2QA4P

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2qa4P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 2qa4P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 2qa4P02
1JJ2O 1N8RQ 3CMEP 1VQNP 1K9MQ 1M1KQ 3CMAP 3I55P 3CCEP 1Q7YQ 1YITP 3CCMP 2OTJP 1W2BO 3CCQP 2QA4P 3G6EP 1K73Q 1VQLP 1YJWP 1YHQP 3I56P 1KQSO 1S72P 3G4SP 3OW2O 1QVFO 3CCVP 1KD1Q 1Q86Q 1YJ9P 1YJNP 3G71P 1YIJP 1VQMP 1QVGO 3CC4P 3CC7P 3CCUP 3CC2P 1KC8Q 1M90Q 1VQ9P 1VQKP 1VQOP 1YI2P 1VQ5P 1Q81Q 3CCJP 1VQ4P 3CCLP 1NJIQ 3CD6P 1Q82Q 2OTLP 3CCSP 1VQ6P 2QEXP 1VQ7P 3CXCO 1VQ8P 3CCRP 1K8AQ 1VQPP 3CPWO
chains in the Genus database with same CATH superfamily
1RE3A 3CWBJ 2FYNC 3HD7B 4Z1MH 1T8ZA 4PXHB 2OGUA 1Z6MA 3S9OA 4ZMDA 3G4SP 3CWBD 2JWDA 1NU1D 2HODB 1NTMK 2VLPA 1RF1C 2QVAA 3RK3C 1GDTA 1S4XA 1PGPA 1KB9D 1WT6A 2LIWA 1BGYD 3HTKB 4W7ZA 4RJTA 4M3LA 3M06A 2WTYA 3DPHA 1NTKK 1FOSE 2MR7A 3CCQP 2FVAA 4QKOA 3LIEA 2ZFCA 4U0DA 2O3JA 5GTHH 2GZJA 3AE3C 1BXIA 2D2CB 4GOEA 1VQ7P 2BCCG 3G26A 3M0DC 4AQRD 3B71A 3L71G 2Q6QA 3NY7B 1NTMD 3KQGA 1OR5A 1FAVA 3L75G 2B89A 1OXZA 2VSQA 2AXTH 5B5EE 2KOGA 1ZN5A 1RNIA 2O1KA 1NTKD 2N6ZA 2P1JA 3RK2C 1SQBK 2L5GB 3FXEA 4PV1C 1SQVK 2LMLA 4BPFA 1RO0A 3N4XA 2OARA 2PGDA 3L73E 2QNWA 1PEOA 3FXDA 1MKMA 2P2UA 4IZ6A 2P7JA 1NKZB 4PD4D 1AYIA 1DH3A 2GUVA 3HE5A 3CCSP 3D6YA 1SQXG 1ZR4A 2WWWA 5APXA 1MFZA 2K5XA 2W90A 2ZYDA 3M0DA 2W8ZA 1GXHA 1WMKA 2HFED 1FZCB 3PLNA 4EYYQ 1FE6A 1SQVJ 1SQBD 1LTAC 1FOSF 1SQVD 4ASWA 2KOOA 3CCEP 1DV5A 2WSSH 3PHLA 1N7SC 2N5IA 2YIUC 5KJ7D 2QJYB 3TYYA 1G2CB 2LL8A 3DS0A 2E76B 3BRTB 1ZP0C 2WSEH 1N7SD 1FJPA 1KB9H 2KP8A 5APSA 1CEIA 1NH4A 4U3FJ 3W68A 1M1JB 3NMDA 7CEIA 3IFMA 2WPVB 1GW4A 1GL2A 5AW5B 1PEMA 2G8YA 4RESB 4U3FD 2JB0A 2L91A 5AW0B 2HG5D 2EHTA 4BPHA 3U59A 3A0HE 1EMVA 4BPGA 1PIXA 1UJZA 3FWLA 2LPKA 3GZMA 2WPQA 2M8RA 4LC1A 1KYOE 2L0QA 1URQC 1KYOI 3CXHE 3CXHI 1NHLA 3TSIA 2N1TC 2OYHC 1NAYA 1URQD 