WT7B 3OAKA 1OWAA 3CCEP 2J59M 2CWOA 4AUWA 1FAVA 5CBNA 4ASVA 4KHXA 4TT3H 2QM8A 1W5CE 3DS1A 1KYOD 3Q2YA 3VTPC 3MTUE 2Q9IA 1CI6B 2IBZG 1L4AC 4PWVB 1SQVD 1FJPA 1PEQA 1PP9E 1SFCD 5B5EH 2XXMA 3SWKA 3N4XA 2A45G 2W90A 2LPKA 2P58A 5KTBA 1VF5D 1CSBA 2E76D 2KGCA 1FZCA 5DJUB 3ABVC 1U7MA 1EIAA 1URQB 3JC22 4M3LA 2KR5A 3CMEP 4K3AA 3HTKB 3RGUA 2FYUG 2FQ1A 2POHA 2Z45A 2MR8A 3MZWB 2M8PA 1S3JA 2L91A 2V7QH 4W7ZA 2WSSH 2JU1A 5AW3B 1FC2C 4GDOA 1M90Q 3L72E 1LTJB 1FDIA 1E5WA 2EHTA 3HYBA 2E42A 3CC2P 2EFJA 3L73D 1S5LH 2G3AA 3CPWO 3HUSA 2Y0EA 3N7NA 2KGDA 2YMYA 1RH5B 4O9BA 2JQ4A 2N6YA 1NTZJ 2OARA 4GR2A 4WYMA 3NTNA 1UJZA 1KYOE 4RO0A 2PGDA 2YO3A 1NTZK 1IFMA 1Y47A 2H89C 2PEIA 5AW2B 1K9MQ 2GZIA 2CGQA 1N7SD 1PZQA 1FOSF 2VLQA 3PTZA 5HGMA 3DS3A 3H47A 2LXCB 1NU1D 2K94A 1FZEA 1AVYA 1JTHB 1MV8A 2KS1A 2NO8A 3NFQA 1L0IA 4XFYA 1SQPG 2GYKA 3GKLC 4B86A 3AEDC 2OYOA 1X0TA 4PJ0H 4OGQC 2KGEA 1PGJA 1NTMJ 5E79H 1KB9D 3HD7B 2ZFCA 1JJ2O 2QM7A 1GXGA 2NPSC 1K30A 1GL2C 1JY3N 1ZMBA 1NTMK 1FR2A 2KUBA 4H13C 1CW5A 2K2QA 2BCCG 3BRTB 2E1MA 2R44A 3TF5A 2FFDC 5GTIE 2E74B 1NU1G 2OYIB 4TLFA 1EXJA 2FYZA 3CCJP 5B66H 1VQLP 2LTEA 2OYHA 2N6ZA 3D6YA 3GHGB 1SP4A 1OMIA 3L73E 4N3YB 1IUQA 1L0LJ 3WU2H 2XU6A 2MKVA 4QKOA 3AE8C 1KILB 1AUMA 2HPCB 2HR3A 3KXDA 1DV5A 4GOEA 1BGYG 2AEJA 5CCGA 1PGOA 1YJWP 2Z4EA 3JCUH 2HG5D 4YXDC 5CCHA 4ZKUA 1KQSO 2VSQA 1LWUA 2RKLA 2YIUC 2RMZA 1L0HA 1SVFA 1IFNA 1VQ4P 3GF3A 1KB9E 1GD2E 3B5IA 4UB8H 2KK7A 1MFTA 3BCCG 1E6JP 4U0DA 4HYTB 3H1HJ 1OVRA 3S4RA 2R32A 2MY5A 2YKQA 1IK9A 3TGUG 4BPGA 1ZRTD 2KG6A 2QSIA 5APYA 1M1KQ 4BPHA 3KYQA 3TNUB 5HGNA 4PV1D 1KFNA 2M5AA 1H89A 4U0AA 2CQ8A 1SFCA 2XDJA 1BCCD 2IX7C 1YITP 1HQBA 3H1ID 2E75C 1OFCX 3VN0A 1A8OA 5KLVJ 1KZUB 2MR7A 5AVWB 1PP9J 1ACPA 1J1EC 4GT1A 3VYIA 3DTJA 2AXTH 2D2CC 1YIJP 5GTHH 5BVZA 1L4AB 2CNRA 1LT9B 4YPCA 1DX7A 1VQ5P 2GZFA 2XZ1C 3SFDC 4PXHB 3G28A 3B4QA 1JMMA 4L75A 1Z6MA 2WSFJ 3ITKA 2BEQD 1FZBA 3L37A 2W6JH 4H2WC 3I5CA 1VQMP 3JSVC 3L72J 1NKNA 1NTKE 2YXRB 3H6PA 1TU3F 3L70G 4Y99C 1URQC 4BXLA 1K05A 1KORA 1GTWA 1N7SA 1GZLA 1D7MA 3GJNA 5HVCA 1BCCE 3V5BA 2WPVB 1A02F 5M1BA 2AFEA 2OGUA 3M9BA 1DD3A 1F80D 5KP8B 2KOPA 1QVGO 1PEUA 2LOLA 1MZ8A 1SQQD 1VQPP 3AEEC 3H1JG 1JCCA 3V2RA 1NWQA 1VHNA 1SQBD 1SQXG 2ZAEB 1MUUA 1KQGB 3AE1C 1ZOYC 5AVQB 2Q3IA 5HGLA 4L73A 3IFMA 1NTZG 3TYYA 5AW1B 2JAZA 4EIJA 3DPHA
chains in the Genus database with same CATH topology
