2OTJP

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2otjP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 2otjP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 2otjP02
1VQOP 2OTLP 1VQ8P 3I56P 2QA4P 3CCUP 1VQ5P 3CCRP 1K9MQ 1NJIQ 3G6EP 1VQ4P 1W2BO 1S72P 3CPWO 2QEXP 1YITP 1QVGO 1Q82Q 1K73Q 1N8RQ 3CCLP 1QVFO 1KD1Q 1VQ9P 1YJ9P 3CC2P 1K8AQ 1YJWP 3CD6P 3CC4P 1VQNP 1VQ7P 3CCQP 1M90Q 3CCVP 1YIJP 3CMEP 1KQSO 3CXCO 1VQMP 1M1KQ 1VQKP 1VQ6P 1VQLP 1Q7YQ 1YI2P 1KC8Q 1YHQP 1Q81Q 1JJ2O 3G4SP 1VQPP 1YJNP 3I55P 3G71P 3CCMP 1Q86Q 3CCSP 3CCEP 3CC7P 3CCJP 2OTJP 3CMAP 3OW2O
chains in the Genus database with same CATH superfamily
2Q3EA 1GL2A 4QNBA 2HYNA 5TJHA 2KGCA 1ZP0C 2QM7A 3N7NA 2BEQD 1GPJA 1X8YA 2HLOA 5CCHA 1VQMP 2WQYC 2IYOA 1NU1G 2FQ0A 3E7KA 4I1LA 1L0NE 1Q86Q 1JM0A 3B5IA 1EZVD 1LJ2A 2C0WA 3GMAA 1RQUA 2RN0A 2AFDA 1YBKA 2DW3A 3P8CE 1RY3A 2FYUD 1A8OA 3IAOA 2XU6A 4DJGA 1W2EA 1FZCA 2GZIA 2OQQA 1M6EX 1FDMA 4OGQB 3CCJP 3RG6C 3A0HE 3GHGA 1CSBA 4K3AA 4EDFA 1GL2D 1HBWA 4H2WC 3CXHH 3BCCG 5APSA 1URQD 3L75J 3H47A 1URQC 1FDIA 2YIUB 1FZEA 3H25A 4BRYB 1RF1C 5KJ7C 3EJEA 2YXRB 4BWNA 3RK3B 3H32B 5M1BA 3EJBA 2XNDH 4BXLA 4PV1C 3PRJA 2ZT9C 1AV1A 4L73A 3Q5SA 1S9KD 2NO8A 1RF0C 3W68A 1FJKA 5H2FH 3A0BH 2E5TA 2L22A 1SQVE 1LTGC 1NTKG 2KIKA 3L73D 3AE2C 1EDIA 1EXIA 4C46A 2WSSH 2N1TC 4GDOA 3IN6A 2IZ1A 4M3LA 2LKMA 1R8EA 4KJMA 1NTZD 2KZJA 2XZRA 3TSIA 4AYCA 2A06E 1W2BO 1SQPG 1S9KE 1VQ9P 1S5LH 2HPCB 3BCCJ 1SQXK 4UHPB 5H2FE 2UWJE 3VP9A 2M8RA 1E6JP 3I55P 3AE7C 3JC22 3KZIE 4TT3H 2C9LY 3CWBG 3G28A 3MGEA 1PFIA 2LTEA 2JDIH 1USDA 2JU1A 2ZT9B 4YTPC 3S9OA 2V4HA 5DCKA 5KLVK 2EFJA 5KAFH 2VRSA 5C39A 3L4FA 1VQKP 1SQVG 3DS1A 2NPSB 1DX7A 1N7SA 1FZCC 3L37A 1LP1B 1S4XA 1LT9A 3MD0A 2QRXA 3L75G 2PRRA 3I5CA 1AQTA 4I2LC 2ZT9D 1SQXJ 1NOHA 2N5HA 2D2CC 2PGDA 2H43A 2CQ8A 1Q81Q 1K04A 4WY4C 2AVAA 2AF8A 5KP6B 1WRGA 3EQ2A 1HGZA 1L0NK 4PV1B 5HGLA 5KLIC 1BDCA 1KYOE 2LL8A 2N9BA 1LT1A 4JBZA 2JAZA 5B5EE 1Z6MA 1NTKJ 3L72G 1U7JA 1RHZB 2C0XA 5AW2B 5B66E 1WMKA 2Z5HA 2A45H 1BAJA 4C7NA 3CCUP 2CPBA 2L6EA 3P32A 3GW6A 2FFDC 3L74J 2E42A 3T97B 4W7ZA 3CX5E 1M74A 2GZJA 3TF5A 3L35A 3M1MA 2R3CA 3H1HD 4U0CA 1SQQD 2PEOA 4CPGA 3TYYA 1EDKA 2M8NA 2PNGA 1PGOA 1LWUA 2R5DA 1URQA 1PGQA 3H1IE 1BDDA 1YITP 3MTUE 2IPPA 1A43A 1FE6A 2OGUA 4AUWA 4I7ZB 2OTKE 2WSCH 5CJ0A 2FYUE 1GK6A 1NTMJ 1VQ5P 3CXHI 1VF5D 4HJGH 3H1HE 2PEMA 4MRTC 1KB9I 1DD4A 1KC8Q 4OGQD 3G0VA 3H1KD 3OW2O 2FXPA 3WBHA 2ZVNB 1VQOP 2IYPA 2ZJSE 2EIAA 1GL2C 1N73B 2OYHA 4B86A 2GDWA 2EHSA 3CLQA 3H1IG 1PP9G 3WUUA 3HE4B 5KKZB 4L76A 1JY3O 3DS2A 2WPVB 1T2KD 1EIAA 2KXPB 2P2UA 1IJDB 1AVOA 2GDXA 4WB4A 2K9JB 5AVXB 3K5BA 1OXZA 4JYCA 1KQGB 4QKOA 4RKUJ 1FDOA 1Y9BA 2Q3IA 2P67A 4XRQA 2WITA 3CXCO 1GXHA 2EHTA 1JY3P 5CJ4A 3P7KA 5KAIE 1GZLA 1SFCC 3RK3C 1AJYA 1L0NG 1OW8A 4DG9A 3NY7B 2Z45A 3H1LG 3CCLP 2N5IA 3KHUA 3F89A 2M5AB 2ERHA 1OVVA 2Z44A 2CG5B 1NKNA 3JCUE 1QRJA 3AEGC 1QEXA 1SQVJ 1LP1A 3MIWA 3GHGB 1ZR2A 2LR2A 3IF4A 1L0LK 3SSUA 3DS4A 2CPSA 2XT1A 1N2DC 2KLUA 2GZFA 3JSVC 3A7OA 5AW4B 3HTKB 2ZYDA 1LTBC 1OZHA 2KS1B 3AE9C 4U0EA 3TDKA 1BE3J 2MR7A 3O8ZA 5CCGD 2FFDA 1MKMA 1A02F 3G1GA 1BGYD 4PH1A 1H89A 1EDLA 1G1IA 1KZUB 4BPHA 4XA4A 2H7HA 2WSFJ 1OMIA 3BASA 2P9XA 2N98A 3AE1C 4OH8B 3VMXA 2O3JA 5APTA 3T97A 1N7LA 3FGAD 2E5YA 4LC1A 3AEBC 4D6TD 4OGQC 1YTZI 1SFCD 5APQA 2ZYGA 1R5LA 3HD7D 3H1JD 1NU1J 1BXIA 5F2OA 3UIAA 4GODA 1X9VA 1L0NJ 2ZAEB 2LKIA 5KLVJ 5CCHD 2XZ1C 4KT0J 3Q1MA 3TGUG 2HFED 1NO4A 2W6BA 2YKOA 2HG5D 4PWVB 2XDJA 3DS3A 3HD7B 1JY2P 2XXMA 2R5BA 2E76D 1NKZB 1PP9J 4GOFA 2FVEA 2FVAA 1L4AA 2BCCG 3VP8A 3DS0A 1SFCA 2RH0A 4ZKUA 4N78E 3U1CA 3M9HA 2OTLP 4HYTB 1ZXGA 4C7NB 1KYOD 1JUNA 4EI2A 3PHLA 2WPQA 2KW2A 2O01H 3EFFK 1UIIA 3VYIA 2VLOA 1SS1A 1D7MA 1PZQA 1QX8A 