5AVXB 1KILB 4PWVB 3CCJP 5B66H 4W7YA 3H1IG 5AVWB 1J1DC 3U43A 1HGVA 5KKZC 1AFOA 2KOSA 2L9FA 3HUSB 3CCMP 3U1AA 1KMIZ 2XKMA 1RF0C 3BCCJ 1JNMA 4XROA 5AVVB 4IPYA 2KG9A 2WITA 1N73B 2HLOA 1FS0E 3M9HA 3FGAD 4PD4H 1SVFA 3BATA 1MZ8A 1ZOYC 1HY8A 1PP9J 1T6AA 3L72E 1L0LK 2A06D 4D6TJ 2PEJA 3GHGC 1ZXGA 4KT0J 2ZXXA 3KDPB 4D6TD 1GW3A 2N1TA 5E79E 3H1KJ 5CHXA 1JMMA 2KZIA 2OYHA 1G1IA 2K2QA 2Y9YA 1VQ8P 2K0XA 2HR3A 3H1KD 3HD7C 4I6MC 2AEFA 1JCCA 1GD2E 2KWLA 1ZNVA 3E7KA 2E75D 3V2RA 4IFDK 4N6JA 1FZAA 1OIPA 3HD7D 3A0BH 1RF0A 1L0LJ 3GLMA 2L22A 1JM0A 1L0LD 3WBHA 3H1HE 2PRRA 1M57D 1BCCD 3V5BA 2FY8A 3IN6A 1L4AA 3L75J 2AEMA 1S3JA 2D2CC 1FJKA 3L74J 3BCCE 3GHGA 1JTHA 2GZIA 1K8AQ 1HGZA 3GG2A 1Y9BA 3GKLC 3L74D 4O9BA 5KLIB 5EJDA 4IFMA 1M8OB 2M3BA 3H1LG 2IDBA 2BHVA 2D2CD 4K3AA 2IZ0A 1KTMA 3HD7A 2KOPA 2WSFJ 2PEKA 1S9KE 4ZKPA 4PH1A 1VQKP 1J2JB 2HODA 3KZIH 1BDCA 2IBZD 4XFYA 4U0CA 1H89A 3DS5A 1P84E 3HTKA 1JY2O 2FBWC 1P84I 3M0AA 1L2PA 2KGEA 1KQSO 1NVOA 5HGLA 2ZVNB 1IJDB 4I7ZB 3AE9C 3L70G 2RH0A 2A45H 2KS1B 1DNYA 1FR2A 1FZCC 3KPEA 1T8KA 1BAJA 3O8ZA 2BCCE 1X9VA 1NTZG 1EOQA 1W2EA 2XZRA 3L71E 2EG5A 2JU1A 1K30A 3L75E 3I55P 4M0IA 1AQTA 2QJYC 3AECC 1M7LA 2KNCB 5KAFE 2E76C 1FZGA 2PEMA 1NWQA 1LTSC 2ZVOB 2W6AA 1JY2P 2WMMA 2Z5IA 2EIAA 4DT0A 1IMQA 2K88A 1H0TB 3H1JJ 1RHZB 1M1JC 4U7JA 5CCHC 2RN0A 2IBZI 2E76D 1E79H 4H2WC 3TNUB 3L4FA 2WVRA 3CC7P 2QG4A 5KAIH 3G1IA 1FZCA 4EOTA 1SQXE 3K5BA 2AFDA 3H1IJ 3V2QA 2M8LA 5TISH 2ONTA 2GZEA 5F2OA 2PEQA 2CG5B 3RBZA 1DD4A 1W5CE 1GXGA 1KILC 3F5HA 2FKWB 1GMJA 1G2CA 4H2YC 3CX5E 2KGCA 3CX5I 3CCRP 1ZRTE 1ACPA 5HV8A 1VL2A 3HUSC 3H0DA 4GR2A 3BRVB 1AA0A 1WRGA 2H43A 2IX7C 2Q5UA 1M1JA 1Y8AA 5CCHA 2JDIH 2Y0DA 2K9JB 1KQLA 1LJ2A 1L0NG 1N73C 1OWAA 2GZFA 1MUUA 1VQ9P 1LTIC 4HH2A 2KUBA 5CCGC 1BSHA 2KXPB 4I2LC 2R5DA 3P8MC 4COPA 5CBOA 1BSNA 2JU2A 1IFJA 4PJ0H 2ZT9B 2LKMA 2DNWA 4WVZA 1JUNA 1T3JA 2KW2A 2Q7CA 5F2NA 2GA1A 1E0HA 1KILA 