2QA4P

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2qa4P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 2qa4P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 2qa4P02
3CCRP 1KD1Q 1S72P 1VQ4P 3OW2O 3CD6P 1Q82Q 1KQSO 1VQOP 2OTJP 1K8AQ 1K73Q 2QEXP 1KC8Q 1Q81Q 1VQ7P 1Q86Q 3I55P 3CC4P 3CMEP 1YHQP 2QA4P 3CC7P 3I56P 1M1KQ 1JJ2O 1VQ8P 1N8RQ 1VQPP 3CCJP 3CCLP 3CCEP 2OTLP 1VQ9P 1VQ6P 1VQ5P 1M90Q 3G6EP 1QVGO 3CPWO 3CCVP 1VQMP 3CCUP 3CXCO 1YI2P 1YJ9P 1Q7YQ 1VQLP 1NJIQ 1QVFO 1VQNP 3CC2P 3CMAP 3G71P 3CCQP 1W2BO 1K9MQ 3CCMP 1YJNP 1YJWP 1VQKP 3G4SP 1YIJP 1YITP 3CCSP
chains in the Genus database with same CATH superfamily
2K9JA 4ZKUA 1S5LE 1X9VA 1KILE 3KPEA 3RK3E 2GZFA 4PD4E 1JB0J 1LP1B 1SFCB 2FYUK 5KLVG 4WY4C 1JJ2O 3VMXA 2KGAA 3FX0A 4IFFA 2N1TC 2ERHA 4YTPC 1YTZI 1U7MA 3PRJA 2QM7A 3EQ2A 2AEFA 1XTGB 4ASWA 3SWFA 5KJ7D 1J1DC 3KDPB 2QVAA 1PPJG 2FKWB 1KB9H 2Q3IA 2Y0CA 3AEFC 4WBAA 1KYOE 5CJ4A 3EJBA 4WY4D 1NTMD 1RO0A 2MR7A 5TISH 2KXPB 2E42A 2ZFCA 3H1LJ 1L0LD 4R0MA 3HTKA 1G1IA 4WVZA 3FXEA 4U0EA 3K5BA 2MF4A 1LWUA 4ASVA 3JCUH 1D7MA 1SQQG 1L0NJ 2KOGA 1GXHA 1NTZJ 2Z5HA 2XV5A 1K9MQ 2QJKB 3G9RA 2PEKA 3Q1MA 1GL2A 1PV3A 4H2YC 1L0HA 3GW6A 3U1CA 3C8VA 1KB9D 1A8OA 1YQ4C 1Q90D 5E79H 2D2CB 1ZLLA 3RG2A 5BVZA 3L36A 5AVXB 2XNXA 3IFMA 3KZIE 2HFED 4UB6E 3O6QB 1SQVK 2PEIA 2BCCD 1VKUA 1KC8Q 1IMPA 2A45H 1S2EA 5AVWB 2AVAA 4AUWA 1N7SA 1VQ9P 2NPSB 1A02F 3N4XA 1JY3N 1Y9BA 5L8RJ 1FZEA 3CWBE 1NTMG 4PWVB 1NVOA 2MVVA 3AE6C 4UB8E 1CZQA 1L0LG 2R5DA 2ZT9B 3H1KJ 1RF0C 1PEOA 2QM8A 3A2AA 3HUSA 3RK2B 1OVRA 2WPSA 1NU1G 2WITA 5B66E 2AF8A 2OYHB 3BASA 2FYNC 2IFMA 1YTZT 3UIAA 3L74D 4GKGA 1DX7A 3CCSP 2Q6QA 3C9IA 1FZCC 2KGEA 3SSUA 1JY2P 2GZGA 1RH5B 4I7ZB 1MZ9A 3GMAA 3OA7A 3L70D 3M0DA 2N1TA 5BU8B 2EIAA 1VQ4P 2BCCG 2E76B 5AVQB 2WTYA 2Z44A 1GD2E 1YQ3C 4RKUJ 4H2XC 1N8RQ 5EJDA 2IZ0A 3G3ZA 3TNUB 2J5UA 2C0WA 3H6PA 2NO8A 2GUVA 3B5NB 3RL0C 2P7JA 5AW6B 3V2QA 5APXA 4GODA 2JGPA 3LRYA 3CXHE 4PD4I 2PGDA 3LW5H 1YYCA 2A06E 3G1IA 3H1IG 3WMM0 3RK3C 2LPKA 3BCCE 5AW3B 3MUDA 3A0BE 1PGPA 5KLVE 2KUBA 2NRGA 3L74G 3T97B 1VQ7P 1E5WA 1KD1Q 2JAZA 2W27A 3DS1A 2HODB 3KXDA 4BRYB 3HRNA 1P84I 2RKLA 1ACPA 1AFOA 4XROA 4UHPB 2IX7C 3L70G 1W2EA 1VQLP 3TGUD 1NJIQ 5B5EE 3WU2E 4ZNCA 1PPJE 1Z56A 3CWBJ 1UNKA 4R4MA 4JQ0D 3EFGA 4H44B 1ZOYC 5AVRB 1FZBA 2KIKA 3L37A 1NWQA 1JNMA 1X8YA 1N73B 1AUMA 2KS1B 1JMMA 3NY7B 1SQQE 2G8YA 5HGNA 2AXTE 2ZAEB 2M8NA 3P8CE 4BWNA 4DZOA 3W68A 1P84D 2GZIA 4D6TD 1GTWA 2OYIA 2Y0EA 5GTIH 1CEIA 3F89A 2K92A 1YI2P 4RJTA 1SFCC 2XDJA 3CMAP 2XZ0D 2AEJA 4WB4A 4HKGA 5EFWB 2QE7H 5AW2B 2L6EA 3M06A 2PEQA 3Q5RA 1KTMA 1QEXA 2IBZI 2VRSA 1JTHB 3W67A 1NKNA 1RQUA 1QVGO 3G29A 3TGUG 5AVSB 2L5GB 4M3LA 3G28A 3SFEC 3L72D 3E2DA 3VMZA 1OFCX 1SFCD 3DTJA 4K3AA 5BS2A 4KHXA 3G0VA 1NTME 3AE9C 2KR5A 3V6IA 2JYLA 1L0LE 1S4XA 2ROQA 2W6JH 1PEMA 4L73A 5KLVJ 2KSEA 3WUVA 1S72P 1AV1A 2WPRA 2IBZD 3KQGA 2QJKC 2IDBA 1Q86Q 1KILA 4D6TG 1FU1A 1DD4A 4TLFA 3HE5A 1LTTC 1KB9E 2FYUD 1L0NK 1NAYA 1QVFO 5BS1A 1NOHA 1GXGA 3GKLC 4RO0A 2D2CC 4BPHA 1PEUA 2FXMA 1RE3A 3H1JD 4PV1B 2JQ4A 1E6JP 1FC2C 2Z5IA 4ZKPA 1IFJA 3C1LA 2MY5A 4I2LC 2P1JA 2FBWC 2M5AA 2FFDA 2BCCE 3FXDA 1OZHA 3CCUP 5GTHE 2PFXA 2JO0A 1LTAC 4JYCA 2L91A 1SQQJ 3L72G 4DOJA 1KN7A 2FQ2A 2NPSC 1WT6A 2KNCA 3BRTB 3JC22 2D2CD 3B8EB 3M0AA 5E79E 5APYA 1BGYD 1RE4C 4PXHB 2GZEA 2ZT9C 4GT1A 2E5TA 3AE7C 1AQTA 3RK2C 1NHLA 3CCJP 2IBZG 2E5YA 1SQPD 3L74E 2NPSD 4C7NB 2FYUG 2QJPC 1USEA 2DNWA 1EDJA 4I7ZC 3CCMP 1DNYA 2IFNA 3H1JG 2HPCB 1L4AB 2WT7A 2XT1A 2ZT9D 1KQLA 3GJNA 3L70E 3MGEA 5TJHA 3RK2D 5APUA 1SQVD 3IF4A 2JBGA 2R5BA 1H89A 1NTMJ 1PIXA 2R3CA 2E76C 1RY3A 1SQBJ 2OGUA 3IAOA 5C39A 4GOFA 1HQBA 1QX8A 1KFNA 5HV8A 2WZ7A 3MGNA 3B5NC 2GM4A 1NU1J 1PGJA 4DJGA 1CW5A 4OGQB 1J1EB 