2OTJP

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2otjP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 2otjP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 2otjP02
2QEXP 1VQ7P 1VQPP 1Q86Q 1K9MQ 3G6EP 3CCVP 3I55P 1VQ6P 1YJNP 1K8AQ 3CMEP 1QVGO 1KD1Q 3CMAP 1QVFO 1YJWP 1VQNP 3CPWO 1Q82Q 1N8RQ 1M1KQ 3CD6P 1VQOP 3CXCO 3CC7P 3I56P 3CC2P 1VQ9P 1VQKP 1Q7YQ 1VQLP 1W2BO 2OTLP 1NJIQ 3OW2O 1YIJP 3CCRP 3CCUP 1M90Q 1KQSO 2OTJP 1VQ4P 3CCSP 3CCMP 1JJ2O 3CCEP 2QA4P 1KC8Q 1S72P 1VQMP 3CCQP 1YJ9P 1VQ5P 1YHQP 1Q81Q 3G71P 1K73Q 1YI2P 1YITP 1VQ8P 3CCLP 3CC4P 3G4SP 3CCJP
chains in the Genus database with same CATH superfamily
3HD7B 3I55P 1VL2A 1L0NE 4GODA 1RE4A 5TISE 1DX7A 3V5BA 2QJYC 2MJZA 1W2EA 1GW3A 3EFFK 3CCMP 2K2QA 2FKWB 4JYCA 1D7MA 3KZIE 4TT3H 3L73J 2H88C 3Q3DA 2FVEA 1K8AQ 1G1IA 1H0TB 4I7ZB 3H1IE 2HODA 3IAOA 2J5UA 1X8YA 2JDIH 5APWA 1LT9C 1AA0A 1NU1J 2K94A 3II6A 4PV1B 1PPJE 4PD4E 2NPSA 2IZ1A 2N1TB 2C0WA 1NTZE 2HR3A 3G21A 3L71D 2RMZA 1BE3E 5AW9B 1LTTC 2K1AA 2KOGA 4Z1MH 1M7LA 1X3OA 3CC7P 4HJGH 3H1JJ 2VLOA 2IBZE 5BS1A 2GZFA 2HFED 2OGUA 2K93A 2JP3A 1S72P 2N6YA 3GW6A 2PRRA 2KR5A 1K73Q 4C7NA 1VQ8P 3M0DC 1SQPJ 2H7HA 3CCVP 1EXJA 1Q82Q 1MFTA 1DV5A 3L70G 3DS2A 4HB1A 3KHUA 1EDIA 5CBOA 3E2DA 2CGQA 1AJYA 3N4XA 4UB6E 1FJKA 2KG6A 4I6MC 2KW2A 3VOPA 1DH3A 1N7SA 2K0YA 3L74J 1RNIA 5APUA 3I56P 3H1KJ 2IPPA 2P10A 2BCCJ 3RK3C 1NU1K 3HE4A 1IFIA 1ZRTE 1Z6MA 3EJBA 1QX8A 1RE3C 5M1BA 3L75G 1NTMD 5EJDA 2WSCJ 4MN4C 2YXQB 1SQXG 1KC8Q 3FWLA 3U1AA 1YHQP 2ZT9B 2KODA 1SQPK 1OR5A 1Q2NA 2R44A 1JTHA 4PV1C 5HVCA 1AYIA 3H4EA 1NAYA 1F80D 2JU2A 2M3EA 3A0HE 2WSFH 4AQRD 1BAJA 1CI6A 3L70E 2SPZA 4U3FE 4L75A 1JOCA 2IFMA 5AVSB 1T3UA 1E79H 2HLOA 2FVAA 3L4FA 3QWOC 3ABVC 2GUSA 2IYPA 5B5EH 4JPZB 1VQ9P 1E6JP 1KYOI 3FXDA 7CEIA 2R32A 2YO3A 4M3LA 2JO0A 1OZHA 4D6TE 1S5LH 1FC2C 1SP4A 5TJHA 2OYIB 1CSBA 1PFIA 1Q90D 5APYA 2OYHA 3JCUE 1Q86Q 2I1KA 3FX0A 4ZKUA 2A45H 5KAFE 1NYHA 1OVUA 1SQBK 2FQ2A 1NO4A 5BVZA 5KLIC 2QNWA 3M0AA 2QA4P 3AE5C 1KILC 4AUWA 3CXHI 1DD4A 1JB0J 3OJAB 1VQPP 1SQXE 2FYUJ 3RK3D 3DPHA 5KP6B 2E76B 3HD7D 3IFMA 1QLED 3L71G 4L74A 3Q2YA 4U0DA 2FFDB 1LWUB 2HPCA 3AE2C 3A0BE 1LP1A 3U43A 1LTJB 5AVXB 1NQ4A 3I5CA 3SSUA 1PP9J 4K3AA 1OW6A 2GA1A 1PGPA 1FS0E 1KB9H 1ZMBA 3GHGC 5AW4B 4XFYA 2ZXEB 4OWFA 3EJDA 3DS1A 2WT7B 4N3YB 1ZMEC 3TF5A 1L0ND 1X22A 1WMKA 1WT6A 2ZT9C 4PV1D 5L8RJ 1MV8A 4MRTC 2G8YA 1KZUB 2MR7A 2XZ0D 3HUSB 1QGKB 3B5NC 5TISH 2PGDA 2C9NY 1JCDA 1GU5A 3T97B 1YIJP 4HYTB 3H1ID 2CPSA 2C9LY 3KZIH 3H1LG 5HGLA 4PD4D 2KI7B 3U59A 1NTZD 2FYUK 3C9IA 1HGZA 2VSQA 1S4XA 1BE3D 2Q3EA 5BU8B 2H8PD 2OYIC 2W8ZA 3EJEA 2WPVB 3OW2O 3Q1MA 3BCCJ 1LT9A 3E1IA 2MVUA 4PD4H 2XXMA 5AVYB 4NPDA 5CJ4A 1RHZB 3B4QA 5AW7B 3QH9A 2CPBA 1KILD 2JWDA 3P32A 1VQKP 1M6EX 2ZXXA 3GF7A 1P84E 2E76C 2JAZA 3IN6A 2FYNB 1GU4A 3VP8A 3NFQA 4XA4A 1LWUC 4BXLA 2ZYDA 1X0TA 1LTJC 4LLHA 1JNMA 5CCHA 3TGUD 2N5HA 3V2PA 1VDFA 2JYGA 5APXA 2A45G 2M8NA 3D6ZA 3M91A 1SLQA 2XT1A 1NTKG 4DG9A 4UHPB 2WPQA 2OQQA 4NPEA 2K88A 4UB6H 4R0MA 2ZT9D 3B8EB 1OVRA 1FU1A 1X79B 2R3SA 3UIAA 1EDJA 3D6YA 3H1LE 2N50A 2QJKC 2EHSA 2M3BA 2QVAA 1AVYA 2PP6A 3CWBJ 3HD7A 3HUSC 1RF1B 4H44B 1DNYA 3EQ2A 2WITA 3NTEA 1RF0C 3H1HJ 3V4QA 1RQUA 3MD0A 5EW5E 2K0DX 2V7QJ 2QIWA 1U7MA 5F2OA 4KJMA 2Z5HA 3N7NA 2B87B 3WBHA 2IYOA 2KZIA 2ZFCA 1L2PA 2J59M 1H0TA 1BCCE 4U3FD 3CMAP 1YJWP 3P7KA 3H0DA 2O01H 1BXIA 2FHSC 4DZOA 2I8DA 2N1TA 1H89A 3A0HH 1CZQA 1L0NG 1SFCC 4QMAA 4D6TD 1NTKE 3CMEP 4RESB 3L37A 2E76D 1VQOP 1OX3A 2FYNC 2I1JA 3P8CE 5F2KA 1HTLC 3L75J 3EWKA 5AVWB 2PEMA 3AEEC 3PRJA 1MUUA 3HYBA 3H1IG 1KFMA 3AE1C 1IFJA 3JCUH 3MP7B 1M74A 2E74B 3CLQA 5KAFH 1N2DC 3Q5RA 2N6ZA 1FZGA 1SQXD 2WPTA 2C0XA 1NTZG 2B9BA 4ZKPA 3G1GA 5KLVJ 2AEFA 3AE6C 3NTNA 2GM4A 2RN0A 