3P32A 1EDJA 4BWNA 4GIFA 3TDKA 3B8EB 1KD1Q 1Q86Q 3HUSA 4IL6E 3RG6C 1USEA 1SQQG 4DZOA 4H2XC 1IZNB 3S1KA 2FYUD 3BASA 2X2BA 2QRXA 3MGEA 3CD6P 2MF4A 1N73A 5BS2A 1NOHA 1G1JA 1U57A 1GU4A 2E75B 3G1GA 1IFIA 4JBZA 3L73J 1PZQA 5AVZB 1YTZT 5CCGA 2J58A 3L73D 2YO2A 3H1LJ 3ITKA 4R4LA 1T2KC 1SQPG 2JBGA 1KLPA 5AW3B 5CJ0A 5KLIC 1EIAA 4F37A 2Q3IA 1T2KD 5H2FE 4WWIA 1CW5A 2FFDB 1W2BO 4C7NA 3PH0A 2HPCB 1S2EA 3G28A 2JR8A 3LW5J 4U0EA 2YKQA 5AVYB 3L70J 2B87A 4XFXA 2XXMA 3CMAP 2N9BA 1PEUA 1S1CX 4I7ZC 1CZQA 1LP1B 4XFZA 2M0BA 3KHUA 1RF1A 1RQVA 1R5SA 2K92A 3AE8C 3MIWA 5JPAA 3WUUA 3C1LA 4UB6H 2Q3EA 1UNKA 3CCVP 2BASA 3AE1C 2XNDH 2KYVA 2ZXEB 1AV1A 3U1CA 3II6A 3H1LE 1KV4A 1KYOD 3CXHD 1QEXA 1K9MQ 1EXJA 2FHSC 2Z44A 2POHA 1PPJG 3B5NB 2Z46A 1EDIA 1NKNA 5B5EH 3RG2A 1OFCX 2KK7A 5KJ7C 1VKUA 2IZ1A 3R2PA 1A8OA 1JB0J 1N86A 2QJKB 2XZ0D 2KS1A 3NTNA 4DOJA 2C0XA 3RK3E 3AE7C 3VP8A 3L70E 3G71P 2CWOA 3AEEC 2O01J 3CCLP 2MD9A 3L72J 3G29A 3M9QA 3L72D 3CMEP 2V4HA 2NZ2A 1M1KQ 5CJ4A 1EDKA 4LLHA 4NPDA 5CZDB 5HVCA 3I56P 4DG9A 1NTZE 2JWAA 2W6JH 1Y47A 3HRNA 4LGDE 5KP6B 2KNCA 5KLVG 2LOLA 2MVVA 3FX0A 2P10A 1KN7A 1A43A 1LWUB 1HJBA 5EFWB 1H0TA 5KJ7A 1KQFB 3TNUA 1YJNP 3RBXA 3ZDMA 1OVVA 2LTEA 4HKGA 1N7SA 3QWOC 3H1HJ 5HGMA 1FDOA 5APWA 2WSCJ 3H1HD 2W27A 3MD0A 3CL3D 5KP7B 2XT1A 2N5HA 1BE3G 3PJSK 2ZT9C 3EJBA 1QLED 1AQ5A 1VQ4P 3BCCD 1EZVG 2BEQD 1M74A 1HJ0A 2ZT9D 1KYOH 3AEBC 3CXHH 4RO0A 5EW5E 2GZGA 4L73A 1TU3F 1YHQP 2LXBA 2JEEA 4WY4D 1PP9D 1URQA 4L75A 1S9KD 3BVHA 1Q90D 4B86A 3A0BE 4H0LD 2I8DA 2Q9IA 2K9JA 4YXWH 3B5IA 2E75C 1P84D 2FQ1A 3DS1A 3VYIA 1N7LA 1L0NE 1IFMA 4OH8B 2FVEA 2BUOA 1LTGC 3TGUG 4GR6A 4MRTC 1CI6B 4OGQB 3NXSA 3AE4C 5HGNA 3C9IA 3CLQA 2P67A 3HYBA 4TT3H 2O01H 3CPWO 4R4MA 1J1EB 2FFDC 5CBNA 5AVUB 2QIWA 2BCCJ 5AW2B 3Q1MA 3N7NA 3L71J 2M5RA 2BCCD 2MKVA 2I1JA 2Z5HA 2WPSA 3L71D 4XFJA 1X0TA 1SQXK 4H44D 1KORA 2XU6A 4YTPC 3A7OA 2C0WA 2XDJA 1VF5B 3L75D 5APUA 