2BASA 2NRGA 2P7JA 4EYYQ 3G71P 4ZKPA 3L36A 2E74B 4WY4B 2VSQA 1Q82Q 3BRVB 4O9BA 1OIPA 1K8AQ 4WVZA 5AW0B 2QJKB 1BSHA 1PPJG 1M56D 1IK9A 4IZ6A 1LNQA 3H1JJ 1JY2O 2FQ2A 2N6YA 1U57A 3A0HH 2M8LA 1KTMA 1L4AD 1PGJA 2N1TB 2KB7P 5KLVD 2YO3A 2AXCA 3H32A 3OJAB 2KGAA 2K0XA 3TGUE 3L70G 4N3YB 3L74G 1BGYJ 4IL6X 1VL2A 3AE3C 1IMQA 2JKVA 3FXEA 1VQ8P 1JMMA 1PEOA 2RKLA 3KQGA 2VLNA 4U3FJ 1HWTC 3AEEC 3U1AA 2KGEA 1KB9D 3KPEA 4GR2A 3RK3D 3E1RA 1OWAA 1NQ4A 2FYZA 4BRYA 3BCCE 2YNYA 1GL2B 1S72P 2WSCJ 2XNXA 4LGDE 4L75A 1OX3A 2JU2A 3O6QB 3CCQP 3QWOC 2MKVA 2B89A 2K0DX 2MVVA 2HODB 3AE6C 1R5SA 1KYOH 3L71G 4ASWA 2AXTE 2QJYC 3KDPB 1IUQA 1N73A 2KYVA 3LW5J 1RO0A 2WZ7A 1SQPK 4EOTA 4H13B 4Y99B 1SQQJ 2Z46A 1SQQK 1N7SB 1SQBG 4U0AA 2KWLA 2QNWA 1AVYA 1KB9H 2Q7CA 1NTME 2QJYB 1HQBA 2ONTA 1OVUA 2IBZG 1NTZG 3B71A 1BE3G 4U0BA 1MFZA 2HR3A 1KB9E 5K5GB 1E79H 2FYNC 5CBOA 1PL5A 2L0QA 4NEOA 3CI9A 1AA0A 3B5NB 1X3OA 1VQ4P 4PJ0H 1VKUA 2OYHC 3V2RA 5AVYB 1SQPJ 1DEEG 4HH2A 2KP8A 2L9FA 2M5RA 4M0IA 1ZV8A 4XROA 1Q2NA 1LT9C 5BS1A 2NPSD 1IK7A 2KUBA 4GKGA 1FC2C 4H2XC 2VLQA 1IO4A 4CA3A 2ITAA 3CD6P 1S2EA 5APXA 1FZAA 2FXOA 1PP9E 1EZVG 3Q3DA 2ROQA 1M6NA 2QJPC 3PJSK 5HGOA 2A45I 4ZMDA 3L75D 3Q20A 5AVWB 2POHA 2WTYA 1H8AA 1LWUB 3HZQA 2QA4P 1DD3A 1P84H 3RK3E 2FYUG 4IFDK 4JF7A 3SWKA 1E5WA 4WY4D 3G4SP 4K35A 3VN0A 1T3JA 1JEKA 2ZXEB 2EG5A 3HUSA 3HUSB 2O1JA 3V6IA 1KYOI 1NU1E 2J5UA 1EC5A 2N1TA 2LMLA 3QH9A 1FZFA 1OW7A 2KZIA 1HH0A 3HE5B 3L72D 3BCCD 2M5AA 1EDJA 1YYCA 1HVVA 2WT7B 2WMMA 2W83C 3L70J 3VRLC 1FS0E 1LT9B 2QIWA 3MGNA 3G3ZA 3HUSC 1Y8AA 2R32A 1JOCA 1QVGO 1SP4A 2AEMA 4N6JA 2MR8A 3DS5A 2Y0DA 2XV5A 1RNIA 1KQSO 1SQQG 1RQVA 3WUVA 1SQBK 2JP3A 1SQXG 3B5ND 2KSJA 1SLQA 3M0AA 2OYIC 2LXBA 2ZYAA 3WMM0 1M57D 1L4AC 3L73G 1EXJA 2IBZE 2K3RA 1ZLLA 2FHSC 1PGPA 2IX7C 1VF5B 1G1JA 4COPA 3H1LE 3V4QA 2HPCA 4R4MA 4H44C 5KTBA 4UB6E 2HODA 3L71J 1SQVK 3A5TA 4D6TE 2G8YA 3GZMA 2XZ0D 4I6MC 1RE3A 4A7PA 5AW7B 4PD4E 4JPZB 1BCCG 2PFXA 3TGUJ 4IFFA 2JO1A 1MFTA 4D6TJ 3L71E 3L70E 4U3FG 3CWBD 5AW6B 1YQ3C 2KOQA 2BQ1E 1XTCC 3B5NC 5KJ7A 1NAFA 2KOOA 1RE4A 5HGNA 1QL2A 3N4XA 3TNUB 1NTMD 2QEXP 2I1JA 3FX0A 3C8VA 1JTHB 3CL3D 4YXWH 2YXQB 2V7QH 4PXHB 1NTZJ 4NPEA 3B4QA 1S1CX 1N7SD 2I1KA 3C9IA 1GTWA 2KS1A 4DZOA 1DH3A 2LIUA 1KLPA 3O6QA 1ZMBA 2WT7A 2Q9IA 5AVTB 2W6JH 1VQPP 2WPRA 2A06D 2KI7B 2LIWA 2Z4EA 1F80D 1DIPA 1U7MA 1QVFO 4OWFA 1VDFA 5AW5B 1KD1Q 1KILA 3D6ZA 4TLFA 5KP8B 1FBMA 2BCCE 3PLNA 5CHXA 1KILC 4DOJA 7CEIA 1OR5A 1NU1D 3Q5RA 2FKWB 3LW5H 1HJ0A 1NHLA 1W5CE 1T2KC 3P8CD 1J1DB 2IFMA 3E1IA 3G6EP 2GUSA 2K9JA 4W7YA 3TNUA 2GYKA 2FAEA 2K92A 2WPSA 1LTIC 3IFMA 2MVUA 1BCCE 4JYBA 3CXHD 3R4YA 2ZVOB 4RJTA 3V2QA 2FY8A 2KOPA 4Y99C 2IZ0A 3RL0g 1IFNA 2AEFA 1KN7A 3H1KJ 1MZ8A 1M8OB 2LPKA 3B8EB 2ZXXA 3HE5A 3SFEC 4XFZA 2JQ4A 3JCUH 4KHXA 1ZN5A 3L74E 1PEUA 2NPSA 2Y9YA 1L4AB 3GKLC 2FQ1A 1M7LA 2YKQA 1IFMA 2DNWA 3PTZA 3C1LA 1FOSF 1N86A 2FYNB 1ZNVA 5CZDB 4Y28J 2QG4A 3CWBE 1H0TA 1P84E 3BRTB 2AFEA 1LTJB 1RE3C 3PH0A 2PEKA 1CZQA 3EFGA 2AEJA 2E75B 3D6YA 1T8KA 2H88C 1GD2E 1PIXA 2GZGA 4H13D 1NJIQ 3L73E 2CWOA 3ZDMA 2WVRA 2XV6A 4NPFX 3H1ID 1PP9D 1H88A 2BUOA 1YIJP 3TGUD 1M1KQ 1NGMB 5CCGC 1JCCA 1SQQE 5EFWB 4U7JA 2E43A 4U3FE 3CE7A 3AE4C 5L8RJ 3USSA 3M06A 3GHGC 3RBZA 1SQPD 3A2AA 1L0LG 1CI6A 2O01N 1KMIZ 1VQLP 3Q5PA 2NZ2A 2KORA 3MHVA 2WPTA 2R3SA 1OFCX 3V5BA 1KORA 1ZRTE 2BHVA 1NH4A 5AW8B 3R2PA 3F5HA 3NXSA 1JTHA 2JEEA 1X0TA 3B4SA 4MN4C 5AVSB 3RBXA 5BU8B 5EJDA 2E1MA 4YXDC 1ZMEC 1MV8A 1EOQA 3S1KA 2GDYA 1RF0A 3I56P 2K9YA 1DNYA 1P84D 2KLVA 1PPJD 4L74A 3AEAC 2JO0A 5AVVB 2E76C 3ABVC 2J59M 1VQNP 3GLMA 2Q5UA 4UB8H 2H8PD 2MY5A 2L91A 5E79H 2K2QA 5AW9B 2FACA 2OTJP 1KFMA 1HY8A 1LTJC 3RG2A 5DJUB 1ACPA 3MP7B 2N9YB 1YTZT 1KILB 3RK2D 1GDTA 5B5EH 5JPAA 4RESB 1CI6B 3H1HJ 