2CQ8A 3G26A 1DD3A 3ZDMA 3E7KA 5DJUB 1EQ7A 3VN0A 3L72D 3O6QB 4DJGA 2MR8A 5CZDB 1QEXA 3Q5SA 3M9HA 3A0BH 1HBWA 2POHA 1OW8A 3IR9A 5AVVB 4U0FA 4UB8E 2J58A 1UNKA 1YYCA 4XFZA 2QG4A 4IL6X 3AEFC 2JO1A 2IDBA 1LTBC 2WVRA 2IX7C 1K30A 1G1JA 3TGUG 1QL2A 4GOEA 2VLQA 2DW3A 1X9VA 1ZLLA 4XFJA 5KKZB 2LL8A 2KXPB 1KMIZ 4N78E 4YTPC 1USEA 1EDKA 1JMMA 1SFCD 3PH0A 3L71J 4H0LB 1IZNB 5KLVK 5KAIE 4Y28J 5AW8B 4EOTA 1IUQA 1A8OA 1HGVA 2M8LA 1LTIC 1VPCA 5HGNA 2XU6A 4BPFA 2KK7A 1BGYG 2OYIA 2JQ4A 3L36A 1HUCA 2E74C 1LTGC 1SQQE 1HQBA 1KB9I 1NOHA 2M5AB 1E5WA 2Q6QA 1N73C 1KILE 3M9QA 1BSNA 1P84D 1ZR2A 1L0LJ 1NVOA 3FWNA 4PJ0E 2P2UA 2GZGA 4PH0A 1M1JC 4U3FG 1A02J 4M0IA 5AVRB 1P84H 3NMDA 4H44D 5KLIB 3WUTA 3SFDC 1KYOE 1KILB 1LWUA 2FFDA 3TGUE 2BQ1E 2JR8A 1LTJA 5HV8A 1Q7YQ 5B66E 4D6TG 2K5XA 3KXDA 2P67A 2GZEA 3H1LD 3BRVB 1KLPA 2GDXA 1NTMJ 5KJ7C 3G4SP 1JMBA 3PP5A 1FZCC 2WT7A 1MKMA 3TSIA 1AQTA 3GHGB 2WSFJ 2PEKA 1RQVA 3B4SA 1SQVE 2KG8A 3H1KD 3GF3A 2WSSH 1BDCA 5KKZC 1VQ5P 4I1LA 1BGYE 3HUSA 4ZMDA 3AE7C 2AF8A 5APTA 2AEJA 2Z5IA 4DCKA 3T97A 1L0LK 1T2KC 1BCCD 4H0LC 3GZMA 1SQBD 1BDDA 1IFNA 4H2WC 1S1CX 1Y8AA 3L72G 5CHXA 2OTJP 2IBZI 5JPAA 1VQ4P 5H2FE 1FR2A 1Y47A 1PGJA 3B5NB 1OWAA 1RO2A 3LIDA 1IJDB 5BU5A 2QEXP 1J1DC 2PY8A 4HKGA 4L76A 2E74D 2OYOA 3AEGC 3OAKA 2KOSA 1VQLP 1OVVA 1NTKD 2L9FA 3FGAD 3KPEA 1XTGB 1L0IA 4C7RA 3P8CD 1N7LA 1GK4A 4H13B 3MGNA 1NTMK 3RG2A 4U7JA 1AVOA 2BUOA 1IMPA 3HE5B 3MUDC 2Z45A 2DNWA 3O8ZA 4GDOA 3MIWA 2YO2A 1PGQA 1YQ4C 2O01N 2WTYA 5K5GB 2P1JA 2FY8A 2N5IA 4HKZH 2MF4A 2PNGA 5KJ7D 2D2CC 1YTZT 2XZRA 3EFGA 1EZVI 1ZV8A 2E1MA 3L72E 3LW5H 2ROQA 3BATA 2KSEA 1L0NJ 3VMYA 1NU1G 3L35A 4WY4B 1S3JA 4IFFA 3D70A 4XROA 3VP9A 1SS1A 2LTEA 2HG5D 3CL3D 1RF1A 1JJ2O 1PV3A 4DOJA 4OVNF 1Y9BA 2BEQD 1T2KD 2QJKB 2BEZF 2XKMA 4H0LD 1ZN5A 1RE4C 2L5GB 2WWWA 1GL2B 3VRLC 1OXZA 4UB8H 4B86A 2DGYA 1EXIA 5AVTB 1M1KQ 3H1IJ 4DT0A 4I2LC 2Y0DA 2B87A 3A5TA 2O1KA 1SQPG 4N78D 3U1CA 3RBZA 1NTZJ 2KNCB 1ZR4A 3F5HA 1BE3J 2E5YA 1KQGB 4U0EA 2LXCB 1IFPA 2FQ0A 3HTKB 1GD2E 2BASA 4OH8B 1HVVA 4H13C 4LGDE 3P05A 2R5BA 4IFDK 1T6AA 1VF5B 1M6NA 3L74G 3L73E 2FXPA 3AECC 3H1KG 4WVZA 5KAIH 3V2QA 3CX5I 1PEUA 2LPKA 1QRJA 1SQQD 1Z56A 1L0NK 5CJ0A 1FZEA 1SFCB 1NU1E 2H43A 1BCCG 2KZJA 4WB4A 1T3JA 1SQBG 4F37A 2JKVA 1QL1A 2KS1B 3AEAC 2XNDH 1BSHA 3M0DA 3TGUJ 2KOOA 4HH2A 1H8AA 3GJNA 3H1JE 4PJ0H 1HH0A 1MZ8A 2GUVA 1KYOD 2BHVA 1M57D 3NXSA 2AXTE 4WY4C 4BWNA 1YI2P 3SWYA 1NTZK 1SQPE 2KWLA 3MGEA 4Y99C 5EFWB 3O6QA 3SFEC 2IZ0A 3PTZA 2PEQA 2P58A 2PEOA 2YIUB 2JU1A 1KYOH 1DEEG 2W6JH 2K3RA 1EIAA 5B66H 2R5DA 1GPJA 1GL2C 2W6BA 2OTKE 1LTAC 1FDIA 2KYVA 1S2EA 1SQVD 3B5ND 3RL0B 4WYMA 3NY7B 1MFZA 3CXHD 5KJ7A 1W5CE 3L74E 2O01J 1BGYD 2PAJA 3H1KE 3G3ZA 2ZYAA 1RE3A 3Q20A 2KGAA 2BCCE 2G3AA 5AW3B 3KDPB 4TLFA 2FAEA 2E75C 1RO0A 3L70J 4YXWH 3H47A 3DS0A 4U3FJ 3V2NA 2WSEJ 2L22A 2W6AA 1LNQA 2K0XA 4IZ6A 1FBMA 2MVVA 4JQ0D 5GTHE 4H13D 1SQBE 4XRQA 3GKLC 1VF5C 2AFEA 2CG5B 2YMYA 1W2BO 1NKNA 2FYUG 4D6TJ 5H2FH 1ZP0C 1RY3A 2WSEH 3WUVA 4EDFA 4PH1A 1URQB 4K35A 3K5BA 3DS3A 1NGMB 4GKGA 3LIEA 3C1LA 3TNUB 5CCGC 1OFCX 2ZJSE 1SVFA 3SWFA 2KB7P 2M5AA 4COCA 1D1DA 1G2CB 1PL5A 3H32B 3H6PA 2FBWC 1YBKA 1SQXJ 1GK6A 2JWAA 1VQ6P 3RL0g 2QE7H 4WY4D 1N73B 1PZQA 1T8ZA 4CPGA 1M90Q 2LF4A 4KT0J 3AE9C 2RKLA 1NHLA 3DS4A 2YIUC 1GXHA 1L4AB 2LKIA 1VHNA 1M1JB 1HY8A 2EHTA 1VQ7P 1KILA 3RK2B 4IL6E 3WMM0 3A3YB 1GL2D 2K37A 2JB0A 3CX5D 1N8RQ 3USSA 2IFNA 2NO8A 2Z46A 4KHXA 2M0BA 2YKQA 1SQQG 3RL0C 2XV5A 2LOLA 3CCSP 3AEBC 2YMKA 2FADA 2Z44A 2N9YB 1ACPA 3PLNA 2O3JA 2FYUE 5AVUB 2LXBA 3G29A 3MZWB 3GHGA 2E75D 3BASA 1QVFO 3S1KA 3VMXA 1XTCC 3B71A 2LR2A 1WRGA 1L0HA 1UIXA 1FZCB 2ZVOB 2WQYC 1JY3P 1PP9E 3A7OA 2Q3IA 3E1RA 1VF5D 1M8OB 3IF4A 2Q1KA 1NH4A 3VYIA 2A45I 2Y0CA 3V4WA 4EIJA 1KD1Q 