1NGMB 2K5XA 3QH9A 5AW9B 3DS0A 5DJUB 2KWLA 1IFMA 4RESB 3L73D 2K2QA 1GMJA 1LT9B 2BQ1E 2E76D 3IR9A 1MFTA 1KMIZ 2LMLA 1R8EA 3DS3A 2I1JA 1BSNA 1USDA 1LTSC 1M74A 3HD7B 2LKMA 3B5ND 3G6EP 3CCVP 3V5BA 2BCCJ 2WSEJ 2E1MA 1X79B 1FDOA 4XFJA 5I4TG 2KOQA 3TF5A 3P8MC 3TGUE 3BCCG 2FACA 3LIDA 2KLVA 1SQVG 3P7KA 2KOPA 2EG5A 2AFEA 1LTJA 3LIEA 1UJZA 1VQ5P 4H44C 5KKZB 1HJBA 3A0HE 1M1JB 2C0XA 1WRGA 1W2BO 3H1IJ 4Y99B 1VF5B 1GZLA 3KYQA 3VYIA 1N73C 2B87B 2JU1A 4QNBA 1URQB 3RG6C 1KB9I 1NTKJ 4KT0J 5HGLA 4MN4C 3M91A 4JBZA 3H32B 1GK6A 1BCCD 3L74J 5AW5B 1EDLA 5F2KA 3VP9A 3Q3DA 1P84E 3VTPC 3L73G 4D6TE 1G2CB 1GW3A 1EOQA 1FZAA 1JY2O 4H44D 5H2FE 3H1HD 4YPCA 2CQ8A 5CBNA 3EWKA 3D6ZA 5APQA 2Q1KA 4CA3A 1NQ4A 3U43A 3U1AA 1S5LX 2Q3EA 4CPGA 2E74B 1IFIA 2KGCA 2N9YB 3CX5H 3OW2O 1SQPK 1VQOP 5KAFH 2FHSC 4YXDC 1U57A 2WSCJ 1ZNVA 3L72E 5GTIE 1AVOA 1T3JA 4QKOA 3CC2P 1AA0A 2O01N 3Q5SA 2J59M 1FR2A 2A45I 1CI6A 1YITP 1EC5A 2JJLA 3GHGA 1RF1A 5CCHC 5KAIH 1NO4A 2V7QJ 2H8PD 3M9BA 1E0HA 2K9JB 1BCCG 1GU5A 2IBZE 2ONTA 4C46A 5APVA 3AEBC 3HE4A 1T2KC 4L74A 3B4SA 1E79H 2FXPA 2FYUE 1A43A 1F80D 1BE3D 3H1HG 3FGAD 1FOSE 2FY8A 1SQXK 3TGUJ 1FDIA 3H1JE 4IL6E 2KG9A 1M1KQ 1IO4A 3HZQA 3V2PA 5CCHD 3KHUA 2CG5B 3S9OA 1LGHB 2M3BA 1T8ZA 1SVFA 3USSA 4EIJA 3MTUE 1HBWA 2L22A 5KJ7A 4GDOA 5CBOA 2YKQA 1T2KD 2CK3H 2FYZA 1IK9A 1R5LA 3D6YA 3CLQA 4WY4A 2JU2A 3HTKB 1LTGC 4PV1D 1LWUB 1BGYE 4D6TJ 2BUOA 4XFZA 1HUCA 1M8OB 2YO3A 1WMKA 4H13B 2ZYDA 3GF7A 2GZJA 1FZGA 4PH0A 3FWNA 1GL2B 3H1LD 1VQPP 1IC2A 3AE2C 3RBZA 3PH0A 1N86A 1SQPE 1L0ND 2YMKA 4LC1A 5AVZB 1BE3G 2OQQA 3PJSK 3EJDA 2L4BA 3B71A 1L4AC 4GR6A 1HH0A 4DG9A 3L72J 3BATA 3A3YB 1HGVA 1SQVE 2A45G 2MKVA 3L75D 2WPVB 1ZR4A 1S5LH 1N7SB 4IOIH 1ZN5A 4PD4H 3TDKA 3FWLA 2CNRA 2H7HA 3CC7P 3CI9A 2PY8A 5DJTB 2CPBA 2O1JA 4OGQC 3VN0A 1S3JA 1FJKA 1L0IA 1VL2A 3DS4A 4U0FA 1L4AD 1VHNA 1SQBK 2P67A 1GPJA 4QMAA 3H25A 4XFYA 1VQKP 3HUSB 1H0TA 1KZUB 1MV8A 4AYCA 3CL3D 3L73E 1KLPA 1LT9C 3H1LG 2V4HA 2OTLP 3H1JJ 2N50A 1VQ6P 2Z46A 1M90Q 3H1KD 2JEEA 2Y9YA 1GW4A 1KYOH 1L0NG 3PHLA 1NAFA 3HD7C 3AE5C 2BEZF 3E7KA 4OGQD 2O1KA 4LGDE 1HY8A 2N1TB 3I55P 4U3FD 1RF0A 1EZVI 2O01J 1SLQA 2JKVA 2BEQD 2FVAA 2XZ1C 1ZR2A 1NKZB 1YJWP 2WSFJ 3L75G 2BASA 3AEEC 5KKZC 1K05A 4W7ZA 4PJ0H 1FZCA 2P58A 1Y47A 3HD7D 1VF5C 2R44A 3Q20A 3ITKA 2DW3A 2K0YA 2ZXEB 1NYHA 1DEBA 4YXWH 2PEOA 2PRRA 1URQC 3V2RA 4N78D 1JCCA 1M56D 3KZIH 1BCCE 2M0BA 5F2OA 5CMZA 5AVYB 2K0XA 1H8AA 1KQFB 2JDIH 3CMEP 1EZVD 1NTKK 2YKPA 2E75B 4U0DA 2M8PA 3H1HE 5CCGD 2MJZA 4H0LB 2M3EA 2LKIA 1VF5D 3BCCJ 1SQVJ 1URQD 1U7JA 2Y9ZA 4UB8H 1FS0E 4JYBA 2VLQA 2LXBA 1FE6A 5F2NA 1JY3P 1JEKA 1ZMEC 4U3FG 2E74C 1BSHA 2LIWA 3N7NA 1OW8A 2QG4A 5B66H 3PLNA 3QWOC 1SP4A 3GZLA 1NTZK 1LTBC 3R4YA 1N2DC 1L2PA 1JCDA 2L0QA 1OX3A 5TISE 1R5SA 3AE3C 2YMYA 1HVVA 1FBMA 4OH8B 2Z4EA 3JCUE 2FXOA 2LF4A 1X3OA 1AYIA 2EHSA 1VQMP 2WSFH 2ZJSE 1BAJA 2E74D 2JP3A 3L71D 2R3SA 2OYIB 1S9KD 1EXIA 4XFXA 3V4WA 1Q82Q 3G21A 5KAFE 1ZRTD 2WWWA 1EZVG 1MUUA 1BE3E 5M1BA 3B4QA 2LIUA 2YNYA 1VQNP 2AFDA 1NH4A 3AE8C 3CXHH 2W8ZA 1ZXGA 2KORA 2FADA 2OYHC 3PTZA 2AXCA 2I1KA 4IFMA 4N6JA 1Q81Q 3DPHA 3DS5A 1FJPA 4OVNF 1T6AA 4L75A 1GDTA 4MRTC 1HWTC 3WBHA 4OWFA 5KLIB 5CHXA 1LP1A 1SFCA 4KJMA 1IFNA 3SWKA 3G4SP 2KW2A 2NZ2A 1Z6MA 2OTJP 3RL0B 2WSSH 2KB7P 4HB1A 1LWUC 5APWA 3CCLP 3HYBA 2IZ1A 2PEMA 4H13C 2GDXA 1JY2N 3G71P 1KILB 5B5EH 2H88C 1L0LJ 3L71G 1AJYA 3RK3B 1IFDA 3H1LE 1LTIC 3HE5B 2W6BA 2K88A 1S1CX 1DV5A 4IPYA 2QJYB 1L0NE 1SQXD 2KODA 1BGYG 2O3JA 1LJ2A 2YKOA 4BPFA 3CPWO 1CSBA 2K1AA 3CXCO 1D1DA 2XXMA 2K0DX 2M5AB 2P9XA 2KI7B 4H13D 2FFDB 2C9NY 4IZ6A 1GL2D 2HYNA 1SQPG 2JYGA 5KP8B 3L75E 1OVUA 1GU4A 2KNCB 2P10A 1G1JA 5KP6B 2MD9A 1W5CE 2OTKE 1T3UA 2K93A 2KG8A 3E1IA 3PP5A 4COPA 2N5IA 4NPDA 3HUSC 2W90A 2RMZA 