1QGKB 1JMBA 5APYA 3D71A 2E74D 1S5LX 2L5GB 1USEA 1VHNA 3MZWB 3H1KE 1N7SC 1KV4A 1GMJA 3M9BA 2K0YA 2WWWA 3CPWO 1L0LE 4YPCA 1MUUA 1EQ7A 2SPZA 5GTHE 2BEZF 1IMPA 1JB0J 3G29A 4QMAA 2LOLA 1NVOA 2Y0EA 3H1JG 3TK1A 3WU2H 2K1AA 3CWBJ 1YJNP 2FBWC 1GW3A 1FU1A 3H1HG 2GM4A 1EZVE 3KZIH 3L72E 2JWDA 3M9QA 4PJ0E 2V7QJ 2IBZI 1IFIA 2M0BA 1RH5B 1KILD 1NTKD 3SWYA 1M1JC 3HYBA 3WUTA 4PH0A 2B87B 4R4LA 4OVNF 3CX5H 2QSIA 4H0LB 1LTTC 4H2YC 2H89C 5AW3B 3P8MC 2LXCB 2YMKA 1XTGB 3GF3A 3EWKA 4COCA 1L0IA 5CBNA 3WU2E 3SWFA 4WYMA 1IFDA 2Y9ZA 3KYQA 3FXDA 1SQBD 3U59A 1S5LE 5KAIH 1PEQA 2A45G 2MD9A 3M0DA 3CCSP 1X79B 3V2NA 1S3JA 1NTZE 3G9RA 1BE3E 3LIDA 5KLVE 2GUVA 4W80A 3H1KG 4GIFA 4WWIA 4UB6H 4WBAA 2IBZD 1AFOA 1VQ7P 3PP5A 1HF9A 2E75C 3W67A 5APWA 2KGDA 1FOSE 4H0LC 2FXMA 1J1DC 4GOEA 1SQVD 2PENA 3CC7P 4PD4I 2RMZA 3CMAP 5KJ7D 3V2PA 5HGMA 5BVZA 1Z56A 1FR2A 1K9MQ 2K94A 1PPJE 5E79E 3G21A 4ZNCA 3VOPA 2QJKC 3AECC 5AW1B 4IL6H 3D70A 2FYUK 3HE4A 1FZCB 2E76B 2L4BA 1NYHA 2KNCB 2KNCA 2B9BA 2NPSC 1G2CA 3RL0C 1Y47A 2QJPB 1T6AA 4H13C 1IC2A 2M3BA 4BPFA 1JY3N 1NTMK 1K73Q 1JNMA 2N50A 3AE8C 5F2KA 3AEFC 3L74D 2PAJA 2C9NY 2E75D 2VLPA 5AVZB 1D1DA 3DTJA 3B5NA 1N73C 1IZNB 2Z5IA 2OARA 1PV3A 1NAYA 4EIJA 2WSEH 3LIEA 4XFYA 3HD7C 4PD4D 4IFMA 4F37A 3Q2YA 5HV8A 2WSEJ 1KILE 2R44A 2KG9A 3NFQA 1CW5A 5AVUB 2GA1A 2OYOA 1YJ9P 3H1LJ 2MF4A 1M90Q 3A0BE 2PEQA 2G3AA 3LMOA 5B66H 1OW6A 2N1TD 5AVQB 1YI2P 1JJ2O 4GR6A 1DEBA 1NU1K 5BU5A 3HTKA 1NTZK 2KR5A 3L71D 2JYLA 3G26A 4N78D 2PY8A 3VTPC 4GT1A 5I4TG 4WY4A 1JO5A 4LLHA 1VF5C 2KG8A 2X2BA 3SFDC 4DCKA 5DJTB 2O01J 1KQLA 1SQXD 2FYUJ 1FZGA 1L2PA 1T3UA 2JB0A 1HTLC 1X22A 1E0HA 2Q6QA 1PEMA 3RL0D 3LRYA 1M1JB 4D6TG 1M1JA 3VMYA 3P05A 4BPGA 5GTIE 3M0DC 1N8RQ 3OA7A 1HJBA 2K93A 2K37A 2KK7A 3NMDA 1T8ZA 1BE3D 3CC2P 3H1IJ 1EMVA 1JCDA 1JY2N 5BS2A 1J2JB 3ITKA 2FVFA 1QL1A 2E74C 1OVRA 1K30A 3RGUA 2GZEA 2IFNA 1TU3F 3CX5D 1GXGA 5KAFE 3CCRP 2PEJA 4IOIH 3RK2B 3U43A 1UIXA 3L72J 1LTJA 2QVAA 5KLIB 3CCVP 2CGQA 1FZBA 3CMEP 4HKGA 4PV1D 2WSFH 3GZLA 1AQ5A 2P1JA 1RF1B 3CCEP 2KSEA 1NTKE 1UJZA 2QM8A 1SVFA 1ZW0A 1L0ND 1CEIA 3AE5C 1L0LJ 2QE7H 5AVRB 3CC4P 3H1LD 2MJZA 2JWAA 2FFDB 1SQBJ 3MUDA 4AQRD 1YHQP 1LWUC 2J58A 4H0LD 4C7RA 1ZOYC 5HVCA 4ASVA 1AF8A 2JGPA 2BCCJ 1BSNA 5TISE 4IPYA 2LF4A 1IFPA 1FAVA 1KFNA 1GU4A 1SQPE 2A06G 2JYGA 2K5XA 1FJPA 1A02J 3CX5I 1G2CB 4I7ZC 2B87A 2YKPA 3BATA 4JQ0D 2W6AA 1URQB 4U0DA 5CCHC 1ZR4A 3VMZA 3E2DA 5KLVG 3S4RA 2JJLA 1VQ6P 1UNKA 3L70D 1J1EC 3CXHE 4NPDA 2CNRA 5TISH 4XFJA 3G1IA 3GF7A 4IL6E 1BGYG 1SQXE 3HD7A 4R0MA 3II6A 1HGVA 1AUMA 1HUCA 4U0FA 4Z1MH 2M3EA 1GU5A 3GJNA 4RO0A 2D2CD 1Q7YQ 2ZFCA 2P10A 2B88A 4XE5B 4PD4H 1NWQA 3BVHA 1SFCB 1KQFB 1K05A 2KOSA 1WT6A 4DT0A 5CCGA 5APVA 1ZRTD 4XFXA 1MZ9A 2JBGA 5F2NA 2YIUC 2DGYA 3NTEA 1RF1A 1GK4A 1LGHB 3CCMP 3M91A 2D2CB 1LTSC 1BCCD 5KKZC 3GG2A 1P84I 2Q1KA 3H1JE 3OAKA 1VPCA 5CMZA 3L73J 1DV5A 3IR9A 2PEIA 2PP6A 2W27A 3DPHA 3V4WA 3A3YB 4U3FD 3KXDA 4HB1A 2I8DA 2KG6A 4UB8E 2FADA 3AEDC 1RO2A 1J1EB 2YO2A 1AYIA 1GW4A 4HKZH 5APUA 1NTMG 5KP7B 2KODA 2KOGA 5GTIH 2BCCD 1LTAC 3VMAA 2O1KA 3H4EA 2XKMA 2W90A 1BGYE 2W8ZA 1IFJA 2N6ZA 1YJWP 2K88A 3NTNA 1NTKK 3RK2C 1YQ4C 3H0DA 3H6PA 4H44D 2Y0CA 4H44B 2AXTH 3MUDC 3FWLA 5GTHH 2P58A 2CK3H 3HRNA 5EW5E 3RL0B 2JR8A 2YMYA 1L0LD 1H0TB 1SQBE 1L0HA 1Q90D 2OYHB 1QLED 2IDBA 2OYIA 2M8PA 3EJDA 1RE4C 2OYIB 3L75E 3FWNA 1EZVI 1BCCJ
chains in the Genus database with same CATH topology