1SQXK 3S4RA 4U0AA 1UJZA 4GOFA 4RJTA 3W67A 1TU3F 1VKUA 2GDYA 4H2YC 2ONTA 3B5NA 2KG9A 5AVZB 3M1MA 1URQC 2X2BA 4NPFX 1AFOA 1GXGA 5DCKA 5CCGD 4IPYA 1SQVG 2PEJA 4GT1A 2EFJA 2JBGA 3L73D 2KIKA 1AF8A 1GW4A 1J1DB 5AW0B 1IC2A 3LMOA 3AEDC 2AEMA 2GZIA 3CCQP 1NU1D 4AYCA 1AUMA 4L73A 1EZVG 3HE5A 2WZ7A 3A2AA 2P7JA 3CE7A 2UWJE 1L4AC 3CWBG 1NJIQ 4YPCA 1FAVA 2VRSA 3BCCE 5GTIE 3RK2C 2MD9A 3DS5A 2LMLA 3H1JD 1KORA 3H1HG 2CNRA 2M8RA 2W90A 3RL0D 1JY2O 3ITKA 5AVQB 5CCHC 3H1LJ 1SQPD 1J2JB 2PEIA 4U0BA 1S9KE 2Y0EA 2FXMA 1L0LD 3G0VA 3GZLA 1PEQA 3WU2E 3Q5PA 3G71P 1K05A 4BRYB 2AXTH 2D2CB 2Y9YA 4WY4A 1CEIA 1K9MQ 1M56D 1DEBA 1QVGO 1EC5A 1VQNP 2QJPB 2K9JB 3S9OA 3M06A 1KQLA 1OIPA 3L74D 3HD7C 3RG6C 2RH0A 3CXHE 1CW5A 1GL2A 1EMVA 4PD4I 2KGCA 2BCCD 3DTJA 1BCCJ 1SQBJ 3OA7A 2ZAEB 1ZOYC 1IO4A 1URQD 2K92A 1RF0A 1GZLA 1EZVE 2FYZA 2KNCA 1JY3N 4YXDC 1R5LA 4H2XC 4GIFA 1A43A 1KFNA 4I7ZC 4ZNCA 3G9RA 1YJ9P 3CWBE 3BRTB 5AW5B 1NTKJ 3H1HE 1K04A 4R4LA 2KGDA 5GTHH 4JYBA 2N1TC 3HTKA 3CI9A 5KLVG 2QM8A 3VMZA 1PIXA 2WSCH 5E79E 2AXCA 2HODB 2LKMA 1T8KA 5C39A 2AVAA 4XE5B 3V6IA 2NPSB 2A06G 1L4AD 3LRYA 3RK2D 1HF9A 2QM7A 1SFCA 1JEKA 5KP8B 2ZYGA 5HGMA 1EOQA 3JC22 3WUUA 2LIWA 2OTLP 4WBAA 4EI2A 1J1EB 5I4TG 5CCHD 2JEEA 2KS1A 5CCGA 2R3CA 3BVHA 3LW5J 3TYYA 1JCCA 3HRNA 3CC4P 4C7NB 4QKOA 3R2PA 1FZAA 3B5IA 3CD6P 2KLVA 2H89C 1GMJA 5APVA 3L75E 3CCRP 1KQSO 3L73G 3RBXA 1FDMA 2FVFA 2WPSA 2CWOA 3CX5E 2FXOA 1UIIA 2QJPC 4GR2A 1KB9D 4IL6H 4XFXA 2GZJA 4QNBA 3CPWO 1NTKK 2LIUA 2L91A 2MKVA 1N7SB 2FYUD 4Y99B 3GMAA 5KLVE 3AE8C 3HE4B 1AV1A 1PP9D 3H1JG 2NZ2A 2Q5UA 1ZXGA 4O9BA 2A06E 1PEMA 2GDWA 2L0QA 1YTZI 3P8MC 1R5SA 2JYLA 4JF7A 2N1TD 1L0LG 2Q9IA 1GDTA 3RGUA 1A02F 2FQ1A 3VMAA 4OGQB 2L4BA 1LT1A 2QRXA 2E75B 5CMZA 1FDOA 1LTSC 1IMQA 4PXHB 1JY2P 2Z4EA 1JTHB 2NPSC 4EYYQ 1ZW0A 2K9YA 1SQQJ 1FE6A 5KP7B 3TK1A 4WWIA 1CI6B 1PPJD 1URQA 3G6EP 3AE4C 1J1EC 5F2NA 1DIPA 3FXEA 2N98A 3D71A 2BCCG 3TNUA 4PWVB 3KQGA 2YKPA 1JY3O 3L71E 1NTMG 4ASVA 1G2CA 2N9BA 5KTBA 3H32A 2IBZD 4RO0A 2KSJA 3CCLP 3BCCD 1FZBA 1HWTC 2D2CD 1U57A 1NAFA 2OYHB 1N73A 2V4HA 5DJTB 2OARA 1JM0A 2E43A 2YXRB 2EIAA 1L4AA 5GTIH 3VTPC 1M1JA 1S9KD 1NWQA 4W7ZA 1Q81Q 4IOIH 2KP8A 1R8EA 2FFDC 1N7SC 2XZ1C 1L0LE 1HJBA 2EG5A 2KORA 1KTMA 2WPRA 3CC2P 4C46A 3G28A 1MZ9A 2Q7CA 1NKZB 1KN7A 2KOPA 1SQVJ 5AW6B 2HPCB 1KQFB 1LP1B 3M9BA 3WU2H 4W7YA 1BGYJ 1SQQK 2KLUA 2YKOA 3C8VA 4COPA 2JGPA 2M8PA 3HZQA 1ZRTD 1RH5B 1FZCA 1FOSF 1OW7A 4A7PA 5BS2A 1LJ2A 4BPHA 3CCUP 1IFDA 4OGQC 3V2RA 3CCEP 5AW2B 2ITAA 4IFMA 2HYNA 3CXHH 2QSIA 4ASWA 1EZVD 5APSA 1NTME 2NPSD 3MHVA 3R4YA 1ZNVA 1YJNP 3CWBD 2KUBA 2O1JA 4JBZA 3F89A 2FACA 3H1HD 3PJSK 3TDKA 2KGEA 4W80A 2E5TA 1LGHB 2B89A 1P84I 2QJYB 2WMMA 3PHLA 2XV6A 2KOQA 1JO5A 2PFXA 3CCJP 1PEOA 3L70D 2E42A 2YNYA 5B5EE 2XNXA 1JY2N 4U0CA 2W27A 1PP9G 2B88A 2PENA 2V7QH 5E79H 3GLMA 5APQA 2VLNA 1S5LE 4R4MA 1SQVK 2OYHC 4BPGA 1VQMP 1LT9B 2M5RA 1IK9A 2W83C 1GTWA 3CXCO 4RKUJ 1H88A 1AQ5A 1PGOA 1N7SD 1N86A 1HJ0A 2ERHA 3MUDA 5AW1B 1FOSE 3L72J 3L75D 3JSVC 1S5LX 3KYQA 1FJPA 2Y9ZA 3MTUE 2XDJA 4LC1A 3G1IA 2P9XA 1PPJG 1EDLA 2L6EA 5HGOA 2GYKA 3H25A 2NRGA 1BE3G 4NEOA 2VLPA 1E0HA 3RK3E 4BRYA 1KB9E 3AE3C 1KV4A 1YQ3C 1FZFA 5CBNA 3W68A 4N6JA 3CX5H 5KLVD 2AFDA 4CA3A 4OGQD 2IBZG 2MY5A 2K9JA 1JUNA 2CK3H 2ZVNB 1U7JA 3BCCG 1IK7A 1RF1C 4H44C 1IFMA 1USDA 2A06D 1OMIA 4GR6A 3GG2A 1YITP 3SWKA 3RK3B 2JJLA
chains in the Genus database with same CATH topology