2FYUG 1A02J 2MR8A 1SQQE 1GU5A 3VOPA 2AF8A 3D70A 2N98A 2CPSA 2BQ1E 3Q5PA 3CWBG 1NJIQ 2ROQA 1NU1G 3L37A 3VMZA 3PTZA 1PEQA 1SQPE 4ASVA 1QL1A 3WU2E 1YJWP 3A2AA 1SQXJ 1BGYG 3EJEA 4HJGH 3KYQA 1R8EA 1YTZI 3IR9A 2FFDA 2YKOA 2O1JA 2PEOA 1SQXD 1HTLC 1ZR2A 2HPCA 3P8CE 1HQBA 3V4QA 2IYPA 2ZYGA 4GOFA 1PL5A 1SLQA 3B5NC 2AXCA 3EQ2A 1S5LH 1NTMG 2KLUA 3MGNA 3SWFA 2R3CA 3CX5D 5GTIE 1ZRTD 2QJKC 3B5ND 1RO2A 1P84H 1D1DA 2QA4P 3SFEC 1NTKG 2PP6A 2NPSD 3VMXA 3HZQA 5KAIE 4PH0A 3CC4P 3JCUE 5KP8B 3CC2P 3MUDC 1Z56A 3EFGA 3W67A 1OW8A 1GL2B 2WPTA 1ZV8A 2YNYA 5AVRB 1USDA 1VQLP 3H1JD 3B4SA 5TJHA 4L74A 4JYBA 3AE2C 2PNGA 3WUTA 1MV8A 2FACA 2VRSA 3Q5SA 2KSEA 2YXRB 2OTKE 4JYCA 1Q81Q 3KXDA 1LWUC 1IK7A 3H6PA 4XA4A 2KI7B 1PPJE 1SQBG 1SQVG 3H1ID 3AE6C 1YJ9P 2ITAA 4KJMA 3LIDA 5KAFH 1GK6A 2KORA 2E43A 2RMZA 4GT1A 2K93A 2L4BA 3QH9A 3EWKA 5M1BA 1YQ3C 1VQ6P 2WSFH 3MUDA 1X22A 3LRYA 2EHSA 2KB7P 4IFFA 5F2KA 3MZWB 1HVVA 2PEIA 2JO0A 2LIUA 1NGMB 5I4TG 1U7MA 4UB8E 1VPCA 1SFCD 4U3FG 1JY3O 1QL2A 4JPZB 2FQ2A 3RL0B 1HWTC 2GDXA 5CMZA 3PP5A 2G3AA 4QNBA 1LWUA 2YKPA 1DX7A 4EDFA 5KLVE 1X8YA 1IUQA 1HBWA 1FZEA 1RQUA 1Q82Q 3CX5H 4OWFA 2AFEA 2SPZA 1AVOA 1NYHA 5C39A 4WY4B 3Q3DA 4NPFX 1PV3A 3E2DA 1ZLLA 4H0LB 3OW2O 5BVZA 3VTPC 2KR5A 2PENA 2E74D 5AVSB 1JCDA 3GF3A 4OGQC 4EI2A 1MFTA 3PRJA 1LNQA 2Y0EA 1FBMA 1IFPA 2NRGA 1SP4A 1BE3E 1J1EC 2JQ4A 1XTCC 1LGHB 4OGQD 1NAFA 4DJGA 2A45G 1JY3P 1S72P 1L4AB 4AUWA 1IMPA 1LTJB 2FXPA 1EZVE 1NQ4A 1EZVI 5GTHE 3H1LD 2A06G 3M9BA 1QRJA 4GDOA 2FQ0A 1LTBC 1VF5C 4YPCA 2UWJE 4HB1A 1NU1J 4D6TG 1YBKA 1KILE 3RL0g 1M56D 2WSEJ 4H44B 4IL6H 1VF5D 3H1KG 1NTZK 3NFQA 1L0HA 1LT1A 1BGYJ 1FDMA 1X3OA 2AXTE 3M1MA 1CI6A 1JOCA 2FXOA 2MVUA 2PAJA 5APTA 1LTTC 2FAEA 3RK3D 3DS3A 2M5AB 3LMOA 3SWKA 4UB6E 3TGUE 1VHNA 3L70D 4N78E 1UIIA 1DIPA 5AW9B 1L0LG 3TF5A 1FC2C 2M3EA 2KZJA 1ZW0A 4U0BA 2WT7B 2ERHA 1VQ5P 1BCCG 4GKGA 5BU8B 2I1KA 1HH0A 1NTMJ 3JC22 2DGYA 1NTZJ 