1LNQA 1HF9A 1BE3J 3E1RA 3O6QA 5KP7B 2JO1A 1N7SD 1AQ5A 4JPZB 5KTBA 3VRLC 3H1KE 2NPSA 4COCA 3I5CA 3O8ZA 4F37A 2W83C 3F5HA 1FOSF 3G26A 1PP9D 4W7YA 1SQXG 2K3RA 2WT7B 3I56P 3WUTA 2OYOA 1RE4A 2MR8A 3M0DC 1YJ9P 2HR3A 3VMYA 4PH1A 1OWAA 4U3FE 1ZV8A 2VLPA 1M57D 2GUSA 3H0DA 3A7OA 2GDWA 2OYHA 2K94A 3M1MA 4Z1MH 4ZMDA 1X22A 3L70J 3AECC 2EHTA 2H89C 4Y28J 2Q7CA 1Y8AA 3CX5I 2G3AA 1UIXA 1YIJP 1SQBD 4GOEA 2N1TD 4N78E 2QEXP 2Q9IA 4U0BA 1YHQP 1NU1D 1H88A 2M8LA 7CEIA 3MUDC 5GTHH 2WSEH 2K37A 1EZVE 2KSJA 5AW7B 2E75C 3V4QA 3AE4C 3M9HA 2Y0DA 4N3YB 3TNUA 2N6YA 2Q5UA 4H0LC 4U0CA 4PJ0E 3B5NA 3A5TA 1PP9G 1QRJA 2C9LY 2XV6A 2N9BA 3L75J 1X0TA 2JB0A 2Z45A 3CX5D 2XZRA 1YJNP 2JR8A 4H2WC 3D71A 1K73Q 1LTJB 2ZYGA 3LW5J 1KV4A 5KLVK 2E75D 4BXLA 2FVEA 4PV1C 3T97A 4H0LD 2FAEA 3GZMA 1OMIA 2HODA 4BRYA 4XA4A 2ZXXA 2K9YA 1FZFA 2OARA 1SQBG 1OR5A 3H1ID 4HKZH 2H43A 1QL1A 3L71E 3Q5PA 2OYIC 1KORA 3ABVC 2FVFA 2R32A 1S9KE 1ZW0A 1PZQA 2JWAA 1NTKD 3S4RA 2XU6A 3P32A 1ZRTE 2I8DA 4U7JA 3TK1A 2B88A 3S1KA 3Q2YA 4U3FJ 1N73A 4M0IA 2QJPB 2FQ1A 1DEEG 1SQQK 1LT1A 1GK4A 2KS1A 2WSCH 2QIWA 1DD3A 3U59A 1M6EX 3ZDMA 5HGMA 1NTZD 3CCRP 5KLIC 2V7QH 1MFZA 2MVUA 4IL6X 4K35A 1JOCA 2J58A 5AW1B 4WYMA 2M8RA 1CI6B 2KGDA 1AF8A 3GHGB 1YBKA 2ZYAA 1RF1B 1EXJA 2KK7A 2PP6A 1Q7YQ 4I1LA 4NPFX 3BVHA 1JTHA 2E43A 3L4FA 1IMQA 2YIUB 2WVRA 2HG5D 1RNIA 2QRXA 2CWOA 1KILC 1RO2A 3HE4B 2W6AA 2LOLA 1M6NA 3RBXA 1DIPA 2QJYC 2ITAA 1VPCA 1NTKG 2KG6A 1PGOA 2ZVNB 3A0HH 1J1EC 4HH2A 1NTMK 1RE3C 1JY3O 1SQXE 3MP7B 1J2JB 5EW5E 1L0LK 2L9FA 3RL0D 2LXCB 2POHA 1EMVA 2FYUJ 5CCHA 1JM0A 1IUQA 2RH0A 2B89A 2PEJA 3NTEA 1KYOI 1NU1K 1PL5A 2FFDC 3OJAB 3CCEP 3MIWA 1KILD 1P84H 2M5RA 3RK3D 3V2NA 4PD4D 1BDDA 3RGUA 1NTZG 4WY4B 5H2FH 4HYTB 2PNGA 1JO5A 2ZVOB 2DGYA 5AW0B 3GG2A 3L71J 4U0AA 2N6ZA 2WPTA 2CGQA 1QGKB 4LLHA 3TYYA 1DH3A 2B9BA 4DT0A 5APSA 3P05A 4JF7A 4I6MC 1J1DB 5APTA 1BGYJ 1IZNB 1KFMA 1M1JC 4GR2A 2LR2A 1KYOD 5CCGC 4Y99C 3RL0g 1Q2NA 3GF3A 1MZ8A 3G1GA 3CCQP 1PP9E 3AEAC 2XKMA 1SQPJ 3B5IA 2JWDA 3M9QA 2KZIA 2KZJA 1KQSO 3II6A 4UB6H 2GA1A 1JMBA 3NXSA 4W80A 4C7RA 2N98A 4HJGH 1ZP0C 2PENA 3R2PA 4NPEA 1IK7A 2LL8A 3H1KG 3MZWB 3OAKA 3AEGC 4TT3H 4C7NA 2QSIA 2KP8A 1FDMA 2UWJE 2YXQB 5CJ0A 2VLOA 1K30A 1FAVA 3TSIA 1H0TB 4IL6H 5HGOA 1QL2A 1SQBE 2HPCA 1L4AA 4NEOA 3H47A 1A02J 1TU3F 1RQVA 2AEMA 2X2BA 2P2UA 4O9BA 1NU1E 3VP8A 1SS1A 4EDFA 1SQXJ 4EI2A 1BXIA 4WWIA 2O01H 3L73J 1K04A 3CWBD 2HLOA 3EFFK 4BPGA 2WQYC 4B86A 1PFIA 5AVVB 2VLNA 2XNDH 2IYOA 2KOOA 4EOTA 4XE5B 2KLUA 3AE1C 3D70A 3CX5E 2FYNB 5CZDB 1VDFA 1LTJC 5BU5A 3SWYA 1HGZA 1LT9A 2YO2A 3L35A 2LTEA 3CXHI 3NTNA 1FZCB 5AVTB 2KYVA 1RHZB 3IN6A 4XRQA 3HD7A 4IFDK 3VOPA 3EJEA 1T8KA 3JSVC 1UIIA 5KAIE 1OIPA 1K8AQ 3CC4P 2QA4P 1HTLC 1BDCA 3H1IE 1PEQA 3BRVB 3A0BH 1JUNA 1PP9J 2IPPA 1NTKE 4AQRD 1EDKA 3NFQA 1BCCJ 1IJDB 1M1JA 2CPSA 4DCKA 5JPAA 5HVCA 5CCGA 4A7PA 3CWBG 3CXHD 1VQ8P 2KOSA 2B87A 2A06D 1KQGB 1URQA 3H1HJ 3LMOA 1GL2C 3WU2H 1MKMA 2RN0A 3H32A 3BCCD 5DCKA 1PGQA 1G2CA 5KLVD 4GIFA 1NTZE 1AVYA 5AW4B 2PAJA 2GYKA 1EDIA 1OXZA 1IFPA 2YXRB 3MHVA 3GHGC 5AVUB 2AXTH 1RF1C 3WUUA 3AEDC 3SFDC 3CD6P 1QLED 2QNWA 3NMDA 2SPZA 2YIUC 1N7SC 5K5GB 1PPJD 2WPQA 2WMMA 4L76A 2BHVA 3H4EA 4EYYQ 2IYPA 1N7LA 3GLMA 1HJ0A 2VSQA 1ZMBA 1OW6A 3VMAA 2N5HA 1OW7A 1OVVA 3DS2A 1SQQD 3MD0A 3P8CD 1EQ7A 2A06G 2EFJA 2FQ0A 2GDYA 1M7LA 1XTCC 3CE7A 5AW8B 1EIAA 4R4LA 5KJ7C
chains in the Genus database with same CATH topology