3DTJA 3MGEA 5HGLA 2QEXP 4GR2A 5DCKA 3VRLC 1Q86Q 2PY8A 3I55P 2PEQA 1VQ6P 3NTEA 4IPYA 2PEOA 2DGYA 4XFXA 1RNIA 4QNBA 3CPWO 1M1KQ 2PEJA 2EFJA 4U0CA 3I56P 2OARA 1VQLP 4PH0A 2PENA 5F2OA 4M0IA 1EIAA 3OW2O 1M90Q 2EIAA 2LF4A 3CCMP 2QA4P 1A43A 2XXMA 1VQMP 3DS4A 3WBHA 3CCQP 1YJ9P 1Q81Q 4WYMA 4U0FA 1VQ7P 1VQPP 1AUMA 3DPHA 1K8AQ 3CMAP 2EG5A 1YJWP 1N8RQ 3CXCO 1PEMA 2BQ1E 4U0EA 2Z46A 4U0DA 4XFZA 3H0DA 3CC2P 1VQKP 2BUOA 3G28A 1Q7YQ 3Q20A 1NJIQ 2Z45A 1M6EX 2JYLA 3DS5A 3CCSP 3P05A 1RO0A 1KC8Q 3H47A 3DS0A 1M6NA 2Z44A 1PEOA 1K30A 1YHQP 1ZMBA 3G21A 4XFYA 2KODA 3G4SP 1PEUA 3LRYA 4COPA 1QRJA 3G29A 2M8PA 3CMEP 3HZQA 3G1IA 1QVFO 4XRQA 2P9XA 3DS1A 5HGMA 1VQOP 3CC7P 1EOQA 2PEIA 3H4EA 4U0BA 2OTLP 1W2BO 5BS2A 2PEKA 2L6EA 5HGOA 5F2KA 3G0VA 5BS1A 1BAJA 3CCUP 5I4TG 2PEMA 2JYGA 3CCEP 2M8NA 1PEQA 3HYBA 2XT1A 1S72P 1VQ5P 2E1MA 3G71P 1K73Q 1VQ8P 3CC4P 1K9MQ 3G6EP 3CCVP 5F2NA 1YJNP 1QVGO 1M74A 1IUQA 1A8OA 4PH1A 1KD1Q 1VQNP 1Q82Q 3B5IA 3CD6P 2M8LA 3DS3A 4U0AA 1VQ9P 1E6JP 3DS2A 4XROA 5HGNA 2ONTA 1YIJP 3CCRP 1KQSO 2OTJP 5JPAA 1VQ4P 3RG6C 2JO0A 3G1GA 1JJ2O 2BHVA 3E2DA 4COCA 3M1MA 4GR6A 1D1DA 2CWOA 1RO2A 1YI2P 1YITP 2XV6A 3CCLP 3G26A 3CCJP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX P;  1VQ7 P;  1VQP P;  1Q86 Q;  1K9M Q;  3G6E P;  3CCV P;  3I55 P;  1VQ6 P;  1YJN P;  1K8A Q;  3CME P;  1QVG O;  1KD1 Q;  3CMA P;  1QVF O;  1YJW P;  1VQN P;  3CPW O;  1Q82 Q;  1N8R Q;  1M1K Q;  3CD6 P;  1VQO P;  3CXC O;  3CC7 P;  3I56 P;  3CC2 P;  1VQ9 P;  1VQK P;  1Q7Y Q;  1VQL P;  1W2B O;  2OTL P;  1NJI Q;  3OW2 O;  1YIJ P;  3CCR P;  3CCU P;  1M90 Q;  1KQS O;  2OTJ P;  1VQ4 P;  3CCS P;  3CCM P;  1JJ2 O;  3CCE P;  2QA4 P;  1KC8 Q;  1S72 P;  1VQM P;  3CCQ P;  1YJ9 P;  1VQ5 P;  1YHQ P;  1Q81 Q;  3G71 P;  1K73 Q;  1YI2 P;  1YIT P;  1VQ8 P;  3CCL P;  3CC4 P;  3G4S P;  3CCJ P; 
#chains in the Genus database with same CATH topology
 3HD7 B;  3I55 P;  1VL2 A;  1L0N E;  4GOD A;  1RE4 A;  5TIS E;  1DX7 A;  3V5B A;  2QJY C;  2MJZ A;  1W2E A;  1GW3 A;  3EFF K;  3CCM P;  2K2Q A;  2FKW B;  4JYC A;  1D7M A;  3KZI E;  4TT3 H;  3L73 J;  2H88 C;  3Q3D A;  2FVE A;  1K8A Q;  1G1I A;  1H0T B;  4I7Z B;  3H1I E;  2HOD A;  3IAO A;  2J5U A;  1X8Y A;  2JDI H;  5APW A;  1LT9 C;  1AA0 A;  1NU1 J;  2K94 A;  3II6 A;  4PV1 B;  1PPJ E;  4PD4 E;  2NPS A;  2IZ1 A;  2N1T B;  2C0W A;  1NTZ E;  2HR3 A;  3G21 A;  3L71 D;  2RMZ A;  1BE3 E;  5AW9 B;  1LTT C;  2K1A A;  2KOG A;  4Z1M H;  1M7L A;  1X3O A;  3CC7 P;  4HJG H;  3H1J J;  2VLO A;  2IBZ E;  5BS1 A;  2GZF A;  2HFE D;  2OGU A;  2K93 A;  2JP3 A;  1S72 P;  2N6Y A;  3GW6 A;  2PRR A;  2KR5 A;  1K73 Q;  4C7N A;  1VQ8 P;  3M0D C;  1SQP J;  2H7H A;  3CCV P;  1EXJ A;  1Q82 Q;  1MFT A;  1DV5 A;  3L70 G;  3DS2 A;  4HB1 A;  3KHU A;  1EDI A;  5CBO A;  3E2D A;  2CGQ A;  1AJY A;  3N4X A;  4UB6 E;  1FJK A;  2KG6 A;  4I6M C;  2KW2 A;  3VOP A;  1DH3 A;  1N7S A;  2K0Y A;  3L74 J;  1RNI A;  5APU A;  3I56 P;  3H1K J;  2IPP A;  2P10 A;  2BCC J;  3RK3 C;  1NU1 K;  3HE4 A;  1IFI A;  1ZRT E;  1Z6M A;  3EJB A;  1QX8 A;  1RE3 C;  5M1B A;  3L75 G;  1NTM D;  5EJD A;  2WSC J;  4MN4 C;  2YXQ B;  1SQX G;  1KC8 Q;  3FWL A;  3U1A A;  1YHQ P;  2ZT9 B;  2KOD A;  1SQP K;  1OR5 A;  1Q2N A;  2R44 A;  1JTH A;  4PV1 C;  5HVC A;  1AYI A;  3H4E A;  1NAY A;  1F80 D;  2JU2 A;  2M3E A;  3A0H E;  2WSF H;  4AQR D;  1BAJ A;  1CI6 A;  3L70 E;  2SPZ A;  4U3F E;  4L75 A;  1JOC A;  2IFM A;  5AVS B;  1T3U A;  1E79 H;  2HLO A;  2FVA A;  3L4F A;  3QWO C;  3ABV C;  2GUS A;  2IYP A;  5B5E H;  4JPZ B;  1VQ9 P;  1E6J P;  1KYO I;  3FXD A;  7CEI A;  2R32 A;  2YO3 A;  4M3L A;  2JO0 A;  1OZH A;  4D6T E;  1S5L H;  1FC2 C;  1SP4 A;  5TJH A;  2OYI B;  1CSB A;  1PFI A;  1Q90 D;  5APY A;  2OYH A;  3JCU E;  1Q86 Q;  2I1K A;  3FX0 A;  4ZKU A;  2A45 H;  5KAF E;  1NYH A;  1OVU A;  1SQB K;  2FQ2 A;  1NO4 A;  5BVZ A;  5KLI C;  2QNW A;  3M0A A;  2QA4 P;  3AE5 C;  1KIL C;  4AUW A;  3CXH I;  1DD4 A;  1JB0 J;  3OJA B;  1VQP P;  1SQX E;  2FYU J;  3RK3 D;  3DPH A;  5KP6 B;  2E76 B;  3HD7 D;  3IFM A;  1QLE D;  3L71 G;  4L74 A;  3Q2Y A;  4U0D A;  2FFD B;  1LWU B;  2HPC A;  3AE2 C;  3A0B E;  1LP1 A;  3U43 A;  1LTJ B;  5AVX B;  1NQ4 A;  3I5C A;  3SSU A;  1PP9 J;  4K3A A;  1OW6 A;  2GA1 A;  1PGP A;  1FS0 E;  1KB9 H;  1ZMB A;  3GHG C;  5AW4 B;  4XFY A;  2ZXE B;  4OWF A;  3EJD A;  3DS1 A;  2WT7 B;  4N3Y B;  1ZME C;  3TF5 A;  1L0N D;  1X22 A;  1WMK A;  1WT6 A;  2ZT9 C;  4PV1 D;  5L8R J;  1MV8 A;  4MRT C;  2G8Y A;  1KZU B;  2MR7 A;  2XZ0 D;  3HUS B;  1QGK B;  3B5N C;  5TIS H;  2PGD A;  2C9N Y;  1JCD A;  1GU5 A;  3T97 B;  1YIJ P;  4HYT B;  3H1I D;  2CPS A;  2C9L Y;  3KZI H;  3H1L G;  5HGL A;  4PD4 D;  2KI7 B;  3U59 A;  1NTZ D;  2FYU K;  3C9I A;  1HGZ A;  2VSQ A;  1S4X A;  1BE3 D;  2Q3E A;  5BU8 B;  2H8P D;  2OYI C;  2W8Z A;  3EJE A;  2WPV B;  3OW2 O;  3Q1M A;  3BCC J;  1LT9 A;  3E1I A;  2MVU A;  4PD4 H;  2XXM A;  5AVY B;  4NPD A;  5CJ4 A;  1RHZ B;  3B4Q A;  5AW7 B;  3QH9 A;  2CPB A;  1KIL D;  2JWD A;  3P32 A;  1VQK P;  1M6E X;  2ZXX A;  3GF7 A;  1P84 E;  2E76 C;  2JAZ A;  3IN6 A;  2FYN B;  1GU4 A;  3VP8 A;  3NFQ A;  4XA4 A;  1LWU C;  4BXL A;  2ZYD A;  1X0T A;  1LTJ C;  4LLH A;  1JNM A;  5CCH A;  3TGU D;  2N5H A;  3V2P A;  1VDF A;  2JYG A;  5APX A;  2A45 G;  2M8N A;  3D6Z A;  3M91 A;  1SLQ A;  2XT1 A;  1NTK G;  4DG9 A;  4UHP B;  2WPQ A;  2OQQ A;  4NPE A;  2K88 A;  4UB6 H;  4R0M A;  2ZT9 D;  3B8E B;  1OVR A;  1FU1 A;  1X79 B;  2R3S A;  3UIA A;  1EDJ A;  3D6Y A;  3H1L E;  2N50 A;  2QJK C;  2EHS A;  2M3B A;  2QVA A;  1AVY A;  2PP6 A;  3CWB J;  3HD7 A;  3HUS C;  1RF1 B;  4H44 B;  1DNY A;  3EQ2 A;  2WIT A;  3NTE A;  1RF0 C;  3H1H J;  3V4Q A;  1RQU A;  3MD0 A;  5EW5 E;  2K0D X;  2V7Q J;  2QIW A;  1U7M A;  5F2O A;  4KJM A;  2Z5H A;  3N7N A;  2B87 B;  3WBH A;  2IYO A;  2KZI A;  2ZFC A;  1L2P A;  2J59 M;  1H0T A;  1BCC E;  4U3F D;  3CMA P;  1YJW P;  3P7K A;  3H0D A;  2O01 H;  1BXI A;  2FHS C;  4DZO A;  2I8D A;  2N1T A;  1H89 A;  3A0H H;  1CZQ A;  1L0N G;  1SFC C;  4QMA A;  4D6T D;  1NTK E;  3CME P;  4RES B;  3L37 A;  2E76 D;  1VQO P;  1OX3 A;  2FYN C;  2I1J A;  3P8C E;  5F2K A;  1HTL C;  3L75 J;  3EWK A;  5AVW B;  2PEM A;  3AEE C;  3PRJ A;  1MUU A;  3HYB A;  3H1I G;  1KFM A;  3AE1 C;  1IFJ A;  3JCU H;  3MP7 B;  1M74 A;  2E74 B;  3CLQ A;  5KAF H;  1N2D C;  3Q5R A;  2N6Z A;  1FZG A;  1SQX D;  2WPT A;  2C0X A;  1NTZ G;  2B9B A;  4ZKP A;  3G1G A;  5KLV J;  2AEF A;  3AE6 C;  3NTN A;  2GM4 A;  2RN0 A;  2CQ8 A;  3G26 A;  1DD3 A;  3ZDM A;  3E7K A;  5DJU B;  1EQ7 A;  3VN0 A;  3L72 D;  3O6Q B;  4DJG A;  2MR8 A;  5CZD B;  1QEX A;  3Q5S A;  3M9H A;  3A0B H;  1HBW A;  2POH A;  1OW8 A;  3IR9 A;  5AVV B;  4U0F A;  4UB8 E;  2J58 A;  1UNK A;  1YYC A;  4XFZ A;  2QG4 A;  4IL6 X;  3AEF C;  2JO1 A;  2IDB A;  1LTB C;  2WVR A;  2IX7 C;  1K30 A;  1G1J A;  3TGU G;  1QL2 A;  4GOE A;  2VLQ A;  2DW3 A;  1X9V A;  1ZLL A;  4XFJ A;  5KKZ B;  2LL8 A;  2KXP B;  1KMI Z;  4N78 E;  4YTP C;  1USE A;  1EDK A;  1JMM A;  1SFC D;  3PH0 A;  3L71 J;  4H0L B;  1IZN B;  5KLV K;  5KAI E;  4Y28 J;  5AW8 B;  4EOT A;  1IUQ A;  1A8O A;  1HGV A;  2M8L A;  1LTI C;  1VPC A;  5HGN A;  2XU6 A;  4BPF A;  2KK7 A;  1BGY G;  2OYI A;  2JQ4 A;  3L36 A;  1HUC A;  2E74 C;  1LTG C;  1SQQ E;  1HQB A;  1KB9 I;  1NOH A;  2M5A B;  1E5W A;  2Q6Q A;  1N73 C;  1KIL E;  3M9Q A;  1BSN A;  1P84 D;  1ZR2 A;  1L0L J;  1NVO A;  3FWN A;  4PJ0 E;  2P2U A;  2GZG A;  4PH0 A;  1M1J C;  4U3F G;  1A02 J;  4M0I A;  5AVR B;  1P84 H;  3NMD A;  4H44 D;  5KLI B;  3WUT A;  3SFD C;  1KYO E;  1KIL B;  1LWU A;  2FFD A;  3TGU E;  2BQ1 E;  2JR8 A;  1LTJ A;  5HV8 A;  1Q7Y Q;  5B66 E;  4D6T G;  2K5X A;  3KXD A;  2P67 A;  2GZE A;  3H1L D;  3BRV B;  1KLP A;  2GDX A;  1NTM J;  5KJ7 C;  3G4S P;  1JMB