1JJ2O 5H2FH 4BRYB 1NTZD 2JAZA 3G9RA 1L0IA 3SFDC 2N50A 3L74G 1QVGO 3MHVA 2YO3A 1NTKJ 1MZ9A 3T97B 4YXDC 2FYUE 3F89A 1DEBA 1RE4C 1JY2N 3CXCO 1D7MA 4UHPB 3UIAA 3H32B 5DJTB 4K35A 2XZ1C 2IBZG 1OW7A 2JYLA 4NPEA 2FADA 2MJZA 3RK2D 3CWBE 4U0FA 1NU1E 4PV1D 1E6JP 2C9LY 5BS1A 3O6QB 2V7QJ 1LT9B 1GL2C 2IPPA 2NPSB 2QE7H 3GZLA 1KB9E 3DTJA 1BGYE 1KB9I 4A7PA 2PFXA 1L0NK 1GL2D 4I1LA 1SQBJ 3R4YA 1N2DC 1Q2NA 4DCKA 1KC8Q 2LR2A 3E1IA 5BU5A 2QM8A 2FXMA 2MY5A 2ZAEB 4IOIH 3A5TA 1DD3A 2CNRA 1RE4A 1BDDA 2Z4EA 3H25A 2W6BA 3DS4A 3C8VA 1EXIA 1K73Q 1NTME 3WUVA 1JO5A 3DS2A 3AEGC 1E5WA 1DEEG 2WQYC 5B66E 1X79B 4EIJA 5AW1B 2N6YA 1L0NJ 2K3RA 3FWNA 1ZMBA 1NTKE 1L0ND 3LW5H 2Q1KA 3HE4B 2M8NA 4QMAA 2OYIB 4MN4C 1SQQK 2CGQA 5APQA 1VQMP 1NO4A 3AE5C 1QGKB 4U0AA 1EDLA 3H1JG 3VP9A 1ZMEC 1FZFA 4PD4E 1GPJA 3S4RA 4PD4I 1QX8A 1S5LX 2K37A 3H47A 1OZHA 3RL0C 2JP3A 1FDIA 2J59M 2P9XA 3NTEA 3A3YB 1R5LA 1SFCB 2VLQA 1SQPK 3CE7A 1KFNA 1K05A 3RL0D 5AVQB 2QSIA 2PY8A 5AW4B 3VMAA 1OVUA 3SWYA 1K04A 3A0HH 1FU1A 4Y99B 5K5GB 1SQBE 1SQQJ 4WY4C 4HYTB 2N1TD 1SQVE 2N9YB 2RKLA 1SQQD 2K0DX 4H0LC 2DW3A 3B4QA 3L36A 1JY3N 3AEDC 4OVNF 2WPRA 1IK9A 2H88C 1YI2P 2L6EA 2XV5A 1SQPJ 5AW8B 4ZNCA 2B88A 2E74B 1SQPD 2V7QH 2QJPB 1L4AC 1LTJC 2H89C 5AW6B 4U3FE 2JO1A 4WYMA 3EJDA 5APVA 3L35A 2K1AA 3TK1A 3P8CD 2P58A 5AW7B 3P05A 2OYOA 1L4AD 2OQQA 4Y28J 1AJYA 4C7NB 2IFNA 1H8AA 3IF4A 4H13B 4WY4A 4H44C 4ZKUA 2J5UA 2R5BA 3CCUP 2JJLA 1KQGB 2B87B 2JYGA 2KG8A 3KZIE 3MP7B 5E79H 2KODA 3AEAC 1RH5B 1BCCJ 3RGUA 4XE5B 2W83C 4AYCA 2FYNB 1QVFO 3OJAB 3VMYA 1UIXA 3G21A 1T3UA 2JKVA 1LTJA 1SS1A 1M6NA 1RF1B 3L73G 3RK3B 1F80D 3I5CA 3V4WA 3VN0A 1AUMA 2KLVA 2A45I 4C46A 1AVYA 2R44A 4HKZH 1IFDA 2WSCH 2VLOA 3V6IA 2A06E 1PP9E 1CSBA 1S5LE 1EC5A 3HE5B 4TLFA 1JMBA 1KFMA 2KIKA 3IAOA 4D6TE 2E1MA 1PPJD 3Q2YA 2GDYA 3H1KE 2EFJA 3E1RA 2GYKA 2QM7A 5AVTB 2M5AA 1AF8A 5KLVK 1JEKA 2VLNA 3G3ZA 4WBAA 1GZLA 3D6ZA 1LT9C 