3WBHA 1VQOP 2OTLP 1NJIQ 2CWOA 1S72P 1QVFO 4QNBA 4U0EA 2EIAA 5HGLA 2XV6A 1KD1Q 1YJ9P 3CD6P 3CC4P 1VQ7P 3CCQP 1M90Q 2BUOA 4XFXA 1YIJP 4COPA 2PEQA 1VQMP 1M1KQ 5JPAA 5F2NA 2DGYA 1M6NA 3G1GA 1YI2P 3NTEA 1YHQP 1JJ2O 5HGOA 4PH1A 4GR6A 3DS2A 3Q20A 3G71P 2PENA 3CCMP 3B5IA 1Q86Q 3CC7P 1EIAA 2JYLA 3CMAP 3G26A 2PY8A 5HGMA 1BAJA 3HZQA 5I4TG 2QA4P 3CCUP 2L6EA 1K9MQ 3G6EP 4IPYA 1W2BO 2LF4A 3CPWO 1Q82Q 2P9XA 3G21A 1IUQA 1VQ9P 2PEIA 1K8AQ 1RO0A 3DPHA 4XRQA 3G29A 3CXCO 1A8OA 2JYGA 1M74A 1RO2A 3M1MA 1VQLP 4U0CA 1M6EX 2Z46A 3G4SP 2PEOA 1PEMA 1YJNP 3LRYA 1E6JP 2BQ1E 3I55P 2EG5A 2M8NA 4U0AA 2KODA 3CCJP 5F2OA 3RG6C 3G28A 3MGEA 3P05A 2BHVA 2M8LA 5HGNA 2Z45A 3H4EA 4U0DA 1YITP 2QEXP 1K73Q 1N8RQ 3CCLP 5DCKA 2EFJA 5F2KA 4XFZA 3E2DA 3CC2P 1A43A 1YJWP 2Z44A 2ONTA 5BS2A 1VQKP 1PEUA 3DS1A 1VQ6P 4U0BA 3HYBA 3H0DA 4PH0A 1QRJA 2E1MA 3H47A 1K30A 1EOQA 3G1IA 3VRLC 1D1DA 3DS3A 3DTJA 1VQ8P 3I56P 2XXMA 1VQ5P 3CCRP 2PEJA 1VQ4P 1QVGO 2OARA 1AUMA 2PEMA 1PEOA 4COCA 3DS4A 2JO0A 4U0FA 1VQNP 3CCVP 3DS5A 1ZMBA 4WYMA 2PEKA 1RNIA 1KQSO 3CMEP 2XT1A 2M8PA 4XFYA 4M0IA 1Q7YQ 1KC8Q 4GR2A 4XROA 1Q81Q 1VQPP 1PEQA 5BS1A 3CCSP 3G0VA 3DS0A 3CCEP 2OTJP 3OW2O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO P;  2OTL P;  1VQ8 P;  3I56 P;  2QA4 P;  3CCU P;  1VQ5 P;  3CCR P;  1K9M Q;  1NJI Q;  3G6E P;  1VQ4 P;  1W2B O;  1S72 P;  3CPW O;  2QEX P;  1YIT P;  1QVG O;  1Q82 Q;  1K73 Q;  1N8R Q;  3CCL P;  1QVF O;  1KD1 Q;  1VQ9 P;  1YJ9 P;  3CC2 P;  1K8A Q;  1YJW P;  3CD6 P;  3CC4 P;  1VQN P;  1VQ7 P;  3CCQ P;  1M90 Q;  3CCV P;  1YIJ P;  3CME P;  1KQS O;  3CXC O;  1VQM P;  1M1K Q;  1VQK P;  1VQ6 P;  1VQL P;  1Q7Y Q;  1YI2 P;  1KC8 Q;  1YHQ P;  1Q81 Q;  1JJ2 O;  3G4S P;  1VQP P;  1YJN P;  3I55 P;  3G71 P;  3CCM P;  1Q86 Q;  3CCS P;  3CCE P;  3CC7 P;  3CCJ P;  2OTJ P;  3CMA P;  3OW2 O; 
#chains in the Genus database with same CATH topology
 2Q3E A;  1GL2 A;  4QNB A;  2HYN A;  5TJH A;  2KGC A;  1ZP0 C;  2QM7 A;  3N7N A;  2BEQ D;  1GPJ A;  1X8Y A;  2HLO A;  5CCH A;  1VQM P;  2WQY C;  2IYO A;  1NU1 G;  2FQ0 A;  3E7K A;  4I1L A;  1L0N E;  1Q86 Q;  1JM0 A;  3B5I A;  1EZV D;  1LJ2 A;  2C0W A;  3GMA A;  1RQU A;  2RN0 A;  2AFD A;  1YBK A;  2DW3 A;  3P8C E;  1RY3 A;  2FYU D;  1A8O A;  3IAO A;  2XU6 A;  4DJG A;  1W2E A;  1FZC A;  2GZI A;  2OQQ A;  1M6E X;  1FDM A;  4OGQ B;  3CCJ P;  3RG6 C;  3A0H E;  3GHG A;  1CSB A;  4K3A A;  4EDF A;  1GL2 D;  1HBW A;  4H2W C;  3CXH H;  3BCC G;  5APS A;  1URQ D;  3L75 J;  3H47 A;  1URQ C;  1FDI A;  2YIU B;  1FZE A;  3H25 A;  4BRY B;  1RF1 C;  5KJ7 C;  3EJE A;  2YXR B;  4BWN A;  3RK3 B;  3H32 B;  5M1B A;  3EJB A;  2XND H;  4BXL A;  4PV1 C;  3PRJ A;  2ZT9 C;  1AV1 A;  4L73 A;  3Q5S A;  1S9K D;  2NO8 A;  1RF0 C;  3W68 A;  1FJK A;  5H2F H;  3A0B H;  2E5T A;  2L22 A;  1SQV E;  1LTG C;  1NTK G;  2KIK A;  3L73 D;  3AE2 C;  1EDI A;  1EXI A;  4C46 A;  2WSS H;  2N1T C;  4GDO A;  3IN6 A;  2IZ1 A;  4M3L A;  2LKM A;  1R8E A;  4KJM A;  1NTZ D;  2KZJ A;  2XZR A;  3TSI A;  4AYC A;  2A06 E;  1W2B O;  1SQP G;  1S9K E;  1VQ9 P;  1S5L H;  2HPC B;  3BCC J;  1SQX K;  4UHP B;  5H2F E;  2UWJ E;  3VP9 A;  2M8R A;  1E6J P;  3I55 P;  3AE7 C;  3JC2 2;  3KZI E;  4TT3 H;  2C9L Y;  3CWB G;  3G28 A;  3MGE A;  1PFI A;  2LTE A;  2JDI H;  1USD A;  2JU1 A;  2ZT9 B;  4YTP C;  3S9O A;  2V4H A;  5DCK A;  5KLV K;  2EFJ A;  5KAF H;  2VRS A;  5C39 A;  3L4F A;  1VQK P;  1SQV G;  3DS1 A;  2NPS B;  1DX7 A;  1N7S A;  1FZC C;  3L37 A;  1LP1 B;  1S4X A;  1LT9 A;  3MD0 A;  2QRX A;  3L75 G;  2PRR A;  3I5C A;  1AQT A;  4I2L C;  2ZT9 D;  1SQX J;  1NOH A;  2N5H A;  2D2C C;  2PGD A;  2H43 A;  2CQ8 A;  1Q81 Q;  1K04 A;  4WY4 C;  2AVA A;  2AF8 A;  5KP6 B;  1WRG A;  3EQ2 A;  1HGZ A;  1L0N K;  4PV1 B;  5HGL A;  5KLI C;  1BDC A;  1KYO E;  2LL8 A;  2N9B A;  1LT1 A;  4JBZ A;  2JAZ A;  5B5E E;  1Z6M A;  1NTK J;  3L72 G;  1U7J A;  1RHZ B;  2C0X A;  5AW2 B;  5B66 E;  1WMK A;  2Z5H A;  2A45 H;  1BAJ A;  4C7N A;  3CCU P;  2CPB A;  2L6E A;  3P32 A;  3GW6 A;  2FFD C;  3L74 J;  2E42 A;  3T97 B;  4W7Z