2BQ1E 4IPYA 3H0DA 2L6EA 2PEQA 3OW2O 3G1IA 1VQOP 2PEIA 3M1MA 1KC8Q 3DS3A 1IUQA 5JPAA 1K30A 3I55P 2PEJA 3NTEA 4PH0A 1M74A 5HGOA 2KODA 1VQ8P 1JJ2O 1VQPP 2LF4A 3CCEP 1VQ9P 3H47A 3G6EP 3CPWO 3G29A 3CCVP 1VQMP 3CXCO 1QVGO 1D1DA 1BAJA 3CC2P 2XXMA 3G28A 1YJWP 2E1MA 2P9XA 1YIJP 1YITP 3CCJP 5I4TG 1VQ7P 4XFXA 3E2DA 1KD1Q 4M0IA 1Q82Q 3G21A 3DTJA 2QEXP 3DS1A 5DCKA 5BS2A 2DGYA 1PEOA 2JYGA 3Q20A 3G0VA 4U0BA 1YHQP 2EG5A 4GR6A 4U0AA 2PEOA 4XROA 2M8LA 2JYLA 1VQ5P 1M6EX 2ONTA 1VQLP 3P05A 1NJIQ 1VQNP 1W2BO 3CCMP 5HGMA 1RO0A 3CCSP 3CCRP 1PEMA 2XT1A 1A43A 5F2OA 4QNBA 4U0CA 1S72P 4COPA 3MGEA 3CD6P 3RG6C 4GR2A 1Q81Q 4U0EA 1Q86Q 1QRJA 5HGLA 3CMEP 2XV6A 4WYMA 3DPHA 3DS5A 3CC7P 1M1KQ 4U0DA 2PY8A 3HZQA 5F2KA 3WBHA 2M8PA 1AUMA 2BHVA 3H4EA 2Z45A 1QVFO 1Q7YQ 5BS1A 3G1GA 3DS4A 4U0FA 3CCQP 1K9MQ 4XRQA 1EOQA 1YJNP 2PEKA 4XFYA 1VQKP 1PEUA 5HGNA 3G4SP 3B5IA 1K73Q 2M8NA 1E6JP 1ZMBA 3VRLC 2EIAA 1A8OA 1VQ4P 1RNIA 4COCA 1KQSO 2CWOA 5F2NA 1K8AQ 2OTJP 3G26A 1RO2A 2Z44A 3CC4P 3DS2A 1M6NA 2QA4P 3I56P 3CCLP 1N8RQ 2OTLP 3DS0A 2PENA 3HYBA 2PEMA 1VQ6P 2Z46A 1M90Q 2EFJA 1YJ9P 3CCUP 1YI2P 3CMAP 3G71P 1PEQA 4PH1A 2JO0A 1EIAA 3LRYA 2BUOA 2OARA 4XFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR P;  1KD1 Q;  1S72 P;  1VQ4 P;  3OW2 O;  3CD6 P;  1Q82 Q;  1KQS O;  1VQO P;  2OTJ P;  1K8A Q;  1K73 Q;  2QEX P;  1KC8 Q;  1Q81 Q;  1VQ7 P;  1Q86 Q;  3I55 P;  3CC4 P;  3CME P;  1YHQ P;  2QA4 P;  3CC7 P;  3I56 P;  1M1K Q;  1JJ2 O;  1VQ8 P;  1N8R Q;  1VQP P;  3CCJ P;  3CCL P;  3CCE P;  2OTL P;  1VQ9 P;  1VQ6 P;  1VQ5 P;  1M90 Q;  3G6E P;  1QVG O;  3CPW O;  3CCV P;  1VQM P;  3CCU P;  3CXC O;  1YI2 P;  1YJ9 P;  1Q7Y Q;  1VQL P;  1NJI Q;  1QVF O;  1VQN P;  3CC2 P;  3CMA P;  3G71 P;  3CCQ P;  1W2B O;  1K9M Q;  3CCM P;  1YJN P;  1YJW P;  1VQK P;  3G4S P;  1YIJ P;  1YIT P;  3CCS P; 
#chains in the Genus database with same CATH topology
 2K9J A;  4ZKU A;  1S5L E;  1X9V A;  1KIL E;  3KPE A;  3RK3 E;  2GZF A;  4PD4 E;  1JB0 J;  1LP1 B;  1SFC B;  2FYU K;  5KLV G;  4WY4 C;  1JJ2 O;  3VMX A;  2KGA A;  3FX0 A;  4IFF A;  2N1T C;  2ERH A;  4YTP C;  1YTZ I;  1U7M A;  3PRJ A;  2QM7 A;  3EQ2 A;  2AEF A;  1XTG B;  4ASW A;  3SWF A;  5KJ7 D;  1J1D C;  3KDP B;  2QVA A;  1PPJ G;  2FKW B;  1KB9 H;  2Q3I A;  2Y0C A;  3AEF C;  4WBA A;  1KYO E;  5CJ4 A;  3EJB A;  4WY4 D;  1NTM D;  1RO0 A;  2MR7 A;  5TIS H;  2KXP B;  2E42 A;  2ZFC A;  3H1L J;  1L0L D;  4R0M A;  3HTK A;  1G1I A;  4WVZ A;  3FXE A;  4U0E A;  3K5B A;  2MF4 A;  1LWU A;  4ASV A;  3JCU H;  1D7M A;  1SQQ G;  1L0N J;  2KOG A;  1GXH A;  1NTZ J;  2Z5H A;  2XV5 A;  1K9M Q;  2QJK B;  3G9R A;  2PEK A;  3Q1M A;  1GL2 A;  1PV3 A;  4H2Y C;  1L0H A;  3GW6 A;  3U1C A;  3C8V A;  1KB9 D;  1A8O A;  1YQ4 C;  1Q90 D;  5E79 H;  2D2C B;  1ZLL A;  3RG2 A;  5BVZ A;  3L36 A;  5AVX B;  2XNX A;  3IFM A;  3KZI E;  2HFE D;  4UB6 E;  3O6Q B;  1SQV K;  2PEI A;  2BCC D;  1VKU A;  1KC8 Q;  1IMP A;  2A45 H;  1S2E A;  5AVW B;  2AVA A;  4AUW A;  1N7S A;  1VQ9 P;  2NPS B;  1A02 F;  3N4X A;  1JY3 N;  1Y9B A;  5L8R J;  1FZE A;  3CWB E;  1NTM G;  4PWV B;  1NVO A;  2MVV A;  3AE6 C;  4UB8 E;  1CZQ A;  1L0L G;  2R5D A;  2ZT9 B;  3H1K J;  1RF0 C;  1PEO A;  2QM8 A;  3A2A A;  3HUS A;  3RK2 B;  1OVR A;  2WPS A;  1NU1 G;  2WIT A;  5B66 E;  2AF8 A;  2OYH B;  3BAS A;  2FYN C;  2IFM A;  1YTZ T;  3UIA A;  3L74 D;  4GKG A;  1DX7 A;  3CCS P;  2Q6Q A;  3C9I A;  1FZC C;  2KGE A;  3SSU A;  1JY2 P;  2GZG A;  1RH5 B;  4I7Z B;  1MZ9 A;  3GMA A;  3OA7 A;  3L70 D;  3M0D A;  2N1T A;  5BU8 B;  2EIA A;  1VQ4 P;  2BCC G;  2E76 B;  5AVQ B;  2WTY A;  2Z44 A;  1GD2 E;  1YQ3 C;  4RKU J;  4H2X C;  1N8R Q;  5EJD A;  2IZ0 A;  3G3Z A;  3TNU B;  2J5U A;  2C0W A;  3H6P A;  2NO8 A;  2GUV A;  3B5N B;  3RL0 C;  2P7J A;  5AW6 B;  3V2Q A;  5APX A;  4GOD A;  2JGP A;  3LRY A;  3CXH E;  4PD4 I;  2PGD A;  3LW5 H;  1YYC A;  2A06 E;  3G1I A;  3H1I G;  3WMM 0;  3RK3 C;  2LPK A;  3BCC E;  5AW3 B;  3MUD A;  3A0B E;  1PGP A;  5KLV E;  2KUB A;  2NRG A;  3L74 G;  3T97 B;  1VQ7 P;  1E5W A;  1KD1 Q;  2JAZ A;  2W27 A;  3DS1 A;  2HOD B;  3KXD A;  4BRY B;  3HRN A;  1P84 I;  2RKL A;  1ACP A;  1AFO A;  4XRO A;  4UHP B;  2IX7 C;  3L70 G;  1W2E A;  1VQL P;  3TGU D;  1NJI Q;  5B5E E;  3WU2 E;  4ZNC A;  1PPJ E;  1Z56 A;  3CWB J;  1UNK A;  4R4M A;  4JQ0 D;  3EFG A;  4H44 B;  1ZOY C;  5AVR B;  1FZB A;  2KIK A;  3L37 A;  1NWQ A;  1JNM A;  1X8Y A;  1N73 B;  1AUM A;  2KS1 B;  1JMM A;  3NY7 B;  1SQQ E;  2G8Y A;  5HGN A;  2AXT E;  2ZAE B;  2M8N A;  3P8C E;  4BWN A;  4DZO A;  3W68 A;  1P84 D;  2GZI A;  4D6T D;  1GTW A;  2OYI A;  2Y0E A;  5GTI H;  1CEI A;  3F89 A;  2K92 A;  1YI2 P;  4RJT A;  1SFC C;  2XDJ A;  3CMA P;  2XZ0 D;  2AEJ A;  4WB4 A;  4HKG A;  5EFW B;  2QE7 H;  5AW2 B;  2L6E A;  3M06 A;  2PEQ A;  3Q5R A;  1KTM A;  1QEX A;  2IBZ I;  2VRS A;  1JTH B;  3W67 A;  1NKN A;  1RQU A;  1QVG O;  3G29 A;  3TGU G;  5AVS B;  2L5G B;  4M3L A;  3G28 A;  3SFE C;  3L72 D;  3E2D A;  3VMZ A;  1OFC X;  1SFC D;  3DTJ A;  4K3A A;  5BS2 A;  4KHX A;  3G0V A;  1NTM E;  3AE9 C;  2KR5 A;  3V6I A;  2JYL A;  1L0L E;  1S4X A;  2ROQ A;  2W6J H;  1PEM A;  4L73 A;  5KLV J;  2KSE A;  3WUV A;  1S72 P;  1AV1 A;  2WPR A;  2IBZ D;  3KQG A;  2QJK C;  2IDB A;  1Q86 Q;  1KIL A;  4D6T G;  1FU1 A;  1DD4 A;  4TLF A;  3HE5 A;  1LTT C;  1KB9 E;  2FYU D;  1L0N K;  1NAY A;  1QVF O;  5BS1 A;  1NOH A;  1GXG A;  3GKL C;  4RO0 A;  2D2C C;  4BPH A;  1PEU A;  2FXM A;  1RE3 A;  3H1J D;  4PV1 B;  2JQ4 A;  1E6J P;  1FC2 C;  2Z5I A;  4ZKP A;  1IFJ A;  3C1L A;  2MY5 A;  4I2L C;  2P1J A;  2FBW C;  2M5A A;  2FFD A;  2BCC E;  3FXD A;  1OZH A;  3CCU P;  5GTH E;  2PFX A;  2JO0 A;  1LTA C;  4JYC A;  2L91 A;  1SQQ J;  3L72 G;  4DOJ A;  1KN7 A;  2FQ2 A;  2NPS C;  1WT6 A;  2KNC A;  3BRT B;  3JC2 2;  2D2C D;  3B8E B;  3M0A A;  5E79 E;  5APY A;  1BGY D;  1RE4 C;  4PXH B;  2GZE A;  2ZT9 C;  4GT1 A;  2E5T A;  3AE7 C;  1AQT A;  3RK2 C;  1NHL A;  3CCJ P;  2IBZ G;  2E5Y A;  1SQP D;  3L74 E;  2NPS D;  4C7N B;  2FYU G;  2QJP C;  1USE A;  2DNW A;  1EDJ A;  4I7Z C;  3CCM P;  1DNY A;  2IFN A;  3H1J G;  2HPC B;  1L4A B;  2WT7 A;  2XT1 A;  2ZT9 D;  1KQL A;  3GJN A;  3L70 E;  3MGE A;  5TJH A;  3RK2 D;  5APU A;  1SQV D;  3IF4 A;  2JBG A;  2R5B A;  1H89 A;  1NTM J;  1PIX A;  2R3C A;  2E76 C;  1RY3 A;  1SQB J;  2OGU A;  3IAO A;  5C39 A;  4GOF A;  1HQB A;  1QX8 A;  1KFN A;  5HV8 A;  2WZ7 A;  3MGN A;  3B5N C;  2GM4 A;  1NU1 J;  1PGJ A;  4DJG A;  1CW5 A;  4OGQ B;  1J1E B;  1NGM B;  2K5X A;  3QH9 A;  5AW9 B;  3DS0 A;  5DJU B;  2KWL A;  1IFM A;  4RES B;  3L73 D;  2K2Q A;  1GMJ A;  1LT9 B;  2BQ1 E;  2E76 D;  3IR9 A;  1MFT A;  1KMI Z;  2LML A;  1R8E A;  3DS3 A;  2I1J A;  1BSN A;  1USD A;  1LTS C;  1M74 A;  3HD7 B;  2LKM A;  3B5N D;  3G6E P;  3CCV P;  3V5B A;  2BCC J;  2WSE J;  2E1M A;  1X79 B;  1FDO A;  4XFJ A;  5I4T G;  2KOQ A;  3TF5 A;  3P8M C;  3TGU E;  3BCC G;  2FAC A;  3LID A;  2KLV A;  1SQV G;  3P7K A;  2KOP A;  2EG5 A;  2AFE A;  1LTJ A;  3LIE A;  1UJZ A;  1VQ5 P;  4H44 C;  5KKZ B;  1HJB A;  3A0H E;  1M1J B;  2C0X A;  1WRG A;  1W2B O;  3H1I J;  4Y99 B;  1VF5 B;  1GZL A;  3KYQ A;  3VYI A;  1N73 C;  2B87 B;  2JU1 A;  4QNB A;  1URQ B;  3RG6 C;  1KB9 I;  1NTK J;  4KT0 J;  5HGL A;  4MN4 C;  3M91 A;  4JBZ A;  3H32 B;  1GK6 A;  1BCC D;  3L74 J;  5AW5 B;  1EDL A;  5F2K A;  3VP9 A;  3Q3D A;  1P84 E;  3VTP C;  3L73 G;  4D6T E;  1G2C B;  1GW3 A;  1EOQ A;  1FZA A;  1JY2 O;  4H44 D;  5H2F E;  3H1H D;  4YPC A;  2CQ8 A;  5CBN A;  3EWK A;  3D6Z A;  5APQ A;  2Q1K A;  4CA3 A;  1NQ4 A;  3U43 A;  3U1A A;  1S5L X;  2Q3E A;  4CPG A;  2E74 B;  1IFI A;  2KGC A;  2N9Y B;  3CX5 H;  3OW2 O;  1SQP K;  1VQO P;  5KAF H;  2FHS C;  4YXD C;  1U57 A;  2WSC J;  1ZNV A;  3L72 E;  5GTI E;  1AVO A;  1T3J A;  4QKO