A;  3PP5 A;  1FZC C;  2WT7 A;  1MKM A;  3TSI A;  1AQT A;  3GHG B;  2WSF J;  2PEK A;  1RQV A;  3B4S A;  1SQV E;  2KG8 A;  3H1K D;  3GF3 A;  2WSS H;  1BDC A;  5KKZ C;  1VQ5 P;  4I1L A;  1BGY E;  3HUS A;  4ZMD A;  3AE7 C;  2AF8 A;  5APT A;  2AEJ A;  2Z5I A;  4DCK A;  3T97 A;  1L0L K;  1T2K C;  1BCC D;  4H0L C;  3GZM A;  1SQB D;  1BDD A;  1IFN A;  4H2W C;  1S1C X;  1Y8A A;  3L72 G;  5CHX A;  2OTJ P;  2IBZ I;  5JPA A;  1VQ4 P;  5H2F E;  1FR2 A;  1Y47 A;  1PGJ A;  3B5N B;  1OWA A;  1RO2 A;  3LID A;  1IJD B;  5BU5 A;  2QEX P;  1J1D C;  2PY8 A;  4HKG A;  4L76 A;  2E74 D;  2OYO A;  3AEG C;  3OAK A;  2KOS A;  1VQL P;  1OVV A;  1NTK D;  2L9F A;  3FGA D;  3KPE A;  1XTG B;  1L0I A;  4C7R A;  3P8C D;  1N7L A;  1GK4 A;  4H13 B;  3MGN A;  1NTM K;  3RG2 A;  4U7J A;  1AVO A;  2BUO A;  1IMP A;  3HE5 B;  3MUD C;  2Z45 A;  2DNW A;  3O8Z A;  4GDO A;  3MIW A;  2YO2 A;  1PGQ A;  1YQ4 C;  2O01 N;  2WTY A;  5K5G B;  2P1J A;  2FY8 A;  2N5I A;  4HKZ H;  2MF4 A;  2PNG A;  5KJ7 D;  2D2C C;  1YTZ T;  2XZR A;  3EFG A;  1EZV I;  1ZV8 A;  2E1M A;  3L72 E;  3LW5 H;  2ROQ A;  3BAT A;  2KSE A;  1L0N J;  3VMY A;  1NU1 G;  3L35 A;  4WY4 B;  1S3J A;  4IFF A;  3D70 A;  4XRO A;  3VP9 A;  1SS1 A;  2LTE A;  2HG5 D;  3CL3 D;  1RF1 A;  1JJ2 O;  1PV3 A;  4DOJ A;  4OVN F;  1Y9B A;  2BEQ D;  1T2K D;  2QJK B;  2BEZ F;  2XKM A;  4H0L D;  1ZN5 A;  1RE4 C;  2L5G B;  2WWW A;  1GL2 B;  3VRL C;  1OXZ A;  4UB8 H;  4B86 A;  2DGY A;  1EXI A;  5AVT B;  1M1K Q;  3H1I J;  4DT0 A;  4I2L C;  2Y0D A;  2B87 A;  3A5T A;  2O1K A;  1SQP G;  4N78 D;  3U1C A;  3RBZ A;  1NTZ J;  2KNC B;  1ZR4 A;  3F5H A;  1BE3 J;  2E5Y A;  1KQG B;  4U0E A;  2LXC B;  1IFP A;  2FQ0 A;  3HTK B;  1GD2 E;  2BAS A;  4OH8 B;  1HVV A;  4H13 C;  4LGD E;  3P05 A;  2R5B A;  4IFD K;  1T6A A;  1VF5 B;  1M6N A;  3L74 G;  3L73 E;  2FXP A;  3AEC C;  3H1K G;  4WVZ A;  5KAI H;  3V2Q A;  3CX5 I;  1PEU A;  2LPK A;  1QRJ A;  1SQQ D;  1Z56 A;  1L0N K;  5CJ0 A;  1FZE A;  1SFC B;  1NU1 E;  2H43 A;  1BCC G;  2KZJ A;  4WB4 A;  1T3J A;  1SQB G;  4F37 A;  2JKV A;  1QL1 A;  2KS1 B;  3AEA C;  2XND H;  1BSH A;  3M0D A;  3TGU J;  2KOO A;  4HH2 A;  1H8A A;  3GJN A;  3H1J E;  4PJ0 H;  1HH0 A;  1MZ8 A;  2GUV A;  1KYO D;  2BHV A;  1M57 D;  3NXS A;  2AXT E;  4WY4 C;  4BWN A;  1YI2 P;  3SWY A;  1NTZ K;  1SQP E;  2KWL A;  3MGE A;  4Y99 C;  5EFW B;  3O6Q A;  3SFE C;  2IZ0 A;  3PTZ A;  2PEQ A;  2P58 A;  2PEO A;  2YIU B;  2JU1 A;  1KYO H;  1DEE G;  2W6J H;  2K3R A;  1EIA A;  5B66 H;  2R5D A;  1GPJ A;  1GL2 C;  2W6B A;  2OTK E;  1LTA C;  1FDI A;  2KYV A;  1S2E A;  1SQV D;  3B5N D;  3RL0 B;  4WYM A;  3NY7 B;  1MFZ A;  3CXH D;  5KJ7 A;  1W5C E;  3L74 E;  2O01 J;  1BGY D;  2PAJ A;  3H1K E;  3G3Z A;  2ZYA A;  1RE3 A;  3Q20 A;  2KGA A;  2BCC E;  2G3A A;  5AW3 B;  3KDP B;  4TLF A;  2FAE A;  2E75 C;  1RO0 A;  3L70 J;  4YXW H;  3H47 A;  3DS0 A;  4U3F J;  3V2N A;  2WSE J;  2L22 A;  2W6A A;  1LNQ A;  2K0X A;  4IZ6 A;  1FBM A;  2MVV A;  4JQ0 D;  5GTH E;  4H13 D;  1SQB E;  4XRQ A;  3GKL C;  1VF5 C;  2AFE A;  2CG5 B;  2YMY A;  1W2B O;  1NKN A;  2FYU G;  4D6T J;  5H2F H;  1ZP0 C;  1RY3 A;  2WSE H;  3WUV A;  4EDF A;  4PH1 A;  1URQ B;  4K35 A;  3K5B A;  3DS3 A;  1NGM B;  4GKG A;  3LIE A;  3C1L A;  3TNU B;  5CCG C;  1OFC X;  2ZJS E;  1SVF A;  3SWF A;  2KB7 P;  2M5A A;  4COC A;  1D1D A;  1G2C B;  1PL5 A;  3H32 B;  3H6P A;  2FBW C;  1YBK A;  1SQX J;  1GK6 A;  2JWA A;  1VQ6 P;  3RL0 g;  2QE7 H;  4WY4 D;  1N73 B;  1PZQ A;  1T8Z A;  4CPG A;  1M90 Q;  2LF4 A;  4KT0 J;  3AE9 C;  2RKL A;  1NHL A;  3DS4 A;  2YIU C;  1GXH A;  1L4A B;  2LKI A;  1VHN A;  1M1J B;  1HY8 A;  2EHT A;  1VQ7 P;  1KIL A;  3RK2 B;  4IL6 E;  3WMM 0;  3A3Y B;  1GL2 