A;  3CX5 E;  1M74 A;  2GZJ A;  3TF5 A;  3L35 A;  3M1M A;  2R3C A;  3H1H D;  4U0C A;  1SQQ D;  2PEO A;  4CPG A;  3TYY A;  1EDK A;  2M8N A;  2PNG A;  1PGO A;  1LWU A;  2R5D A;  1URQ A;  1PGQ A;  3H1I E;  1BDD A;  1YIT P;  3MTU E;  2IPP A;  1A43 A;  1FE6 A;  2OGU A;  4AUW A;  4I7Z B;  2OTK E;  2WSC H;  5CJ0 A;  2FYU E;  1GK6 A;  1NTM J;  1VQ5 P;  3CXH I;  1VF5 D;  4HJG H;  3H1H E;  2PEM A;  4MRT C;  1KB9 I;  1DD4 A;  1KC8 Q;  4OGQ D;  3G0V A;  3H1K D;  3OW2 O;  2FXP A;  3WBH A;  2ZVN B;  1VQO P;  2IYP A;  2ZJS E;  2EIA A;  1GL2 C;  1N73 B;  2OYH A;  4B86 A;  2GDW A;  2EHS A;  3CLQ A;  3H1I G;  1PP9 G;  3WUU A;  3HE4 B;  5KKZ B;  4L76 A;  1JY3 O;  3DS2 A;  2WPV B;  1T2K D;  1EIA A;  2KXP B;  2P2U A;  1IJD B;  1AVO A;  2GDX A;  4WB4 A;  2K9J B;  5AVX B;  3K5B A;  1OXZ A;  4JYC A;  1KQG B;  4QKO A;  4RKU J;  1FDO A;  1Y9B A;  2Q3I A;  2P67 A;  4XRQ A;  2WIT A;  3CXC O;  1GXH A;  2EHT A;  1JY3 P;  5CJ4 A;  3P7K A;  5KAI E;  1GZL A;  1SFC C;  3RK3 C;  1AJY A;  1L0N G;  1OW8 A;  4DG9 A;  3NY7 B;  2Z45 A;  3H1L G;  3CCL P;  2N5I A;  3KHU A;  3F89 A;  2M5A B;  2ERH A;  1OVV A;  2Z44 A;  2CG5 B;  1NKN A;  3JCU E;  1QRJ A;  3AEG C;  1QEX A;  1SQV J;  1LP1 A;  3MIW A;  3GHG B;  1ZR2 A;  2LR2 A;  3IF4 A;  1L0L K;  3SSU A;  3DS4 A;  2CPS A;  2XT1 A;  1N2D C;  2KLU A;  2GZF A;  3JSV C;  3A7O A;  5AW4 B;  3HTK B;  2ZYD A;  1LTB C;  1OZH A;  2KS1 B;  3AE9 C;  4U0E A;  3TDK A;  1BE3 J;  2MR7 A;  3O8Z A;  5CCG D;  2FFD A;  1MKM A;  1A02 F;  3G1G A;  1BGY D;  4PH1 A;  1H89 A;  1EDL A;  1G1I A;  1KZU B;  4BPH A;  4XA4 A;  2H7H A;  2WSF J;  1OMI A;  3BAS A;  2P9X A;  2N98 A;  3AE1 C;  4OH8 B;  3VMX A;  2O3J A;  5APT A;  3T97 A;  1N7L A;  3FGA D;  2E5Y A;  4LC1 A;  3AEB C;  4D6T D;  4OGQ C;  1YTZ I;  1SFC D;  5APQ A;  2ZYG A;  1R5L A;  3HD7 D;  3H1J D;  1NU1 J;  1BXI A;  5F2O A;  3UIA A;  4GOD A;  1X9V A;  1L0N J;  2ZAE B;  2LKI A;  5KLV J;  5CCH D;  2XZ1 C;  4KT0 J;  3Q1M A;  3TGU G;  2HFE D;  1NO4 A;  2W6B A;  2YKO A;  2HG5 D;  4PWV B;  2XDJ A;  3DS3 A;  3HD7 B;  1JY2 P;  2XXM A;  2R5B A;  2E76 D;  1NKZ B;  1PP9 J;  4GOF A;  2FVE A;  2FVA A;  1L4A A;  2BCC G;  3VP8 A;  3DS0 A;  1SFC A;  2RH0 A;  4ZKU A;  4N78 E;  3U1C A;  3M9H A;  2OTL P;  4HYT B;  1ZXG A;  4C7N B;  1KYO D;  1JUN A;  4EI2 A;  3PHL A;  2WPQ A;  2KW2 A;  2O01 H;  3EFF K;  1UII A;  3VYI A;  2VLO A;  1SS1 A;  1D7M A;  1PZQ A;  1QX8 A;  2BAS A;  2NRG A;  2P7J A;  4EYY Q;  3G71 P;  4ZKP A;  3L36 A;  2E74 B;  4WY4 B;  2VSQ A;  1Q82 Q;  3BRV B;  4O9B A;  1OIP A;  1K8A Q;  4WVZ A;  5AW0 B;  2QJK B;  1BSH A;  1PPJ G;  1M56 D;  1IK9 A;  4IZ6 A;  1LNQ A;  3H1J J;  1JY2 O;  2FQ2 A;  2N6Y A;  1U57 A;  3A0H H;  2M8L A;  1KTM A;  1L4A D;  1PGJ A;  2N1T B;  2KB7 P;  5KLV D;  2YO3 A;  2AXC A;  3H32 A;  3OJA B;  2KGA A;  2K0X A;  3TGU E;  3L70 G;  4N3Y B;  3L74 G;  1BGY J;  4IL6 X;  1VL2 A;  3AE3 C;  1IMQ A;  2JKV A;  3FXE A;  1VQ8 P;  1JMM A;  1PEO A;  2RKL A;  3KQG A;  2VLN A;  4U3F J;  1HWT C;  3AEE C;  3U1A A;  2KGE A;  1KB9 D;  3KPE A;  4GR2 A;  3RK3 D;  3E1R A;  1OWA A;  1NQ4 A;  2FYZ A;  4BRY A;  3BCC E;  2YNY A;  1GL2 B;  1S72 P;  2WSC J;  2XNX A;  4LGD E;  4L75 A;  1OX3 A;  2JU2 A;  3O6Q B;  3CCQ P;  3QWO C;  2MKV A;  2B89 A;  2K0D X;  2MVV A;  2HOD B;  3AE6 C;  1R5S A;  1KYO H;  3L71 G;  4ASW A;  2AXT E;  2QJY C;  3KDP B;  1IUQ A;  1N73 A;  2KYV A;  3LW5 J;  1RO0 A;  2WZ7 A;  1SQP K;  4EOT A;  4H13 B;  4Y99 B;  1SQQ J;  2Z46 A;  1SQQ K;  1N7S B;  1SQB G;  4U0A A;  2KWL A;  2QNW A;  1AVY A;  1KB9 H;  2Q7C A;  1NTM E;  2QJY B;  1HQB A;  2ONT A;  1OVU A;  2IBZ G;  1NTZ G;  3B71 A;  1BE3 G;  4U0B A;  1MFZ A;  2HR3 A;  1KB9 E;  5K5G B;  1E79 H;  2FYN