A;  3CC2 P;  1AA0 A;  2O01 N;  3Q5S A;  2J59 M;  1FR2 A;  2A45 I;  1CI6 A;  1YIT P;  1EC5 A;  2JJL A;  3GHG A;  1RF1 A;  5CCH C;  5KAI H;  1NO4 A;  2V7Q J;  2H8P D;  3M9B A;  1E0H A;  2K9J B;  1BCC G;  1GU5 A;  2IBZ E;  2ONT A;  4C46 A;  5APV A;  3AEB C;  3HE4 A;  1T2K C;  4L74 A;  3B4S A;  1E79 H;  2FXP A;  2FYU E;  1A43 A;  1F80 D;  1BE3 D;  3H1H G;  3FGA D;  1FOS E;  2FY8 A;  1SQX K;  3TGU J;  1FDI A;  3H1J E;  4IL6 E;  2KG9 A;  1M1K Q;  1IO4 A;  3HZQ A;  3V2P A;  5CCH D;  3KHU A;  2CG5 B;  3S9O A;  1LGH B;  2M3B A;  1T8Z A;  1SVF A;  3USS A;  4EIJ A;  3MTU E;  1HBW A;  2L22 A;  5KJ7 A;  4GDO A;  5CBO A;  2YKQ A;  1T2K D;  2CK3 H;  2FYZ A;  1IK9 A;  1R5L A;  3D6Y A;  3CLQ A;  4WY4 A;  2JU2 A;  3HTK B;  1LTG C;  4PV1 D;  1LWU B;  1BGY E;  4D6T J;  2BUO A;  4XFZ A;  1HUC A;  1M8O B;  2YO3 A;  1WMK A;  4H13 B;  2ZYD A;  3GF7 A;  2GZJ A;  1FZG A;  4PH0 A;  3FWN A;  1GL2 B;  3H1L D;  1VQP P;  1IC2 A;  3AE2 C;  3RBZ A;  3PH0 A;  1N86 A;  1SQP E;  1L0N D;  2YMK A;  4LC1 A;  5AVZ B;  1BE3 G;  2OQQ A;  3PJS K;  3EJD A;  2L4B A;  3B71 A;  1L4A C;  4GR6 A;  1HH0 A;  4DG9 A;  3L72 J;  3BAT A;  3A3Y B;  1HGV A;  1SQV E;  2A45 G;  2MKV A;  3L75 D;  2WPV B;  1ZR4 A;  1S5L H;  1N7S B;  4IOI H;  1ZN5 A;  4PD4 H;  3TDK A;  3FWL A;  2CNR A;  2H7H A;  3CC7 P;  3CI9 A;  2PY8 A;  5DJT B;  2CPB A;  2O1J A;  4OGQ C;  3VN0 A;  1S3J A;  1FJK A;  1L0I A;  1VL2 A;  3DS4 A;  4U0F A;  1L4A D;  1VHN A;  1SQB K;  2P67 A;  1GPJ A;  4QMA A;  3H25 A;  4XFY A;  1VQK P;  3HUS B;  1H0T A;  1KZU B;  1MV8 A;  4AYC A;  3CL3 D;  3L73 E;  1KLP A;  1LT9 C;  3H1L G;  2V4H A;  2OTL P;  3H1J J;  2N50 A;  1VQ6 P;  2Z46 A;  1M90 Q;  3H1K D;  2JEE A;  2Y9Y A;  1GW4 A;  1KYO H;  1L0N G;  3PHL A;  1NAF A;  3HD7 C;  3AE5 C;  2BEZ F;  3E7K A;  4OGQ D;  2O1K A;  4LGD E;  1HY8 A;  2N1T B;  3I55 P;  4U3F D;  1RF0 A;  1EZV I;  2O01 J;  1SLQ A;  2JKV A;  2BEQ D;  2FVA A;  2XZ1 C;  1ZR2 A;  1NKZ B;  1YJW P;  2WSF J;  3L75 G;  2BAS A;  3AEE C;  5KKZ C;  1K05 A;  4W7Z A;  4PJ0 H;  1FZC A;  2P58 A;  1Y47 A;  3HD7 D;  1VF5 C;  2R44 A;  3Q20 A;  3ITK A;  2DW3 A;  2K0Y A;  2ZXE B;  1NYH A;  1DEB A;  4YXW H;  2PEO A;  2PRR A;  1URQ C;  3V2R A;  4N78 D;  1JCC A;  1M56 D;  3KZI H;  1BCC E;  2M0B A;  5F2O A;  5CMZ A;  5AVY B;  2K0X A;  1H8A A;  1KQF B;  2JDI H;  3CME P;  1EZV D;  1NTK K;  2YKP A;  2E75 B;  4U0D A;  2M8P A;  3H1H E;  5CCG D;  2MJZ A;  4H0L B;  2M3E A;  2LKI A;  1VF5 D;  3BCC J;  1SQV J;  1URQ D;  1U7J A;  2Y9Z A;  4UB8 H;  1FS0 E;  4JYB A;  2VLQ A;  2LXB A;  1FE6 A;  5F2N A;  1JY3 P;  1JEK A;  1ZME C;  4U3F G;  2E74 C;  1BSH A;  2LIW A;  3N7N A;  1OW8 A;  2QG4 A;  5B66 H;  3PLN A;  3QWO C;  1SP4 A;  3GZL A;  1NTZ K;  1LTB C;  3R4Y A;  1N2D C;  1L2P A;  1JCD A;  2L0Q A;  1OX3 A;  5TIS E;  1R5S A;  3AE3 C;  2YMY A;  1HVV A;  1FBM A;  4OH8 B;  2Z4E A;  3JCU E;  2FXO A;  2LF4 A;  1X3O A;  1AYI A;  2EHS A;  1VQM P;  2WSF H;  2ZJS E;  1BAJ A;  2E74 D;  2JP3 A;  3L71 D;  2R3S A;  2OYI B;  1S9K D;  1EXI A;  4XFX A;  3V4W A;  1Q82 Q;  3G21 A;  5KAF E;  1ZRT D;  2WWW A;  1EZV G;  1MUU A;  1BE3 E;  5M1B A;  3B4Q A;  2LIU A;  2YNY A;  1VQN P;  2AFD A;  1NH4 A;  3AE8 C;  3CXH H;  2W8Z A;  1ZXG A;  2KOR A;  2FAD A;  2OYH C;  3PTZ A;  2AXC A;  2I1K A;  4IFM A;  4N6J A;  1Q81 Q;  3DPH A;  3DS5 A;  1FJP A;  4OVN F;  1T6A A;  4L75 A;  1GDT A;  4MRT C;  1HWT C;  3WBH A;  4OWF A;  5KLI B;  5CHX A;  1LP1 A;  1SFC A;  4KJM A;  1IFN A;  3SWK A;  3G4S P;  2KW2 A;  2NZ2 A;  1Z6M A;  2OTJ P;  3RL0 B;  2WSS H;  2KB7 P;  4HB1 A;  1LWU C;  5APW A;  3CCL P;  3HYB A;  2IZ1 A;  2PEM A;  4H13 C;  2GDX A;  1JY2 N;  3G71 P;  1KIL B;  5B5E H;  2H88 C;  1L0L J;  3L71 