D;  2K37 A;  2JB0 A;  3CX5 D;  1N8R Q;  3USS A;  2IFN A;  2NO8 A;  2Z46 A;  4KHX A;  2M0B A;  2YKQ A;  1SQQ G;  3RL0 C;  2XV5 A;  2LOL A;  3CCS P;  3AEB C;  2YMK A;  2FAD A;  2Z44 A;  2N9Y B;  1ACP A;  3PLN A;  2O3J A;  2FYU E;  5AVU B;  2LXB A;  3G29 A;  3MZW B;  3GHG A;  2E75 D;  3BAS A;  1QVF O;  3S1K A;  3VMX A;  1XTC C;  3B71 A;  2LR2 A;  1WRG A;  1L0H A;  1UIX A;  1FZC B;  2ZVO B;  2WQY C;  1JY3 P;  1PP9 E;  3A7O A;  2Q3I A;  3E1R A;  1VF5 D;  1M8O B;  3IF4 A;  2Q1K A;  1NH4 A;  3VYI A;  2A45 I;  2Y0C A;  3V4W A;  4EIJ A;  1KD1 Q;  1SQX K;  3S4R A;  4U0A A;  1UJZ A;  4GOF A;  4RJT A;  3W67 A;  1TU3 F;  1VKU A;  2GDY A;  4H2Y C;  2ONT A;  3B5N A;  2KG9 A;  5AVZ B;  3M1M A;  1URQ C;  2X2B A;  4NPF X;  1AFO A;  1GXG A;  5DCK A;  5CCG D;  4IPY A;  1SQV G;  2PEJ A;  4GT1 A;  2EFJ A;  2JBG A;  3L73 D;  2KIK A;  1AF8 A;  1GW4 A;  1J1D B;  5AW0 B;  1IC2 A;  3LMO A;  3AED C;  2AEM A;  2GZI A;  3CCQ P;  1NU1 D;  4AYC A;  1AUM A;  4L73 A;  1EZV G;  3HE5 A;  2WZ7 A;  3A2A A;  2P7J A;  3CE7 A;  2UWJ E;  1L4A C;  3CWB G;  1NJI Q;  4YPC A;  1FAV A;  2VRS A;  3BCC E;  5GTI E;  3RK2 C;  2MD9 A;  3DS5 A;  2LML A;  3H1J D;  1KOR A;  3H1H G;  2CNR A;  2M8R A;  2W90 A;  3RL0 D;  1JY2 O;  3ITK A;  5AVQ B;  5CCH C;  3H1L J;  1SQP D;  1J2J B;  2PEI A;  4U0B A;  1S9K E;  2Y0E A;  2FXM A;  1L0L D;  3G0V A;  3GZL A;  1PEQ A;  3WU2 E;  3Q5P A;  3G71 P;  1K05 A;  4BRY B;  2AXT H;  2D2C B;  2Y9Y A;  4WY4 A;  1CEI A;  1K9M Q;  1M56 D;  1DEB A;  1QVG O;  1EC5 A;  1VQN P;  2QJP B;  2K9J B;  3S9O A;  3M06 A;  1KQL A;  1OIP A;  3L74 D;  3HD7 C;  3RG6 C;  2RH0 A;  3CXH E;  1CW5 A;  1GL2 A;  1EMV A;  4PD4 I;  2KGC A;  2BCC D;  3DTJ A;  1BCC J;  1SQB J;  3OA7 A;  2ZAE B;  1ZOY C;  1IO4 A;  1URQ D;  2K92 A;  1RF0 A;  1GZL A;  1EZV E;  2FYZ A;  2KNC A;  1JY3 N;  4YXD C;  1R5L A;  4H2X C;  4GIF A;  1A43 A;  1KFN A;  4I7Z C;  4ZNC A;  3G9R A;  1YJ9 P;  3CWB E;  3BRT B;  5AW5 B;  1NTK J;  3H1H E;  1K04 A;  4R4L A;  2KGD A;  5GTH H;  4JYB A;  2N1T C;  3HTK A;  3CI9 A;  5KLV G;  2QM8 A;  3VMZ A;  1PIX A;  2WSC H;  5E79 E;  2AXC A;  2HOD B;  2LKM A;  1T8K A;  5C39 A;  2AVA A;  4XE5 B;  3V6I A;  2NPS B;  2A06 G;  1L4A D;  3LRY A;  3RK2 D;  1HF9 A;  2QM7 A;  1SFC A;  1JEK A;  5KP8 B;  2ZYG A;  5HGM A;  1EOQ A;  3JC2 2;  3WUU A;  2LIW A;  2OTL P;  4WBA A;  4EI2 A;  1J1E B;  5I4T G;  5CCH D;  2JEE A;  2KS1 A;  5CCG A;  2R3C A;  3BVH A;  3LW5 J;  3TYY A;  1JCC A;  3HRN A;  3CC4 P;  4C7N B;  4QKO A;  3R2P A;  1FZA A;  3B5I A;  3CD6 P;  2KLV A;  2H89 C;  1GMJ A;  5APV A;  3L75 E;  3CCR P;  1KQS O;  3L73 G;  3RBX A;  1FDM A;  2FVF A;  2WPS A;  2CWO A;  3CX5 E;  2FXO A;  1UII A;  2QJP C;  4GR2 A;  1KB9 D;  4IL6 H;  4XFX A;  2GZJ A;  4QNB A;  3CPW O;  1NTK K;  2LIU A;  2L91 A;  2MKV A;  1N7S B;  2FYU D;  4Y99 B;  3GMA A;  5KLV E;  3AE8 C;  3HE4 B;  1AV1 A;  1PP9 D;  3H1J G;  2NZ2 A;  2Q5U A;  1ZXG A;  4O9B A;  2A06 E;  1PEM A;  2GDW A;  2L0Q A;  1YTZ I;  3P8M C;  1R5S A;  2JYL A;  4JF7 A;  2N1T D;  1L0L G;  2Q9I A;  1GDT A;  3RGU A;  1A02 F;  2FQ1 A;  3VMA A;  4OGQ B;  2L4B A;  1LT1 A;  2QRX A;  2E75 B;  5CMZ A;  1FDO A;  1LTS C;  1IMQ A;  4PXH B;  1JY2 P;  2Z4E A;  1JTH B;  2NPS C;  4EYY Q;  1ZW0 A;  2K9Y A;  1SQQ J;  1FE6 A;  5KP7 B;  3TK1 A;  4WWI A;  1CI6 B;  1PPJ D;  1URQ A;  3G6E P;  3AE4 C;  1J1E C;  5F2N A;  1DIP A;  3FXE A;  2N98 A;  3D71 A;  2BCC G;  3TNU A;  4PWV B;  3KQG A;  2YKP A;  1JY3 O;  3L71 E;  1NTM G;  4ASV A;  1G2C A;  2N9B A;  5KTB A;  3H32 A;  2IBZ D;  4RO0 A;  2KSJ A;  3CCL P;  3BCC D;  1FZB A;  1HWT C;  2D2C D;  1U57 A;  1NAF A;  2OYH B;  1N73 A;  2V4H A;  5DJT B;  2OAR A;  1JM0 A;  2E43 A;  2YXR B;  2EIA