3D71A 2Z45A 2WT7A 2NPSC 1LP1A 1GTWA 1H88A 3RK2B 4COCA 1L0LE 4PV1B 1PGJA 3WU2H 2AEJA 5HGOA 4BRYA 1BCCE 3EFFK 3ABVC 2NO8A 4JF7A 4NEOA 1VDFA 2IYOA 2KSJA 4IL6X 1OVRA 2ZYAA 1IC2A 3Q20A 4N3YB 2C9NY 5KTBA 3V2PA 1VQPP 4GODA 3MTUE 3OAKA 2XNXA 3T97A 2O01N 2ZJSE 5KLVJ 3L74E 1YITP 3H4EA 2OTJP 5TISE 3M91A 3H32A 2JGPA 2LKIA 5KLVD 5DCKA 1YIJP 1M6EX 5DJUB 1M90Q 3GW6A 1HF9A 3GMAA 5GTIH 3B5NA 3O6QA 5APYA 2IBZE 1IFNA 3GF7A 1LT9A 1VQNP 2K0YA 2NPSA 4CPGA 2OYIC 5L8RJ 2GUSA 1N7SB 1HUCA 2YIUB 1OX3A 3JCUH 5CCHD 4L76A 2R3SA 4R0MA 4KHXA 1BE3J 2YMYA 1PFIA 3JSVC 1RY3A 2E5YA 1GK4A 3CI9A 1BE3D 3AEFC 2K94A 2CQ8A 2H8PD 1FZBA 2KG6A 3Q5RA 1SFCC 1EQ7A 2KGDA 1EZVD 4C7RA 4PJ0E 3L72G 1U7JA 3V2NA 2FYZA 2KOQA 2WZ7A 4Y99C 2Y9ZA 1IO4A 3G0VA 2OTLP 2QEXP 3VRLC 4JQ0D 1N8RQ 2KGAA 1KILD 2R32A 1URQB 4CA3A 2YXQB 2CPBA 1KZUB 4BXLA 3HE4A 2M8PA 3OA7A 2LXCB 2B9BA 2IFMA 2E5TA 2N1TB 1OMIA 2OYIA 2OYHB 1XTGB 3SSUA 1PGOA 1YYCA 1RE3C 2YMKA 3TGUJ 1PGQA 1J1DB 2FYUK 2E74C 3USSA 1OW6A 1A02F 5KKZB 3TGUD 2QJPC 1Q7YQ 2BEZF 4N78D 4XRQA 3H1JE 5CCGD 2GDWA 3H1HG 2LF4A 1SFCA 2AVAA 1YQ4C 2H7HA 4UB8H 1NU1K 2GM4A 4W80A 3BCCG 4H13C 2E42A 2FVFA 3GJNA 3G6EP 3H1IE 2FYUJ 4WB4A 2HYNA 2CK3H 3GHGB 2XV6A 1JTHB 2Y0CA 1VQOP 4H13D 4RKUJ 1PP9G 2K9YA 3WMM0 3P7KA
chains in the Genus database with same CATH topology
1RO2A 3DS3A 1D1DA 5JPAA 3CCMP 2EFJA 2BHVA 3DS4A 2QA4P 4QNBA 1K73Q 3G4SP 3CCVP 1KD1Q 1Q86Q 1YJNP 3RG6C 4XROA 4WYMA 3HZQA 4IPYA 4PH0A 1IUQA 3CC4P 2PEKA 3CC7P 3DS2A 3G1IA 4U0BA 3CC2P 4PH1A 1VQKP 1VQ5P 3P05A 5HGMA 3MGEA 2Z45A 3CD6P 1Q82Q 3G0VA 2OTLP 5BS2A 2QEXP 4XFYA 4U0CA 3VRLC 1ZMBA 2DGYA 3G1GA 1JJ2O 3DS5A 4COCA 1N8RQ 1K9MQ 3CCEP 3DPHA 3E2DA 2XT1A 2M8NA 2M8LA 3CCQP 1VQLP 2ONTA 5HGOA 1KQSO 5F2OA 3OW2O 2PEQA 2Z44A 2PENA 5HGLA 2M8PA 4U0DA 1VQMP 1QVGO 2PEJA 3DS0A 2Z46A 3CCUP 4U0AA 1VQ4P 2BQ1E 1Q81Q 2JYGA 1NJIQ 1M74A 2KODA 3H47A 3Q20A 1VQ7P 3CXCO 1VQ8P 1A8OA 3G26A 3CCRP 