G;  1AJY A;  3RK3 B;  1IFD A;  3H1L E;  1LTI C;  3HE5 B;  2W6B A;  2K88 A;  1S1C X;  1DV5 A;  4IPY A;  2QJY B;  1L0N E;  1SQX D;  2KOD A;  1BGY G;  2O3J A;  1LJ2 A;  2YKO A;  4BPF A;  3CPW O;  1CSB A;  2K1A A;  3CXC O;  1D1D A;  2XXM A;  2K0D X;  2M5A B;  2P9X A;  2KI7 B;  4H13 D;  2FFD B;  2C9N Y;  4IZ6 A;  1GL2 D;  2HYN A;  1SQP G;  2JYG A;  5KP8 B;  3L75 E;  1OVU A;  1GU4 A;  2KNC B;  2P10 A;  1G1J A;  5KP6 B;  2MD9 A;  1W5C E;  2OTK E;  1T3U A;  2K93 A;  2KG8 A;  3E1I A;  3PP5 A;  4COP A;  2N5I A;  4NPD A;  3HUS C;  2W90 A;  2RMZ A;  1LNQ A;  1HF9 A;  1BE3 J;  3E1R A;  3O6Q A;  5KP7 B;  2JO1 A;  1N7S D;  1AQ5 A;  4JPZ B;  5KTB A;  3VRL C;  3H1K E;  2NPS A;  4COC A;  3I5C A;  3O8Z A;  4F37 A;  2W83 C;  3F5H A;  1FOS F;  3G26 A;  1PP9 D;  4W7Y A;  1SQX G;  2K3R A;  2WT7 B;  3I56 P;  3WUT A;  2OYO A;  1RE4 A;  2MR8 A;  3M0D C;  1YJ9 P;  2HR3 A;  3VMY A;  4PH1 A;  1OWA A;  4U3F E;  1ZV8 A;  2VLP A;  1M57 D;  2GUS A;  3H0D A;  3A7O A;  2GDW A;  2OYH A;  2K94 A;  3M1M A;  4Z1M H;  4ZMD A;  1X22 A;  3L70 J;  3AEC C;  2EHT A;  2H89 C;  4Y28 J;  2Q7C A;  1Y8A A;  3CX5 I;  2G3A A;  1UIX A;  1YIJ P;  1SQB D;  4GOE A;  2N1T D;  4N78 E;  2QEX P;  2Q9I A;  4U0B A;  1YHQ P;  1NU1 D;  1H88 A;  2M8L A;  7CEI A;  3MUD C;  5GTH H;  2WSE H;  2K37 A;  1EZV E;  2KSJ A;  5AW7 B;  2E75 C;  3V4Q A;  3AE4 C;  3M9H A;  2Y0D A;  4N3Y B;  3TNU A;  2N6Y A;  2Q5U A;  4H0L C;  4U0C A;  4PJ0 E;  3B5N A;  3A5T A;  1PP9 G;  1QRJ A;  2C9L Y;  2XV6 A;  2N9B A;  3L75 J;  1X0T A;  2JB0 A;  2Z45 A;  3CX5 D;  2XZR A;  1YJN P;  2JR8 A;  4H2W C;  3D71 A;  1K73 Q;  1LTJ B;  2ZYG A;  3LW5 J;  1KV4 A;  5KLV K;  2E75 D;  4BXL A;  2FVE A;  4PV1 C;  3T97 A;  4H0L D;  2FAE A;  3GZM A;  1OMI A;  2HOD A;  4BRY A;  4XA4 A;  2ZXX A;  2K9Y A;  1FZF A;  2OAR A;  1SQB G;  1OR5 A;  3H1I D;  4HKZ H;  2H43 A;  1QL1 A;  3L71 E;  3Q5P A;  2OYI C;  1KOR A;  3ABV C;  2FVF A;  2R32 A;  1S9K E;  1ZW0 A;  1PZQ A;  2JWA A;  1NTK D;  3S4R A;  2XU6 A;  3P32 A;  1ZRT E;  2I8D A;  4U7J A;  3TK1 A;  2B88 A;  3S1K A;  3Q2Y A;  4U3F J;  1N73 A;  4M0I A;  2QJP B;  2FQ1 A;  1DEE G;  1SQQ K;  1LT1 A;  1GK4 A;  2KS1 A;  2WSC H;  2QIW A;  1DD3 A;  3U59 A;  1M6E X;  3ZDM A;  5HGM A;  1NTZ D;  3CCR P;  5KLI C;  2V7Q H;  1MFZ A;  2MVU A;  4IL6 X;  4K35 A;  1JOC A;  2J58 A;  5AW1 B;  4WYM A;  2M8R A;  1CI6 B;  2KGD A;  1AF8 A;  3GHG B;  1YBK A;  2ZYA A;  1RF1 B;  1EXJ A;  2KK7 A;  2PP6 A;  1Q7Y Q;  4I1L A;  4NPF X;  3BVH A;  1JTH A;  2E43 A;  3L4F A;  1IMQ A;  2YIU B;  2WVR A;  2HG5 D;  1RNI A;  2QRX A;  2CWO A;  1KIL C;  1RO2 A;  3HE4 B;  2W6A A;  2LOL A;  1M6N A;  3RBX A;  1DIP A;  2QJY C;  2ITA A;  1VPC A;  1NTK G;  2KG6 A;  1PGO A;  2ZVN B;  3A0H H;  1J1E C;  4HH2 A;  1NTM K;  1RE3 C;  1JY3 O;  1SQX E;  3MP7 B;  1J2J B;  5EW5 E;  1L0L K;  2L9F A;  3RL0 D;  2LXC B;  2POH A;  1EMV A;  2FYU J;  5CCH A;  1JM0 A;  1IUQ A;  2RH0 A;  2B89 A;  2PEJ A;  3NTE A;  1KYO I;  1NU1 K;  1PL5 A;  2FFD C;  3OJA B;  3CCE P;  3MIW A;  1KIL D;  1P84 H;  2M5R A;  3RK3 D;  3V2N A;  4PD4 D;  1BDD A;  3RGU A;  1NTZ G;  4WY4 B;  5H2F H;  4HYT B;  2PNG A;  1JO5 A;  2ZVO B;  2DGY A;  5AW0 B;  3GG2 A;  3L71 J;  4U0A A;  2N6Z A;  2WPT A;  2CGQ A;  1QGK B;  4LLH A;  3TYY A;  1DH3 A;  2B9B A;  4DT0 A;  5APS A;  3P05 A;  4JF7 A;  4I6M C;  1J1D B;  5APT A;  1BGY J;  1IZN B;  1KFM A;  1M1J C;  4GR2 A;  2LR2 A;  1KYO D;  5CCG C;  4Y99 C;  3RL0 g;  1Q2N A;  3GF3 A;  1MZ8 A;  3G1G A;  3CCQ P;  1PP9 E;  3AEA C;  2XKM A;  1SQP J;  3B5I A;  2JWD A;  3M9Q A;  2KZI A;  2KZJ A;  1KQS O;  3II6 A;  4UB6 H;  2GA1 A;  1JMB A;  3NXS A;  4W80 A;  4C7R A;  2N98 A;  4HJG H;  1ZP0 C;  2PEN A;  3R2P A;  4NPE