A;  1L4A A;  5GTI H;  3VTP C;  1M1J A;  1S9K D;  1NWQ A;  4W7Z A;  1Q81 Q;  4IOI H;  2KP8 A;  1R8E A;  2FFD C;  1N7S C;  2XZ1 C;  1L0L E;  1HJB A;  2EG5 A;  2KOR A;  1KTM A;  2WPR A;  3CC2 P;  4C46 A;  3G28 A;  1MZ9 A;  2Q7C A;  1NKZ B;  1KN7 A;  2KOP A;  1SQV J;  5AW6 B;  2HPC B;  1KQF B;  1LP1 B;  3M9B A;  3WU2 H;  4W7Y A;  1BGY J;  1SQQ K;  2KLU A;  2YKO A;  3C8V A;  4COP A;  2JGP A;  2M8P A;  3HZQ A;  1ZRT D;  1RH5 B;  1FZC A;  1FOS F;  1OW7 A;  4A7P A;  5BS2 A;  1LJ2 A;  4BPH A;  3CCU P;  1IFD A;  4OGQ C;  3V2R A;  3CCE P;  5AW2 B;  2ITA A;  4IFM A;  2HYN A;  3CXH H;  2QSI A;  4ASW A;  1EZV D;  5APS A;  1NTM E;  2NPS D;  3MHV A;  3R4Y A;  1ZNV A;  1YJN P;  3CWB D;  2KUB A;  2O1J A;  4JBZ A;  3F89 A;  2FAC A;  3H1H D;  3PJS K;  3TDK A;  2KGE A;  4W80 A;  2E5T A;  1LGH B;  2B89 A;  1P84 I;  2QJY B;  2WMM A;  3PHL A;  2XV6 A;  2KOQ A;  1JO5 A;  2PFX A;  3CCJ P;  1PEO A;  3L70 D;  2E42 A;  2YNY A;  5B5E E;  2XNX A;  1JY2 N;  4U0C A;  2W27 A;  1PP9 G;  2B88 A;  2PEN A;  2V7Q H;  5E79 H;  3GLM A;  5APQ A;  2VLN A;  1S5L E;  4R4M A;  1SQV K;  2OYH C;  4BPG A;  1VQM P;  1LT9 B;  2M5R A;  1IK9 A;  2W83 C;  1GTW A;  3CXC O;  4RKU J;  1H88 A;  1AQ5 A;  1PGO A;  1N7S D;  1N86 A;  1HJ0 A;  2ERH A;  3MUD A;  5AW1 B;  1FOS E;  3L72 J;  3L75 D;  3JSV C;  1S5L X;  3KYQ A;  1FJP A;  2Y9Z A;  3MTU E;  2XDJ A;  4LC1 A;  3G1I A;  2P9X A;  1PPJ G;  1EDL A;  2L6E A;  5HGO A;  2GYK A;  3H25 A;  2NRG A;  1BE3 G;  4NEO A;  2VLP A;  1E0H A;  3RK3 E;  4BRY A;  1KB9 E;  3AE3 C;  1KV4 A;  1YQ3 C;  1FZF A;  5CBN A;  3W68 A;  4N6J A;  3CX5 H;  5KLV D;  2AFD A;  4CA3 A;  4OGQ D;  2IBZ G;  2MY5 A;  2K9J A;  1JUN A;  2CK3 H;  2ZVN B;  1U7J A;  3BCC G;  1IK7 A;  1RF1 C;  4H44 C;  1IFM A;  1USD A;  2A06 D;  1OMI A;  4GR6 A;  3GG2 A;  1YIT P;  3SWK A;  3RK3 B;  2JJL A; 
#chains in the Genus database with same CATH homology
 3DTJ A;  3MGE A;  5HGL A;  2QEX P;  4GR2 A;  5DCK A;  3VRL C;  1Q86 Q;  2PY8 A;  3I55 P;  2PEQ A;  1VQ6 P;  3NTE A;  4IPY A;  2PEO A;  2DGY A;  4XFX A;  1RNI A;  4QNB A;  3CPW O;  1M1K Q;  2PEJ A;  2EFJ A;  4U0C A;  3I56 P;  2OAR A;  1VQL P;  4PH0 A;  2PEN A;  5F2O A;  4M0I A;  1EIA A;  3OW2 O;  1M90 Q;  2EIA A;  2LF4 A;  3CCM P;  2QA4 P;  1A43 A;  2XXM A;  1VQM P;  3DS4 A;  3WBH A;  3CCQ P;  1YJ9 P;  1Q81 Q;  4WYM A;  4U0F A;  1VQ7 P;  1VQP P;  1AUM A;  3DPH A;  1K8A Q;  3CMA P;  2EG5 A;  1YJW P;  1N8R Q;  3CXC O;  1PEM A;  2BQ1 E;  4U0E A;  2Z46 A;  4U0D A;  4XFZ A;  3H0D A;  3CC2 P;  1VQK P;  2BUO A;  3G28 A;  1Q7Y Q;  3Q20 A;  1NJI Q;  2Z45 A;  1M6E X;  2JYL A;  3DS5 A;  3CCS P;  3P05 A;  1RO0 A;  1KC8 Q;  3H47 A;  3DS0 A;  1M6N A;  2Z44 A;  1PEO A;  1K30 A;  1YHQ P;  1ZMB A;  3G21 A;  4XFY A;  2KOD A;  3G4S P;  1PEU A;  3LRY A;  4COP A;  1QRJ A;  3G29 A;  2M8P A;  3CME P;  3HZQ A;  3G1I A;  1QVF O;  4XRQ A;  2P9X A;  3DS1 A;  5HGM A;  1VQO P;  3CC7 P;  1EOQ A;  2PEI A;  3H4E A;  4U0B A;  2OTL P;  1W2B O;  5BS2 A;  2PEK A;  2L6E A;  5HGO A;  5F2K A;  3G0V A;  5BS1 A;  1BAJ A;  3CCU P;  5I4T G;  2PEM A;  2JYG A;  3CCE P;  2M8N A;  1PEQ A;  3HYB A;  2XT1 A;  1S72 P;  1VQ5 P;  2E1M A;  3G71 P;  1K73 Q;  1VQ8 P;  3CC4 P;  1K9M Q;  3G6E P;  3CCV P;  5F2N A;  1YJN P;  1QVG O;  1M74 A;  1IUQ A;  1A8O A;  4PH1 A;  1KD1 Q;  1VQN P;  1Q82 Q;  3B5I A;  3CD6 P;  2M8L A;  3DS3 A;  4U0A A;  1VQ9 P;  1E6J P;  3DS2 A;  4XRO A;  5HGN A;  2ONT A;  1YIJ P;  3CCR P;  1KQS O;  2OTJ P;  5JPA A;  1VQ4 P;  3RG6 C;  2JO0 A;  3G1G A;  1JJ2 O;  2BHV A;  3E2D A;  4COC A;  3M1M A;  4GR6 A;  1D1D A;  2CWO A;  1RO2 A;  1YI2 P;  1YIT P;  2XV6 A;  3CCL P;  3G26 A;  3CCJ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...