2M8PA 3CCQP 3G1GA 3HZQA 3CD6P 1AUMA 1M90Q 2XV6A 3CCSP 1QVFO 3DTJA 2BQ1E 2DGYA 2XT1A 1QRJA 2EIAA 3HYBA 1YIJP 2PEJA 3WBHA 3CC2P 3H0DA 2ONTA 2EFJA 3CMAP 1YJWP 1YJ9P 3CPWO 3P05A 3I56P 3I55P 3G21A 3LRYA 3CC4P 1VQ5P 3MGEA 1KQSO 2EG5A 3DS4A 2OARA 2BHVA 4GR2A 4WYMA 1S72P 1YJNP 5BS2A 1PEMA 3G28A 5JPAA 2JO0A 5DCKA 3H4EA 3G4SP 1KC8Q 1BAJA 3G1IA 1VQ8P 4XFXA 1Q7YQ 1A43A 2PEIA 1M74A 1K9MQ 1K8AQ 4PH1A 2P9XA 4U0CA 1VQ4P 3CCUP 3B5IA 5HGMA 4GR6A 3NTEA 2QEXP 1VQMP 1K73Q 3CCEP 3G71P 3OW2O 3DS3A 3H47A 2OTLP 2CWOA 4XRQA 4COCA 5F2OA 1N8RQ 2PEMA 1Q81Q 3G26A 5HGOA 1E6JP 1RNIA 2Z44A 3DS2A 4U0DA 3DS1A 4U0EA 3CCVP 4M0IA 5F2NA 4XFYA 1YHQP 1PEOA 2JYLA 3RG6C 4IPYA 4U0FA 3CCRP 1Q86Q 2OTJP 1VQOP 5F2KA 4XROA 1NJIQ 2L6EA 1PEQA 3DS0A 2XXMA 5BS1A 1EOQA 1JJ2O 2M8LA 1K30A 1M1KQ 3CC7P 3CCMP 1ZMBA 2KODA 5HGNA 3VRLC 3CCLP 2PEQA 1QVGO 2M8NA 1YI2P 2E1MA 1PEUA 1VQ6P 2JYGA 1RO2A 4U0AA 1VQPP 3G6EP 1D1DA 1M6NA 3DS5A 3CCJP 3CXCO 1EIAA 1VQLP 3Q20A 1YITP 1RO0A 4XFZA 2LF4A 2QA4P 1M6EX 2PEKA 2PENA 1W2BO 5HGLA 1A8OA 3CMEP 1VQKP 1IUQA 4U0BA 4PH0A 3E2DA 5I4TG 3G29A 1KD1Q 2Z46A 2Z45A 4QNBA 1VQ9P 4COPA 2BUOA 2PEOA 1Q82Q 2PY8A 1VQNP 3G0VA 1VQ7P 3DPHA 3M1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ P;  3CCV P;  1YHQ P;  3CD6 P;  1VQP P;  3G6E P;  3G4S P;  1KC8 Q;  3CCR P;  1M90 Q;  3CCS P;  3CCJ P;  1Q86 Q;  3CXC O;  1VQO P;  1VQL P;  1QVF O;  2OTJ P;  1VQ8 P;  1Q7Y Q;  1VQ6 P;  1K9M Q;  1YIJ P;  1YIT P;  1K8A Q;  3CC2 P;  1VQ4 P;  3CCU P;  1NJI Q;  3CMA P;  2QA4 P;  1YJW P;  1YJ9 P;  3CPW O;  3I56 P;  1W2B O;  3CME P;  2QEX P;  1VQM P;  1K73 Q;  1JJ2 O;  1VQK P;  3I55 P;  3CCE P;  3G71 P;  1M1K Q;  1KD1 Q;  3OW2 O;  3CCM P;  3CC7 P;  2OTL P;  3CC4 P;  1VQ5 P;  1VQ9 P;  1KQS O;  3CCL P;  1N8R Q;  1Q82 Q;  1Q81 Q;  1QVG O;  1VQN P;  1YI2 P;  1VQ7 P;  1YJN P;  1S72 P; 
#chains in the Genus database with same CATH topology
 2K3R A;  2WSC J;  4EYY Q;  2EIA A;  3M0D A;  3D71 A;  2KSE A;  4NEO A;  1AFO A;  1IMQ A;  3LRY A;  3MGE A;  1MKM A;  3SWF A;  2NPS B;  3MGN A;  1GL2 B;  2KOS A;  2H43 A;  2WSF H;  4H13 B;  5JPA A;  1EQ7 A;  2ZXX A;  1NTM G;  2P10 A;  4C7N A;  2W27 A;  2FFD B;  1VQ8 P;  2KOG A;  2CPS A;  3SSU A;  2O1K A;  4HKZ H;  1SLQ A;  5APT A;  3KDP B;  3H25 A;  2XZ0 D;  2AEM A;  3BVH A;  3AE6 C;  1OVU A;  1G1J A;  2HOD B;  1FU1 A;  1SQQ E;  4M0I A;  2LR2 A;  1KB9 I;  3Q5S A;  2ZT9 B;  1YQ4 C;  2AEF A;  2YMK A;  3GHG C;  3P32 A;  2KS1 B;  1SQB E;  4U3F D;  4W7Y A;  3VOP A;  1T8Z A;  1L0L G;  4H2Y C;  4DCK A;  2KNC A;  1RE3 C;  1VKU A;  5APU A;  2N1T D;  1N2D C;  2N50 A;  4HKG A;  1KIL C;  4C46 A;  1YI2 P;  5KJ7 C;  2JYG A;  1KLP A;  3L75 G;  5AW0 B;  2Y0C A;  2ZVN B;  3FXD A;  2YIU B;  2KZJ A;  1OXZ A;  2FQ2 A;  3RL0 D;  4H0L B;  3RL0 g;  2GUV A;  3H1K D;  2QA4 P;  2PEO A;  2B9B A;  1QEX A;  2WSC H;  2B87 B;  2KLV A;  3GF7 A;  5HV8 A;  3RK3 D;  1RY3 A;  3HE4 B;  1PV3 A;  5GTI H;  1L0N J;  2IZ1 A;  2PEJ A;  