C;  5CBO A;  1PL5 A;  2L0Q A;  4NEO A;  3CI9 A;  1AA0 A;  3B5N B;  1X3O A;  1VQ4 P;  4PJ0 H;  1VKU A;  2OYH C;  3V2R A;  5AVY B;  1SQP J;  1DEE G;  4HH2 A;  2KP8 A;  2L9F A;  2M5R A;  4M0I A;  1ZV8 A;  4XRO A;  1Q2N A;  1LT9 C;  5BS1 A;  2NPS D;  1IK7 A;  2KUB A;  4GKG A;  1FC2 C;  4H2X C;  2VLQ A;  1IO4 A;  4CA3 A;  2ITA A;  3CD6 P;  1S2E A;  5APX A;  1FZA A;  2FXO A;  1PP9 E;  1EZV G;  3Q3D A;  2ROQ A;  1M6N A;  2QJP C;  3PJS K;  5HGO A;  2A45 I;  4ZMD A;  3L75 D;  3Q20 A;  5AVW B;  2POH A;  2WTY A;  1H8A A;  1LWU B;  3HZQ A;  2QA4 P;  1DD3 A;  1P84 H;  3RK3 E;  2FYU G;  4IFD K;  4JF7 A;  3SWK A;  1E5W A;  4WY4 D;  3G4S P;  4K35 A;  3VN0 A;  1T3J A;  1JEK A;  2ZXE B;  2EG5 A;  3HUS A;  3HUS B;  2O1J A;  3V6I A;  1KYO I;  1NU1 E;  2J5U A;  1EC5 A;  2N1T A;  2LML A;  3QH9 A;  1FZF A;  1OW7 A;  2KZI A;  1HH0 A;  3HE5 B;  3L72 D;  3BCC D;  2M5A A;  1EDJ A;  1YYC A;  1HVV A;  2WT7 B;  2WMM A;  2W83 C;  3L70 J;  3VRL C;  1FS0 E;  1LT9 B;  2QIW A;  3MGN A;  3G3Z A;  3HUS C;  1Y8A A;  2R32 A;  1JOC A;  1QVG O;  1SP4 A;  2AEM A;  4N6J A;  2MR8 A;  3DS5 A;  2Y0D A;  2XV5 A;  1RNI A;  1KQS O;  1SQQ G;  1RQV A;  3WUV A;  1SQB K;  2JP3 A;  1SQX G;  3B5N D;  2KSJ A;  1SLQ A;  3M0A A;  2OYI C;  2LXB A;  2ZYA A;  3WMM 0;  1M57 D;  1L4A C;  3L73 G;  1EXJ A;  2IBZ E;  2K3R A;  1ZLL A;  2FHS C;  1PGP A;  2IX7 C;  1VF5 B;  1G1J A;  4COP A;  3H1L E;  3V4Q A;  2HPC A;  4R4M A;  4H44 C;  5KTB A;  4UB6 E;  2HOD A;  3L71 J;  1SQV K;  3A5T A;  4D6T E;  2G8Y A;  3GZM A;  2XZ0 D;  4I6M C;  1RE3 A;  4A7P A;  5AW7 B;  4PD4 E;  4JPZ B;  1BCC G;  2PFX A;  3TGU J;  4IFF A;  2JO1 A;  1MFT A;  4D6T J;  3L71 E;  3L70 E;  4U3F G;  3CWB D;  5AW6 B;  1YQ3 C;  2KOQ A;  2BQ1 E;  1XTC C;  3B5N C;  5KJ7 A;  1NAF A;  2KOO A;  1RE4 A;  5HGN A;  1QL2 A;  3N4X A;  3TNU B;  1NTM D;  2QEX P;  2I1J A;  3FX0 A;  3C8V A;  1JTH B;  3CL3 D;  4YXW H;  2YXQ B;  2V7Q H;  4PXH B;  1NTZ J;  4NPE A;  3B4Q A;  1S1C X;  1N7S D;  2I1K A;  3C9I A;  1GTW A;  2KS1 A;  4DZO A;  1DH3 A;  2LIU A;  1KLP A;  3O6Q A;  1ZMB A;  2WT7 A;  2Q9I A;  5AVT B;  2W6J H;  1VQP P;  2WPR A;  2A06 D;  2KI7 B;  2LIW A;  2Z4E A;  1F80 D;  1DIP A;  1U7M A;  1QVF O;  4OWF A;  1VDF A;  5AW5 B;  1KD1 Q;  1KIL A;  3D6Z A;  4TLF A;  5KP8 B;  1FBM A;  2BCC E;  3PLN A;  5CHX A;  1KIL C;  4DOJ A;  7CEI A;  1OR5 A;  1NU1 D;  3Q5R A;  2FKW B;  3LW5 H;  1HJ0 A;  1NHL A;  1W5C E;  1T2K C;  3P8C D;  1J1D B;  2IFM A;  3E1I A;  3G6E P;  2GUS A;  2K9J A;  4W7Y A;  3TNU A;  2GYK A;  2FAE A;  2K92 A;  2WPS A;  1LTI C;  3IFM A;  2MVU A;  1BCC E;  4JYB A;  3CXH D;  3R4Y A;  2ZVO B;  4RJT A;  3V2Q A;  2FY8 A;  2KOP A;  4Y99 C;  2IZ0 A;  3RL0 g;  1IFN A;  2AEF A;  1KN7 A;  3H1K J;  1MZ8 A;  1M8O B;  2LPK A;  3B8E B;  2ZXX A;  3HE5 A;  3SFE C;  4XFZ A;  2JQ4 A;  3JCU H;  4KHX A;  1ZN5 A;  3L74 E;  1PEU A;  2NPS A;  2Y9Y A;  1L4A B;  3GKL C;  2FQ1 A;  1M7L A;  2YKQ A;  1IFM A;  2DNW A;  3PTZ A;  3C1L A;  1FOS F;  1N86 A;  2FYN B;  1ZNV A;  5CZD B;  4Y28 J;  2QG4 A;  3CWB E;  1H0T A;  1P84 E;  3BRT B;  2AFE A;  1LTJ B;  1RE3 C;  3PH0 A;  2PEK A;  1CZQ A;  3EFG A;  2AEJ A;  2E75 B;  3D6Y A;  1T8K A;  2H88 C;  1GD2 E;  1PIX A;  2GZG A;  4H13 D;  1NJI Q;  3L73 E;  2CWO A;  3ZDM A;  2WVR A;  2XV6 A;  4NPF X;  3H1I D;  1PP9 D;  1H88 A;  2BUO A;  1YIJ P;  3TGU D;  1M1K Q;  1NGM B;  5CCG C;  1JCC A;  1SQQ E;  5EFW B;  4U7J A;  2E43 A;  4U3F E;  3CE7 A;  3AE4 C;  5L8R J;  3USS A;  3M06 A;  3GHG C;  3RBZ A;  1SQP D;  3A2A A;  1L0L G;  1CI6 A;  2O01 N;  1KMI Z;  1VQL P;  3Q5P A;  2NZ2 A;  2KOR A;  3MHV A;  2WPT A;  2R3S A;  1OFC X;  3V5B A;  1KOR A;  1ZRT E;  2BHV A;  1NH4 A;  5AW8 B;  3R2P A;  3F5H