1VQPP 1EIAA 1PEQA 2P9XA 3H0DA 4GR2A 3NTEA 1Q7YQ 1YITP 3H4EA 2OTJP 1W2BO 1PEMA 1YJWP 2JYLA 1YHQP 1S72P 4XRQA 1QVFO 1YJ9P 3G71P 5DCKA 1BAJA 1YIJP 3G21A 2CWOA 4U0FA 2LF4A 2PY8A 2PEOA 1M6EX 1E6JP 3G28A 5BS1A 1M90Q 1VQ9P 1M6NA 3CCLP 1EOQA 4U0EA 1QRJA 1RNIA 3B5IA 1AUMA 1VQ6P 3G29A 2EG5A 3LRYA 1K30A 3DTJA 4XFXA 5F2KA 2XXMA 3DS1A 3CMEP 4COPA 3WBHA 3CMAP 3I55P 1M1KQ 1VQNP 4M0IA 3G6EP 2PEIA 3I56P 2JO0A 2BUOA 1RO0A 1PEUA 2OARA 1PEOA 5I4TG 2PEMA 4GR6A 2XV6A 1KC8Q 4XFZA 1VQOP 1YI2P 3CCJP 2L6EA 5HGNA 2E1MA 2EIAA 3CCSP 3M1MA 5F2NA 3HYBA 1K8AQ 1A43A 3CPWO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 O;  1N8R Q;  3CME P;  1VQN P;  1K9M Q;  1M1K Q;  3CMA P;  3I55 P;  3CCE P;  1Q7Y Q;  1YIT P;  3CCM P;  2OTJ P;  1W2B O;  3CCQ P;  2QA4 P;  3G6E P;  1K73 Q;  1VQL P;  1YJW P;  1YHQ P;  3I56 P;  1KQS O;  1S72 P;  3G4S P;  3OW2 O;  1QVF O;  3CCV P;  1KD1 Q;  1Q86 Q;  1YJ9 P;  1YJN P;  3G71 P;  1YIJ P;  1VQM P;  1QVG O;  3CC4 P;  3CC7 P;  3CCU P;  3CC2 P;  1KC8 Q;  1M90 Q;  1VQ9 P;  1VQK P;  1VQO P;  1YI2 P;  1VQ5 P;  1Q81 Q;  3CCJ P;  1VQ4 P;  3CCL P;  1NJI Q;  3CD6 P;  1Q82 Q;  2OTL P;  3CCS P;  1VQ6 P;  2QEX P;  1VQ7 P;  3CXC O;  1VQ8 P;  3CCR P;  1K8A Q;  1VQP P;  3CPW O; 
#chains in the Genus database with same CATH topology
 1RE3 A;  3CWB J;  2FYN C;  3HD7 B;  4Z1M H;  1T8Z A;  4PXH B;  2OGU A;  1Z6M A;  3S9O A;  4ZMD A;  3G4S P;  3CWB D;  2JWD A;  1NU1 D;  2HOD B;  1NTM K;  2VLP A;  1RF1 C;  2QVA A;  3RK3 C;  1GDT A;  1S4X A;  1PGP A;  1KB9 D;  1WT6 A;  2LIW A;  1BGY D;  3HTK B;  4W7Z A;  4RJT A;  4M3L A;  3M06 A;  2WTY A;  3DPH A;  1NTK K;  1FOS E;  2MR7 A;  3CCQ P;  2FVA A;  4QKO A;  3LIE A;  2ZFC A;  4U0D A;  2O3J A;  5GTH H;  2GZJ A;  3AE3 C;  1BXI A;  2D2C B;  4GOE A;  1VQ7 P;  2BCC G;  3G26 A;  3M0D C;  4AQR D;  3B71 A;  3L71 G;  2Q6Q A;  3NY7 B;  1NTM D;  3KQG A;  1OR5 A;  1FAV A;  3L75 G;  