5AVV B;  3CX5 D;  1L0N K;  4WY4 A;  3RK2 D;  2PFX A;  4ZKP A;  2Q6Q A;  2EG5 A;  4XA4 A;  3B5N D;  1YBK A;  1JM0 A;  2ITA A;  1ZV8 A;  1N73 C;  4PH1 A;  1ZXG A;  4U3F E;  4U0C A;  2GDX A;  5KAF E;  4H44 C;  2E75 B;  1RF0 A;  3FWN A;  2Z44 A;  2QE7 H;  2A06 G;  2KYV A;  3V4W A;  5BU5 A;  2WPQ A;  5F2K A;  5KLV G;  1IO4 A;  3H1K E;  5AW6 B;  3LID A;  2D2C B;  2FXO A;  1JCD A;  1M56 D;  1KB9 H;  1EXI A;  3G3Z A;  2LIU A;  1AF8 A;  1ZME C;  2LIW A;  3IF4 A;  5APQ A;  3RK3 E;  1QX8 A;  1UIX A;  2O01 J;  2XKM A;  1NTK J;  3T97 A;  1WMK A;  2FYU D;  1M1J C;  1LT9 C;  3LW5 J;  1HJB A;  4JQ0 D;  1NTK K;  1NVO A;  4R4L A;  2GA1 A;  1BCC J;  1G2C A;  3O6Q B;  2E5T A;  4BRY A;  2E5Y A;  1S9K D;  3MUD C;  1H0T B;  2FAD A;  2R5B A;  2BQ1 E;  2DGY A;  5AVS B;  4Y99 B;  5EFW B;  3AEG C;  3L72 G;  3B4S A;  3GW6 A;  3KZI E;  4AYC A;  3V4Q A;  2LXB A;  3HE5 A;  2MD9 A;  2IBZ E;  2Q1K A;  1IC2 A;  1OIP A;  4NPE A;  2GDY A;  2P9X A;  2QNW A;  1P84 I;  3L71 G;  4A7P A;  3C8V A;  3A0H E;  3G71 P;  2K9Y A;  2FYN C;  2KOR A;  1SQP D;  3L4F A;  3USS A;  3UIA A;  1LP1 B;  4U0E A;  5F2N A;  4HB1 A;  1PPJ G;  3RG6 C;  2PAJ A;  1Q86 Q;  4XE5 B;  3L36 A;  3C1L A;  3CLQ A;  2L0Q A;  2FYU E;  5AVR B;  1SQV E;  1BE3 G;  1BDC A;  3VP9 A;  2BCC D;  3HRN A;  3A0B H;  4N6J A;  1WT6 A;  3OA7 A;  5KLI C;  1USD A;  2O01 H;  4CA3 A;  1S9K E;  1E0H A;  1M6N A;  1IMP A;  3LW5 H;  4DJG A;  1HH0 A;  2B89 A;  1SQQ J;  3M0A A;  2N1T A;  1M6E X;  2R5D A;  1X9V A;  4U0B A;  2HLO A;  1VQ9 P;  1SQQ K;  3KPE A;  1Q82 Q;  1SQB J;  2VRS A;  5TJH A;  1IFP A;  3L74 J;  1AQ5 A;  3HUS C;  1MZ9 A;  3II6 A;  3G1G A;  1BGY D;  3GZM A;  3GG2 A;  1X8Y A;  2FQ0 A;  1LTI C;  1SQB K;  1RF1 A;  1LJ2 A;  2NRG A;  3HD7 D;  1FZG A;  3VMX A;  3Q5R A;  3H32 A;  2IZ0 A;  4WBA A;  1NH4 A;  1ZNV A;  2E74 D;  4LLH A;  3CC4 P;  2K37 A;  1SQP E;  4L74 A;  2WMM A;  1NOH A;  3PHL A;  2ZT9 C;  2EHS A;  1EZV G;  3H1L G;  3R4Y A;  2E43 A;  4GKG A;  2WTY A;  2O1J A;  3VMZ A;  1K04 A;  2QJK C;  1S4X A;  3S1K A;  2M8R A;  1XTC C;  3BCC D;  2BCC E;  3CI9 A;  1KIL D;  1PGP A;  5KJ7 D;  3B5N A;  1NU1 E;  1OW8 A;  1M7L A;  1P84 H;  2KGA A;  2FVF A;  1GK4 A;  3TGU D;  4H0L C;  1PFI A;  5KAI E;  2JU2 A;  3DS0 A;  2QRX A;  1Q2N A;  7CEI A;  2M8L A;  2JP3 A;  3CWB G;  4D6T G;  2OYH C;  4U3F J;  2C9N Y;  3AEB C;  2IFN A;  1VQ6 P;  1L0N G;  2X2B A;  2I1J A;  1BGY E;  3EJB A;  2QG4 A;  2DW3 A;  3LMO A;  2JB0 A;  2WPT A;  2LF4 A;  4IOI H;  1N73 B;  4HH2 A;  1HBW A;  2Z46 A;  1AA0 A;  5CCG C;  3M9H A;  2J58 A;  3A2A A;  2WT7 A;  1EDJ A;  1VQN P;  3F5H A;  4H44 B;  4QMA A;  3H1K J;  3AE7 C;  