A;  3NXS A;  1JTH A;  2JEE A;  1X0T A;  3B4S A;  4MN4 C;  5AVS B;  3RBX A;  5BU8 B;  5EJD A;  2E1M A;  4YXD C;  1ZME C;  1MV8 A;  1EOQ A;  3S1K A;  2GDY A;  1RF0 A;  3I56 P;  2K9Y A;  1DNY A;  1P84 D;  2KLV A;  1PPJ D;  4L74 A;  3AEA C;  2JO0 A;  5AVV B;  2E76 C;  3ABV C;  2J59 M;  1VQN P;  3GLM A;  2Q5U A;  4UB8 H;  2H8P D;  2MY5 A;  2L91 A;  5E79 H;  2K2Q A;  5AW9 B;  2FAC A;  2OTJ P;  1KFM A;  1HY8 A;  1LTJ C;  3RG2 A;  5DJU B;  1ACP A;  3MP7 B;  2N9Y B;  1YTZ T;  1KIL B;  3RK2 D;  1GDT A;  5B5E H;  5JPA A;  4RES B;  1CI6 B;  3H1H J;  1QGK B;  1JMB A;  5APY A;  3D71 A;  2E74 D;  1S5L X;  2L5G B;  1USE A;  1VHN A;  3MZW B;  3H1K E;  1N7S C;  1KV4 A;  1GMJ A;  3M9B A;  2K0Y A;  2WWW A;  3CPW O;  1L0L E;  4YPC A;  1MUU A;  1EQ7 A;  2SPZ A;  5GTH E;  2BEZ F;  1IMP A;  1JB0 J;  3G29 A;  4QMA A;  2LOL A;  1NVO A;  2Y0E A;  3H1J G;  3TK1 A;  3WU2 H;  2K1A A;  3CWB J;  1YJN P;  2FBW C;  1GW3 A;  1FU1 A;  3H1H G;  2GM4 A;  1EZV E;  3KZI H;  3L72 E;  2JWD A;  3M9Q A;  4PJ0 E;  2V7Q J;  2IBZ I;  1IFI A;  2M0B A;  1RH5 B;  1KIL D;  1NTK D;  3SWY A;  1M1J C;  3HYB A;  3WUT A;  4PH0 A;  2B87 B;  4R4L A;  4OVN F;  3CX5 H;  2QSI A;  4H0L B;  1LTT C;  4H2Y C;  2H89 C;  5AW3 B;  3P8M C;  2LXC B;  2YMK A;  1XTG B;  3GF3 A;  3EWK A;  4COC A;  1L0I A;  5CBN A;  3WU2 E;  3SWF A;  4WYM A;  1IFD A;  2Y9Z A;  3KYQ A;  3FXD A;  1SQB D;  3U59 A;  1S5L E;  5KAI H;  1PEQ A;  2A45 G;  2MD9 A;  3M0D A;  3CCS P;  1X79 B;  3V2N A;  1S3J A;  1NTZ E;  3G9R A;  1BE3 E;  3LID A;  5KLV E;  2GUV A;  4W80 A;  3H1K G;  4GIF A;  4WWI A;  4UB6 H;  4WBA A;  2IBZ D;  1AFO A;  1VQ7 P;  3PP5 A;  1HF9 A;  2E75 C;  3W67 A;  5APW A;  2KGD A;  1FOS E;  4H0L C;  2FXM A;  1J1D C;  4GOE A;  1SQV D;  2PEN A;  3CC7 P;  4PD4 I;  2RMZ A;  3CMA P;  5KJ7 D;  3V2P A;  5HGM A;  5BVZ A;  1Z56 A;  1FR2 A;  1K9M Q;  2K94 A;  1PPJ E;  5E79 E;  3G21 A;  4ZNC A;  3VOP A;  2QJK C;  3AEC C;  5AW1 B;  4IL6 H;  3D70 A;  2FYU K;  3HE4 A;  1FZC B;  2E76 B;  2L4B A;  1NYH A;  2KNC B;  2KNC A;  2B9B A;  2NPS C;  1G2C A;  3RL0 C;  1Y47 A;  2QJP B;  1T6A A;  4H13 C;  1IC2 A;  2M3B A;  4BPF A;  1JY3 N;  1NTM K;  1K73 Q;  1JNM A;  2N50 A;  3AE8 C;  5F2K A;  3AEF C;  3L74 D;  2PAJ A;  2C9N Y;  2E75 D;  2VLP A;  5AVZ B;  1D1D A;  3DTJ A;  3B5N A;  1N73 C;  1IZN B;  2Z5I A;  2OAR A;  1PV3 A;  1NAY A;  4EIJ A;  2WSE H;  3LIE A;  4XFY A;  3HD7 C;  4PD4 D;  4IFM A;  4F37 A;  3Q2Y A;  5HV8 A;  2WSE J;  1KIL E;  2R44 A;  2KG9 A;  3NFQ A;  1CW5 A;  5AVU B;  2GA1 A;  2OYO A;  1YJ9 P;  3H1L J;  2MF4 A;  1M90 Q;  3A0B E;  2PEQ A;  2G3A A;  3LMO A;  5B66 H;  1OW6 A;  2N1T D;  5AVQ B;  1YI2 P;  1JJ2 O;  4GR6 A;  1DEB A;  1NU1 K;  5BU5 A;  3HTK A;  1NTZ K;  2KR5 A;  3L71 D;  2JYL A;  3G26 A;  4N78 D;  2PY8 A;  3VTP C;  4GT1 A;  5I4T G;  4WY4 A;  1JO5 A;  4LLH A;  1VF5 C;  2KG8 A;  2X2B A;  3SFD C;  4DCK A;  5DJT B;  2O01 J;  1KQL A;  1SQX D;  2FYU J;  1FZG A;  1L2P A;  1T3U A;  2JB0 A;  1HTL C;  1X22 A;  1E0H A;  2Q6Q A;  1PEM A;  3RL0 D;  3LRY A;  1M1J B;  4D6T G;  1M1J A;  3VMY A;  3P05 A;  4BPG A;  5GTI E;  3M0D C;  1N8R Q;  3OA7 A;  1HJB A;  2K93 A;  2K37 A;  2KK7 A;  3NMD A;  1T8Z A;  1BE3 D;  3CC2 P;  3H1I J;  1EMV A;  1JCD A;  1JY2 N;  5BS2 A;  1J2J B;  3ITK A;  2FVF A;  1QL1 A;  2E74 C;  1OVR A;  1K30 A;  3RGU A;  2GZE A;  2IFN A;  1TU3 F;  3CX5 D;  1GXG A;  5KAF E;  3CCR P;  2PEJ A;  4IOI H;  3RK2 B;  3U43 A;  1UIX A;  3L72 J;  1LTJ A;  2QVA A;  5KLI B;  3CCV P;  2CGQ A;  1FZB A;  3CME P;  4HKG A;  4PV1 D;  2WSF H;  3GZL A;  1AQ5 A;  2P1J A;  1RF1 B;  3CCE P;  2KSE A;  1NTK E;  1UJZ A;  2QM8 A;  1SVF A;  1ZW0 A;  1L0N D;  1CEI A;  3AE5 C;  1L0L J;  2QE7 H;  5AVR