A;  1IK7 A;  2LL8 A;  3H1K G;  3MZW B;  3OAK A;  3AEG C;  4TT3 H;  4C7N A;  2QSI A;  2KP8 A;  1FDM A;  2UWJ E;  2YXQ B;  5CJ0 A;  2VLO A;  1K30 A;  1FAV A;  3TSI A;  1H0T B;  4IL6 H;  5HGO A;  1QL2 A;  1SQB E;  2HPC A;  1L4A A;  4NEO A;  3H47 A;  1A02 J;  1TU3 F;  1RQV A;  2AEM A;  2X2B A;  2P2U A;  4O9B A;  1NU1 E;  3VP8 A;  1SS1 A;  4EDF A;  1SQX J;  4EI2 A;  1BXI A;  4WWI A;  2O01 H;  3L73 J;  1K04 A;  3CWB D;  2HLO A;  3EFF K;  4BPG A;  2WQY C;  4B86 A;  1PFI A;  5AVV B;  2VLN A;  2XND H;  2IYO A;  2KOO A;  4EOT A;  4XE5 B;  2KLU A;  3AE1 C;  3D70 A;  3CX5 E;  2FYN B;  5CZD B;  1VDF A;  1LTJ C;  5BU5 A;  3SWY A;  1HGZ A;  1LT9 A;  2YO2 A;  3L35 A;  2LTE A;  3CXH I;  3NTN A;  1FZC B;  5AVT B;  2KYV A;  1RHZ B;  3IN6 A;  4XRQ A;  3HD7 A;  4IFD K;  3VOP A;  3EJE A;  1T8K A;  3JSV C;  1UII A;  5KAI E;  1OIP A;  1K8A Q;  3CC4 P;  2QA4 P;  1HTL C;  1BDC A;  3H1I E;  1PEQ A;  3BRV B;  3A0B H;  1JUN A;  1PP9 J;  2IPP A;  1NTK E;  4AQR D;  1EDK A;  3NFQ A;  1BCC J;  1IJD B;  1M1J A;  2CPS A;  4DCK A;  5JPA A;  5HVC A;  5CCG A;  4A7P A;  3CWB G;  3CXH D;  1VQ8 P;  2KOS A;  2B87 A;  2A06 D;  1KQG B;  1URQ A;  3H1H J;  3LMO A;  1GL2 C;  3WU2 H;  1MKM A;  2RN0 A;  3H32 A;  3BCC D;  5DCK A;  1PGQ A;  1G2C A;  5KLV D;  4GIF A;  1NTZ E;  1AVY A;  5AW4 B;  2PAJ A;  2GYK A;  1EDI A;  1OXZ A;  1IFP A;  2YXR B;  3MHV A;  3GHG C;  5AVU B;  2AXT H;  1RF1 C;  3WUU A;  3AED C;  3SFD C;  3CD6 P;  1QLE D;  2QNW A;  3NMD A;  2SPZ A;  2YIU C;  1N7S C;  5K5G B;  1PPJ D;  2WPQ A;  2WMM A;  4L76 A;  2BHV A;  3H4E A;  4EYY Q;  2IYP A;  1N7L A;  3GLM A;  1HJ0 A;  2VSQ A;  1ZMB A;  1OW6 A;  3VMA A;  2N5H A;  1OW7 A;  1OVV A;  3DS2 A;  1SQQ D;  3MD0 A;  3P8C D;  1EQ7 A;  2A06 G;  2EFJ A;  2FQ0 A;  2GDY A;  1M7L A;  1XTC C;  3CE7 A;  5AW8 B;  1EIA A;  4R4L A;  5KJ7 C; 
#chains in the Genus database with same CATH homology
 2BQ1 E;  4IPY A;  3H0D A;  2L6E A;  2PEQ A;  3OW2 O;  3G1I A;  1VQO P;  2PEI A;  3M1M A;  1KC8 Q;  3DS3 A;  1IUQ A;  5JPA A;  1K30 A;  3I55 P;  2PEJ A;  3NTE A;  4PH0 A;  1M74 A;  5HGO A;  2KOD A;  1VQ8 P;  1JJ2 O;  1VQP P;  2LF4 A;  3CCE P;  1VQ9 P;  3H47 A;  3G6E P;  3CPW O;  3G29 A;  3CCV P;  1VQM P;  3CXC O;  1QVG O;  1D1D A;  1BAJ A;  3CC2 P;  2XXM A;  3G28 A;  1YJW P;  2E1M A;  2P9X A;  1YIJ P;  1YIT P;  3CCJ P;  5I4T G;  1VQ7 P;  4XFX A;  3E2D A;  1KD1 Q;  4M0I A;  1Q82 Q;  3G21 A;  3DTJ A;  2QEX P;  3DS1 A;  5DCK A;  5BS2 A;  2DGY A;  1PEO A;  2JYG A;  3Q20 A;  3G0V A;  4U0B A;  1YHQ P;  2EG5 A;  4GR6 A;  4U0A A;  2PEO A;  4XRO A;  2M8L A;  2JYL A;  1VQ5 P;  1M6E X;  2ONT A;  1VQL P;  3P05 A;  1NJI Q;  1VQN P;  1W2B O;  3CCM P;  5HGM A;  1RO0 A;  3CCS P;  3CCR P;  1PEM A;  2XT1 A;  1A43 A;  5F2O A;  4QNB A;  4U0C A;  1S72 P;  4COP A;  3MGE A;  3CD6 P;  3RG6 C;  4GR2 A;  1Q81 Q;  4U0E A;  1Q86 Q;  1QRJ A;  5HGL A;  3CME P;  2XV6 A;  4WYM A;  3DPH A;  3DS5 A;  3CC7 P;  1M1K Q;  4U0D A;  2PY8 A;  3HZQ A;  5F2K A;  3WBH A;  2M8P A;  1AUM A;  2BHV A;  3H4E A;  2Z45 A;  1QVF O;  1Q7Y Q;  5BS1 A;  3G1G A;  3DS4 A;  4U0F A;  3CCQ P;  1K9M Q;  4XRQ A;  1EOQ A;  1YJN P;  2PEK A;  4XFY A;  1VQK P;  1PEU A;  5HGN A;  3G4S P;  3B5I A;  1K73 Q;  2M8N A;  1E6J P;  1ZMB A;  3VRL C;  2EIA A;  1A8O A;  1VQ4 P;  1RNI A;  4COC A;  1KQS O;  2CWO A;  5F2N A;  1K8A Q;  2OTJ P;  3G26 A;  1RO2 A;  2Z44 A;  3CC4 P;  3DS2 A;  1M6N A;  2QA4 P;  3I56 P;  3CCL P;  1N8R Q;  2OTL P;  3DS0 A;  2PEN A;  3HYB A;  2PEM A;  1VQ6 P;  2Z46 A;  1M90 Q;  2EFJ A;  1YJ9 P;  3CCU P;  1YI2 P;  3CMA P;  3G71 P;  1PEQ A;  4PH1 A;  2JO0 A;  1EIA A;  3LRY A;  2BUO A;  2OAR A;  4XFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...