5CCH C;  5AW9 B;  2IFM A;  5B5E E;  1HUC A;  1QVF O;  3B8E B;  1J1D B;  5KP6 B;  1IFI A;  2JBG A;  3A5T A;  3F89 A;  3P05 A;  4L76 A;  4IL6 E;  3Q3D A;  2PP6 A;  3BCC E;  2JEE A;  4IFM A;  4WY4 D;  1S72 P;  1FDO A;  5APS A;  5DCK A;  3EJD A;  3GLM A;  3TGU E;  4JYC A;  4XFX A;  2L22 A;  1T2K C;  2VLO A;  3VMA A;  1M1J B;  1S2E A;  2IBZ I;  3L70 D;  2Z5I A;  4JPZ B;  4EI2 A;  3G26 A;  3DS2 A;  2L5G B;  4EDF A;  3TSI A;  1NTK G;  3HTK A;  1XTG B;  3A7O A;  3PRJ A;  4U0F A;  4I1L A;  1L4A D;  5EJD A;  3U1A A;  2ROQ A;  2GZE A;  1JMB A;  3K5B A;  1SFC C;  1ZRT E;  2W6A A;  5KAF H;  1LTJ A;  1KYO I;  3FX0 A;  1KQF B;  1HTL C;  3H1J D;  2K9J B;  2AFD A;  2JKV A;  1AYI A;  2AVA A;  1VPC A;  3NMD A;  1EDL A;  2E76 C;  1FE6 A;  1SQX D;  3G6E P;  2JO1 A;  1X3O A;  3PLN A;  3TDK A;  4XFJ A;  1NYH A;  1NTZ D;  2CK3 H;  3H1I E;  1JEK A;  3IN6 A;  1KD1 Q;  3MP7 B;  1JB0 J;  2BUO A;  2FYU J;  1EC5 A;  1AQT A;  1SQV J;  2WVR A;  2FYN B;  4JBZ A;  1RE4 C;  2WWW A;  3BAS A;  2FYU K;  3LIE A;  1SQV K;  3C9I A;  1JTH A;  2XT1 A;  1IFJ A;  2ZVO B;  1E79 H;  1G1I A;  2N9B A;  1GW4 A;  4NPF X;  3I55 P;  1FZC B;  4ZNC A;  1KQL A;  4RES B;  2N9Y B;  1LTT C;  3L70 E;  3M9Q A;  1NTM D;  3HD7 A;  5KLI B;  3G4S P;  4WB4 A;  2KZI A;  4GOF A;  1AJY A;  3AE4 C;  3P7K A;  1NAY A;  1OX3 A;  2FHS C;  2OYI A;  1QL1 A;  2FKW B;  2ERH A;  5AW8 B;  4COC A;  5TIS E;  4EOT A;  3KZI H;  5F2O A;  1BDD A;  3H1J E;  2H7H A;  3L73 J;  1SQX E;  4JYB A;  1IFD A;  4KJM A;  2MF4 A;  3HUS B;  4OGQ D;  4DOJ A;  1L0L D;  3D6Z A;  1SQP J;  3JCU E;  5C39 A;  2AF8 A;  1KIL A;  1NTZ E;  2VLN A;  2L6E A;  3Q1M A;  5KJ7 A;  2NPS D;  1GL2 D;  2VLP A;  3WUV A;  1SQP K;  2M3E A;  1QL2 A;  1JY2 P;  4H13 D;  3L74 G;  3A0H H;  3L75 D;  1NGM B;  2BCC J;  1HY8 A;  1VDF A;  1R5S A;  1EDK A;  2K0D X;  1Y8A A;  1UNK A;  1NU1 J;  2FBW C;  1X79 B;  1BSH A;  1KYO H;  1ZN5 A;  4WWI A;  1ZR2 A;  1M57 D;  2I8D A;  1NU1 K;  1NHL A;  2QJK B;  1JUN A;  2ZT9 D;  4F37 A;  1NTM E;  3WMM 0;  1MFZ A;  2BEZ F;  1JNM A;  2XNX A;  1BGY J;  2H88 C;  3I56 P;  2KW2 A;  3EWK A;  1RF1 B;  2O3J A;  1JO5 A;  2N5H A;  3FWL A;  3FXE A;  1NO4 A;  4AQR D;  5BS2 A;  2OYH B;  4H0L D;  1FZA A;  3AE2 C;  3TNU A;  5CZD B;  1L0L E;  1PIX A;  2FXP A;  2JDI H;  1A43 A;  3Q5P A;  1K8A Q;  3RK3 B;  3NXS A;  3NTE A;  3P8C D;  2P67 A;  1Y9B A;  2A06 D;  1YQ3 C;  3TK1 A;  5DJT B;  1OR5 A;  4LC1 A;  3L75 E;  2FAC A;  3L35 A;  4GIF A;  3H1H G;  2K0Y A;  1PGQ A;  3BCC J;  1FOS E;  4RJT A;  5GTH E;  5KLV D;  2OTJ P;  1NAF A;  3CXH D;  2RH0 A;  1W2E A;  1LWU B;  2C0W A;  3TGU J;  3W67 A;  3B71 A;  3CL3 D;  5BU8 