B;  3CC4 P;  3H1L D;  2MJZ A;  2JWA A;  2FFD B;  1SQB J;  3MUD A;  4AQR D;  1YHQ P;  1LWU C;  2J58 A;  4H0L D;  4C7R A;  1ZOY C;  5HVC A;  4ASV A;  1AF8 A;  2JGP A;  2BCC J;  1BSN A;  5TIS E;  4IPY A;  2LF4 A;  1IFP A;  1FAV A;  1KFN A;  1GU4 A;  1SQP E;  2A06 G;  2JYG A;  2K5X A;  1FJP A;  1A02 J;  3CX5 I;  1G2C B;  4I7Z C;  2B87 A;  2YKP A;  3BAT A;  4JQ0 D;  2W6A A;  1URQ B;  4U0D A;  5CCH C;  1ZR4 A;  3VMZ A;  3E2D A;  5KLV G;  3S4R A;  2JJL A;  1VQ6 P;  1UNK A;  3L70 D;  1J1E C;  3CXH E;  4NPD A;  2CNR A;  5TIS H;  4XFJ A;  3G1I A;  3GF7 A;  4IL6 E;  1BGY G;  1SQX E;  3HD7 A;  4R0M A;  3II6 A;  1HGV A;  1AUM A;  1HUC A;  4U0F A;  4Z1M H;  2M3E A;  1GU5 A;  3GJN A;  4RO0 A;  2D2C D;  1Q7Y Q;  2ZFC A;  2P10 A;  2B88 A;  4XE5 B;  4PD4 H;  1NWQ A;  3BVH A;  1SFC B;  1KQF B;  1K05 A;  2KOS A;  1WT6 A;  4DT0 A;  5CCG A;  5APV A;  1ZRT D;  4XFX A;  1MZ9 A;  2JBG A;  5F2N A;  2YIU C;  2DGY A;  3NTE A;  1RF1 A;  1GK4 A;  1LGH B;  3CCM P;  3M91 A;  2D2C B;  1LTS C;  1BCC D;  5KKZ C;  3GG2 A;  1P84 I;  2Q1K A;  3H1J E;  3OAK A;  1VPC A;  5CMZ A;  3L73 J;  1DV5 A;  3IR9 A;  2PEI A;  2PP6 A;  2W27 A;  3DPH A;  3V4W A;  3A3Y B;  4U3F D;  3KXD A;  4HB1 A;  2I8D A;  2KG6 A;  4UB8 E;  2FAD A;  3AED C;  1RO2 A;  1J1E B;  2YO2 A;  1AYI A;  1GW4 A;  4HKZ H;  5APU A;  1NTM G;  5KP7 B;  2KOD A;  2KOG A;  5GTI H;  2BCC D;  1LTA C;  3VMA A;  2O1K A;  3H4E A;  2XKM A;  2W90 A;  1BGY E;  2W8Z A;  1IFJ A;  2N6Z A;  1YJW P;  2K88 A;  3NTN A;  1NTK K;  3RK2 C;  1YQ4 C;  3H0D A;  3H6P A;  4H44 D;  2Y0C A;  4H44 B;  2AXT H;  3MUD C;  3FWL A;  5GTH H;  2P58 A;  2CK3 H;  3HRN A;  5EW5 E;  3RL0 B;  2JR8 A;  2YMY A;  1L0L D;  1H0T B;  1SQB E;  1L0H A;  1Q90 D;  2OYH B;  1QLE D;  2IDB A;  2OYI A;  2M8P A;  3EJD A;  1RE4 C;  2OYI B;  3L75 E;  3FWN A;  1EZV I;  1BCC J; 
#chains in the Genus database with same CATH homology
 3WBH A;  1VQO P;  2OTL P;  1NJI Q;  2CWO A;  1S72 P;  1QVF O;  4QNB A;  4U0E A;  2EIA A;  5HGL A;  2XV6 A;  1KD1 Q;  1YJ9 P;  3CD6 P;  3CC4 P;  1VQ7 P;  3CCQ P;  1M90 Q;  2BUO A;  4XFX A;  1YIJ P;  4COP A;  2PEQ A;  1VQM P;  1M1K Q;  5JPA A;  5F2N A;  2DGY A;  1M6N A;  3G1G A;  1YI2 P;  3NTE A;  1YHQ P;  1JJ2 O;  5HGO A;  4PH1 A;  4GR6 A;  3DS2 A;  3Q20 A;  3G71 P;  2PEN A;  3CCM P;  3B5I A;  1Q86 Q;  3CC7 P;  1EIA A;  2JYL A;  3CMA P;  3G26 A;  2PY8 A;  5HGM A;  1BAJ A;  3HZQ A;  5I4T G;  2QA4 P;  3CCU P;  2L6E A;  1K9M Q;  3G6E P;  4IPY A;  1W2B O;  2LF4 A;  3CPW O;  1Q82 Q;  2P9X A;  3G21 A;  1IUQ A;  1VQ9 P;  2PEI A;  1K8A Q;  1RO0 A;  3DPH A;  4XRQ A;  3G29 A;  3CXC O;  1A8O A;  2JYG A;  1M74 A;  1RO2 A;  3M1M A;  1VQL P;  4U0C A;  1M6E X;  2Z46 A;  3G4S P;  2PEO A;  1PEM A;  1YJN P;  3LRY A;  1E6J P;  2BQ1 E;  3I55 P;  2EG5 A;  2M8N A;  4U0A A;  2KOD A;  3CCJ P;  5F2O A;  3RG6 C;  3G28 A;  3MGE A;  3P05 A;  2BHV A;  2M8L A;  5HGN A;  2Z45 A;  3H4E A;  4U0D A;  1YIT P;  2QEX P;  1K73 Q;  1N8R Q;  3CCL P;  5DCK A;  2EFJ A;  5F2K A;  4XFZ A;  3E2D A;  3CC2 P;  1A43 A;  1YJW P;  2Z44 A;  2ONT A;  5BS2 A;  1VQK P;  1PEU A;  3DS1 A;  1VQ6 P;  4U0B A;  3HYB A;  3H0D A;  4PH0 A;  1QRJ A;  2E1M A;  3H47 A;  1K30 A;  1EOQ A;  3G1I A;  3VRL C;  1D1D A;  3DS3 A;  3DTJ A;  1VQ8 P;  3I56 P;  2XXM A;  1VQ5 P;  3CCR P;  2PEJ A;  1VQ4 P;  1QVG O;  2OAR A;  1AUM A;  2PEM A;  1PEO A;  4COC A;  3DS4 A;  2JO0 A;  4U0F A;  1VQN P;  3CCV P;  3DS5 A;  1ZMB A;  4WYM A;  2PEK A;  1RNI A;  1KQS O;  3CME P;  2XT1 A;  2M8P A;  4XFY A;  4M0I A;  1Q7Y Q;  1KC8 Q;  4GR2 A;  4XRO A;  1Q81 Q;  1VQP P;  1PEQ A;  5BS1 A;  3CCS P;  3G0V A;  3DS0 A;  3CCE P;  2OTJ P;  3OW2 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...