B;  2QJY B;  4PV1 C;  1L4A A;  1LT9 A;  1J1D C;  2R3C A;  2XV5 A;  1D1D A;  3CXC O;  5AW7 B;  3VP8 A;  1YYC A;  2E75 D;  2WIT A;  1RO0 A;  5KAI H;  1YTZ I;  2PEK A;  2FVA A;  1W2B O;  3PH0 A;  1PP9 G;  4UB6 E;  3MUD A;  1HGV A;  2Y9Y A;  3G0V A;  1EMV A;  2JWA A;  3L72 D;  4MN4 C;  2KOQ A;  4Z1M H;  2D2C D;  1KTM A;  4NPD A;  1DEB A;  5CBO A;  2K1A A;  2M5A B;  4BWN A;  3P8C E;  3CX5 E;  2A06 E;  2ZXE B;  5CHX A;  1U7J A;  1SFC B;  2QJP C;  2N5I A;  4PD4 D;  3M91 A;  3H1I J;  1JY2 O;  2QIW A;  1IZN B;  5KLV E;  1RF0 C;  3L71 D;  4UHP B;  1FZF A;  3MHV A;  1VF5 B;  2WPR A;  2MJZ A;  2E76 B;  1USE A;  1U57 A;  3G9R A;  3U1C A;  3CXH E;  3S9O A;  2OTL P;  4XRQ A;  2PEM A;  4IL6 H;  1PPJ D;  1URQ D;  4H2X C;  1ZP0 C;  2MVU A;  4IPY A;  3L70 J;  1BE3 D;  1VQO P;  2M0B A;  4HJG H;  2QVA A;  4Y28 J;  2K92 A;  3WUT A;  2UWJ E;  5BS1 A;  1IK7 A;  1SQV G;  4RKU J;  3NY7 B;  4DT0 A;  3CCL P;  2DNW A;  2K0X A;  2NPS A;  2IPP A;  1GL2 A;  3H1J J;  4BPF A;  2JR8 A;  3E7K A;  2OTK E;  1T3J A;  4WVZ A;  1FZC C;  1CEI A;  1SQX J;  2FFD A;  3E2D A;  3PJS K;  4K35 A;  1N7S B;  1SQX K;  2OQQ A;  4PD4 E;  1VQ7 P;  2N98 A;  3RG2 A;  5L8R J;  3V2P A;  3HZQ A;  3WUU A;  1L2P A;  3CCS P;  3L71 E;  2Q7C A;  3KQG A;  1KN7 A;  2HOD A;  2C0X A;  2IDB A;  2Z5H A;  3WBH A;  1NKZ B;  2ONT A;  4I2L C;  5AVX B;  2I1K A;  4YXW H;  1GU4 A;  3L73 G;  3IAO A;  1EZV D;  1ZLL A;  2GZG A;  1PPJ E;  2WSE J;  3H1L D;  4W80 A;  4I7Z C;  1JOC A;  1LT1 A;  1BE3 E;  1R5L A;  1Q7Y Q;  4IZ6 A;  1PL5 A;  3RBX A;  5H2F E;  2W83 C;  4CPG A;  1JY3 P;  2RN0 A;  3U59 A;  3OW2 O;  1HWT C;  2MVV A;  3KHU A;  2KOO A;  5AVZ B;  3EFF K;  2PNG A;  1AVO A;  2WQY C;  3IR9 A;  3CCR P;  2CG5 B;  1DIP A;  3CWB D;  2B87 A;  2AXC A;  4D6T D;  3M06 A;  1H88 A;  1GK6 A;  2PRR A;  3HE4 A;  2KOD A;  1IJD B;  1L0N D;  4C7N B;  2N1T C;  2PEQ A;  3SWY A;  2M8N A;  3AEA C;  4IL6 X;  1L0L K;  5TIS H;  1HJ0 A;  3L75 J;  2G8Y A;  1RQV A;  1LTA C;  4XFZ A;  3R2P A;  3RL0 C;  1RF1 C;  2W8Z A;  4U7J A;  3V2N A;  3OJA B;  2SPZ A;  2PY8 A;  1EZV E;  1RHZ B;  1GW3 A;  1YTZ T;  3H1L E;  2KLU A;  3CD6 P;  2CPB A;  3E1I A;  2XV6 A;  2KNC B;  3RK3 C;  1N86 A;  1QRJ A;  3H0D A;  5CMZ A;  1GDT A;  1S5L X;  2WSE H;  2KIK A;  1M8O B;  1DEE G;  3RK2 C;  3DS4 A;  3EJE A;  1PEM A;  2W6B A;  2KB7 P;  1KC8 Q;  3B5N C;  1BAJ A;  4PV1 B;  1Z56 A;  1HGZ A;  3CX5 I;  2LKI A;  3EFG A;  1LWU C;  3CWB E;  2KP8 A;  4D6T E;  4H44 D;  2QEX P;  2P1J A;  2QJY C;  1KIL E;  1NTK D;  2KWL A;  1CI6 A;  2R3S A;  1L0N E;  2BAS A;  1HVV A;  1RNI A;  2H8P D;  2YO2 A;  5APV A;  3CXH I;  1SS1 A;  2M3B A;  5K5G B;  2YXQ B;  4WY4 B;  3O6Q A;  1T6A A;  3E1R A;  1NJI Q;  5KKZ B;  2YKP A;  1H0T A;  4GOD A;  2KXP B;  2C9L Y;  1URQ A;  2HYN A;  1CZQ A;  2GZJ A;  5KLV K;  5AW4 B;  2QJP B;  1DD4 A;  2A45 I;  1LTG C;  2Q5U A;  1S5L E;  1GXH A;  3BRV B;  2KG9 A;  2PEN A;  1QLE D;  2P2U A;  1BCC G;  1RE4 A;  1UII A;  4PH0 A;  5I4T G;  1GPJ A;  4QNB A;  3H1I G;  3ZDM A;  4COP A;  1T3U A;  1H8A A;  4IFD K;  3FGA D;  3GZL A;  1JY3 O;  4DG9 A;  1VF5 C;  5AVY B;  2L4B A;  3A0B E;  2GM4 A;  1LP1 A;  1R8E A;  3CMA P;  1J2J B;  1YJ9 P;  4PD4 I;  3AEC C;  2ZYD A;  2B88 A;  1P84 D;  5APX A;  3T97 B;  2P7J A;  4UB6 H;  4OVN F;  2BHV A;  1YJN P;  5KP7 B;  2LML A;  4PJ0 E;  1FBM A;  3U43 A;  2KI7 B;  2GUS A;  5E79 E;  4N78 D;  2ZYA A;  1G2C B;  3AE9 C;  5EW5 E;  4OWF A;  4BRY B;  1K73 Q;  2K88 A;  2ZYG A;  3L71 J;  2IYO A;  1N8R Q;  1ZW0 A;  1Q81 Q;  3CX5 H;  3EQ2 A;  5B66 E;  2WZ7 A;  2V4H A;  2K93 A;  3CCV P;  1YHQ P;  1LTJ C;  1WRG A;  3D70 A;  5AW5 B;  2YKO A;  3CE7 A;  3L74 D;  2LKM A;  4IFF A;  3WU2 E;  3HE5 B;  2Q3E A;  1QGK B;  3CXH H;  1N7S C;  1BE3 J;  3CCM P;  2Y9Z A;  2LL8 A;  3AE3 C;  3VRL C;  1ZR4 A;  4YTP C;  2HFE D;  3GHG A;  1RO2 A;  1BSN A;  2NZ2 A;  3DS5 A;  1LTB C;  1SQQ G;  3MD0 A;  3Q20 A;  4I7Z B;  1RE3 A;  4I6M C;  3GMA A;  1KV4 A;  4OGQ B;  4R4M A;  2M5R A;  1VQK P;  2HPC A;  1SQB G;  4MRT C;  1P84 E;  1RQU A;  2A45 H;  1JY2 N;  3O8Z A;  2JWD A;  5AVU B;  5APW A;  4OH8 B;  3CCQ P;  1EDI A;  5AVT B;  3V6I A;  1T8K A;  2O01 N;  4N78 E;  2KG8 A;  1HF9 A;  3HD7 C;  2K5X A;  1OZH A;  4UB8 E;  3MIW A;  1AV1 A;  1NQ4 A;  2WPS A;  1A02 J;  1EZV I;  1Q90 D;  3AEF C;  3A3Y B;  2JJL A;  3AE5 C;  3M0D C;  2E74 C;  2OYI C;  2FAE A;  3BAT A;  1GMJ A;  2N1T B;  1FJK A;  3H4E A;  4PD4 H;  3G1I A;  2Y0D A;  4ASW A;  3H1L J;  3CCU P;  2GDW A;  3L74 E;  4GR6 A;  4C7R A;  1DH3 A;  2XND H;  3RL0 B;  3H1H D;  5HGO A;  1LGH B;  3V2Q A;  1N73 A;  4JF7 A;  3H32 B;  1FS0 E;  2L9F A;  1PEO A;  2JYL A;  3RBZ A;  4ZMD A;  4XRO A;  4DZO A;  1EOQ A;  2ZJS E;  1BXI A;  1VL2 A;  5H2F H;  3CC7 P;  4U3F G;  1LNQ A;  5CJ0 A;  1OW7 A;  3CWB J;  4D6T J;  2AXT E;  3VMY A;  3RK2 B;  2FXM A;  1OW6 A;  4R0M A;  1GU5 A;  3B5N B;  2J5U A;  1PP9 D;  4LGD E;  1FDM A;  3P8M C;  2FY8 A;  2IYP A;  5CCG D;  3G29 A;  2KSJ A;  3H1K G;  5CCH D;  1KMI Z;  3QWO C;  3M1M A;  3SFE C;  1M1J A;  3QH9 A;  2V7Q J;  3W68 A;  4KT0 J;  2FVE A;  1OVV A;  2XZR A;  1S1C X;  3PP5 A;  2YNY A;  1N7L A;  5CJ4 A;  3G21 A;  1LTS C;  2JGP A;  3H1H E;  1KFM A;  1X22 A;  2IBZ D;  4WY4 C;  2JO0 A;  1DNY A;  5KKZ C;  1T2K D;  2K9J A;  1J1E B;  1M74 A;  2WT7 B;  3OAK A;  1OWA A;  3CCE P;  2J59 M;  2CWO A;  4AUW A;  1FAV A;  5CBN A;  4ASV A;  4KHX A;  4TT3 H;  2QM8 A;  1W5C E;  3DS1 A;  1KYO D;  3Q2Y A;  3VTP C;  3MTU E;  2Q9I A;  1CI6 B;  2IBZ G;  1L4A C;  4PWV B;  1SQV D;  1FJP A;  1PEQ A;  1PP9 E;  1SFC D;  5B5E H;  2XXM A;  3SWK A;  3N4X A;  2A45 G;  2W90 A;  2LPK A;  2P58 A;  5KTB A;  1VF5 D;  1CSB A;  2E76 D;  2KGC A;  1FZC A;  5DJU B;  3ABV C;  1U7M A;  1EIA A;  1URQ B;  3JC2 2;  4M3L A;  2KR5 A;  3CME P;  4K3A A;  3HTK B;  3RGU A;  2FYU G;  2FQ1 A;  2POH A;  2Z45 A;  2MR8 A;  3MZW B;  2M8P A;  1S3J A;  2L91 A;  2V7Q H;  4W7Z A;  2WSS H;  2JU1 A;  5AW3 B;  1FC2 C;  4GDO A;  1M90 Q;  3L72 E;  1LTJ B;  1FDI A;  1E5W A;  2EHT A;  3HYB A;  2E42 A;  3CC2 P;  2EFJ A;  3L73 D;  1S5L H;  2G3A A;  3CPW O;  3HUS A;  2Y0E A;  3N7N A;  2KGD A;  2YMY A;  1RH5 B;  4O9B A;  2JQ4 A;  2N6Y A;  1NTZ J;  2OAR A;  4GR2 A;  4WYM A;  3NTN A;  1UJZ A;  1KYO E;  4RO0 A;  2PGD A;  2YO3 A;  1NTZ K;  1IFM A;  1Y47 A;  2H89 C;  2PEI A;  5AW2 B;  1K9M Q;  2GZI A;  2CGQ A;  1N7S D;  1PZQ A;  1FOS F;  2VLQ A;  3PTZ A;  5HGM A;  3DS3 A;  3H47 A;  2LXC B;  1NU1 D;  2K94 A;  1FZE A;  1AVY A;  1JTH B;  1MV8 A;  2KS1 A;  2NO8 A;  3NFQ A;  1L0I A;  4XFY A;  1SQP G;  2GYK A;  3GKL C;  4B86 A;  3AED C;  2OYO A;  1X0T A;  4PJ0 H;  4OGQ C;  2KGE A;  1PGJ A;  1NTM J;  5E79 H;  1KB9 D;  3HD7 B;  2ZFC A;  1JJ2 O;  2QM7 A;  1GXG A;  2NPS C;  1K30 A;  1GL2 C;  1JY3 N;  1ZMB A;  1NTM K;  1FR2 A;  2KUB A;  4H13 C;  1CW5 A;  2K2Q A;  2BCC G;  3BRT B;  2E1M A;  2R44 A;  3TF5 A;  2FFD C;  5GTI E;  2E74 B;  1NU1 G;  2OYI B;  4TLF A;  1EXJ A;  2FYZ A;  3CCJ P;  5B66 H;  1VQL P;  2LTE A;  2OYH A;  2N6Z A;  3D6Y A;  3GHG B;  1SP4 A;  1OMI A;  3L73 E;  4N3Y B;  1IUQ A;  1L0L J;  3WU2 H;  2XU6 A;  2MKV A;  4QKO A;  3AE8 C;  1KIL B;  1AUM A;  2HPC B;  2HR3 A;  3KXD A;  1DV5 A;  4GOE A;  1BGY G;  2AEJ A;  5CCG A;  1PGO A;  1YJW P;  2Z4E A;  3JCU H;  2HG5 D;  4YXD C;  5CCH A;  4ZKU A;  1KQS O;  2VSQ A;  1LWU A;  2RKL A;  2YIU C;  2RMZ A;  1L0H A;  1SVF A;  1IFN A;  1VQ4 P;  3GF3 A;  1KB9 E;  1GD2 E;  3B5I A;  4UB8 H;  2KK7 A;  1MFT A;  3BCC G;  1E6J P;  4U0D A;  4HYT B;  3H1H J;  1OVR A;  3S4R A;  2R32 A;  2MY5 A;  2YKQ A;  1IK9 A;  3TGU G;  4BPG A;  1ZRT D;  2KG6 A;  2QSI A;  5APY A;  1M1K Q;  4BPH A;  3KYQ A;  3TNU B;  5HGN A;  4PV1 D;  1KFN A;  2M5A A;  1H89 A;  4U0A A;  2CQ8 A;  1SFC A;  2XDJ A;  1BCC D;  2IX7 C;  1YIT P;  1HQB A;  3H1I D;  2E75 C;  1OFC X;  3VN0 A;  1A8O A;  5KLV J;  1KZU B;  2MR7 A;  5AVW B;  1PP9 J;  1ACP A;  1J1E C;  4GT1 A;  3VYI A;  3DTJ A;  2AXT H;  2D2C C;  1YIJ P;  5GTH H;  5BVZ A;  1L4A B;  2CNR A;  1LT9 B;  4YPC A;  1DX7 A;  1VQ5 P;  2GZF A;  2XZ1 C;  3SFD C;  4PXH B;  3G28 A;  3B4Q A;  1JMM A;  4L75 A;  1Z6M A;  2WSF J;  3ITK A;  2BEQ D;  1FZB A;  3L37 A;  2W6J H;  4H2W C;  3I5C A;  1VQM P;  3JSV C;  3L72 J;  1NKN A;  1NTK E;  2YXR B;  3H6P A;  1TU3 F;  3L70 G;  4Y99 C;  1URQ C;  4BXL A;  1K05 A;  1KOR A;  1GTW A;  1N7S A;  1GZL A;  1D7M A;  3GJN A;  5HVC A;  1BCC E;  3V5B A;  2WPV B;  1A02 F;  5M1B A;  2AFE A;  2OGU A;  3M9B A;  1DD3 A;  1F80 D;  5KP8 B;  2KOP A;  1QVG O;  1PEU A;  2LOL A;  1MZ8 A;  1SQQ D;  1VQP P;  3AEE C;  3H1J G;  1JCC A;  3V2R A;  1NWQ A;  1VHN A;  1SQB D;  1SQX G;  2ZAE B;  1MUU A;  1KQG B;  3AE1 C;  1ZOY C;  5AVQ B;  2Q3I A;  5HGL A;  4L73 A;  3IFM A;  1NTZ G;  3TYY A;  5AW1 B;  2JAZ A;  4EIJ A;  3DPH A; 
#chains in the Genus database with same CATH homology
 2M8P A;  3CCQ P;  3G1G A;  3HZQ A;  3CD6 P;  1AUM A;  1M90 Q;  2XV6 A;  3CCS P;  1QVF O;  3DTJ A;  2BQ1 E;  2DGY A;  2XT1 A;  1QRJ A;  2EIA A;  3HYB A;  1YIJ P;  2PEJ A;  3WBH A;  3CC2 P;  3H0D A;  2ONT A;  2EFJ A;  3CMA P;  1YJW P;  1YJ9 P;  3CPW O;  3P05 A;  3I56 P;  3I55 P;  3G21 A;  3LRY A;  3CC4 P;  1VQ5 P;  3MGE A;  1KQS O;  2EG5 A;  3DS4 A;  2OAR A;  2BHV A;  4GR2 A;  4WYM A;  1S72 P;  1YJN P;  5BS2 A;  1PEM A;  3G28 A;  5JPA A;  2JO0 A;  5DCK A;  3H4E A;  3G4S P;  1KC8 Q;  1BAJ A;  3G1I A;  1VQ8 P;  4XFX A;  1Q7Y Q;  1A43 A;  2PEI A;  1M74 A;  1K9M Q;  1K8A Q;  4PH1 A;  2P9X A;  4U0C A;  1VQ4 P;  3CCU P;  3B5I A;  5HGM A;  4GR6 A;  3NTE A;  2QEX P;  1VQM P;  1K73 Q;  3CCE P;  3G71 P;  3OW2 O;  3DS3 A;  3H47 A;  2OTL P;  2CWO A;  4XRQ A;  4COC A;  5F2O A;  1N8R Q;  2PEM A;  1Q81 Q;  3G26 A;  5HGO A;  1E6J P;  1RNI A;  2Z44 A;  3DS2 A;  4U0D A;  3DS1 A;  4U0E A;  3CCV P;  4M0I A;  5F2N A;  4XFY A;  1YHQ P;  1PEO A;  2JYL A;  3RG6 C;  4IPY A;  4U0F A;  3CCR P;  1Q86 Q;  2OTJ P;  1VQO P;  5F2K A;  4XRO A;  1NJI Q;  2L6E A;  1PEQ A;  3DS0 A;  2XXM A;  5BS1 A;  1EOQ A;  1JJ2 O;  2M8L A;  1K30 A;  1M1K Q;  3CC7 P;  3CCM P;  1ZMB A;  2KOD A;  5HGN A;  3VRL C;  3CCL P;  2PEQ A;  1QVG O;  2M8N A;  1YI2 P;  2E1M A;  1PEU A;  1VQ6 P;  2JYG A;  1RO2 A;  4U0A A;  1VQP P;  3G6E P;  1D1D A;  1M6N A;  3DS5 A;  3CCJ P;  3CXC O;  1EIA A;  1VQL P;  3Q20 A;  1YIT P;  1RO0 A;  4XFZ A;  2LF4 A;  2QA4 P;  1M6E X;  2PEK A;  2PEN A;  1W2B O;  5HGL A;  1A8O A;  3CME P;  1VQK P;  1IUQ A;  4U0B A;  4PH0 A;  3E2D A;  5I4T G;  3G29 A;  1KD1 Q;  2Z46 A;  2Z45 A;  4QNB A;  1VQ9 P;  4COP A;  2BUO A;  2PEO A;  1Q82 Q;  2PY8 A;  1VQN P;  3G0V A;  1VQ7 P;  3DPH A;  3M1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...