2B89 A;  1OXZ A;  2VSQ A;  2AXT H;  5B5E E;  2KOG A;  1ZN5 A;  1RNI A;  2O1K A;  1NTK D;  2N6Z A;  2P1J A;  3RK2 C;  1SQB K;  2L5G B;  3FXE A;  4PV1 C;  1SQV K;  2LML A;  4BPF A;  1RO0 A;  3N4X A;  2OAR A;  2PGD A;  3L73 E;  2QNW A;  1PEO A;  3FXD A;  1MKM A;  2P2U A;  4IZ6 A;  2P7J A;  1NKZ B;  4PD4 D;  1AYI A;  1DH3 A;  2GUV A;  3HE5 A;  3CCS P;  3D6Y A;  1SQX G;  1ZR4 A;  2WWW A;  5APX A;  1MFZ A;  2K5X A;  2W90 A;  2ZYD A;  3M0D A;  2W8Z A;  1GXH A;  1WMK A;  2HFE D;  1FZC B;  3PLN A;  4EYY Q;  1FE6 A;  1SQV J;  1SQB D;  1LTA C;  1FOS F;  1SQV D;  4ASW A;  2KOO A;  3CCE P;  1DV5 A;  2WSS H;  3PHL A;  1N7S C;  2N5I A;  2YIU C;  5KJ7 D;  2QJY B;  3TYY A;  1G2C B;  2LL8 A;  3DS0 A;  2E76 B;  3BRT B;  1ZP0 C;  2WSE H;  1N7S D;  1FJP A;  1KB9 H;  2KP8 A;  5APS A;  1CEI A;  1NH4 A;  4U3F J;  3W68 A;  1M1J B;  3NMD A;  7CEI A;  3IFM A;  2WPV B;  1GW4 A;  1GL2 A;  5AW5 B;  1PEM A;  2G8Y A;  4RES B;  4U3F D;  2JB0 A;  2L91 A;  5AW0 B;  2HG5 D;  2EHT A;  4BPH A;  3U59 A;  3A0H E;  1EMV A;  4BPG A;  1PIX A;  1UJZ A;  3FWL A;  2LPK A;  3GZM A;  2WPQ A;  2M8R A;  4LC1 A;  1KYO E;  2L0Q A;  1URQ C;  1KYO I;  3CXH E;  3CXH I;  1NHL A;  3TSI A;  2N1T C;  2OYH C;  1NAY A;  1URQ D;  5AVX B;  1KIL B;  4PWV B;  3CCJ P;  5B66 H;  4W7Y A;  3H1I G;  5AVW B;  1J1D C;  3U43 A;  1HGV A;  5KKZ C;  1AFO A;  2KOS A;  2L9F A;  3HUS B;  3CCM P;  3U1A A;  1KMI Z;  2XKM A;  1RF0 C;  3BCC J;  1JNM A;  4XRO A;  5AVV B;  4IPY A;  2KG9 A;  2WIT A;  1N73 B;  2HLO A;  1FS0 E;  3M9H A;  3FGA D;  4PD4 H;  1SVF A;  3BAT A;  1MZ8 A;  1ZOY C;  1HY8 A;  1PP9 J;  1T6A A;  3L72 E;  1L0L K;  2A06 D;  4D6T J;  2PEJ A;  3GHG C;  1ZXG A;  4KT0 J;  2ZXX A;  3KDP B;  4D6T D;  1GW3 A;  2N1T A;  5E79 E;  3H1K J;  5CHX A;  1JMM A;  2KZI A;  2OYH A;  1G1I A;  2K2Q A;  2Y9Y A;  1VQ8 P;  2K0X A;  2HR3 A;  3H1K D;  3HD7 C;  4I6M C;  2AEF A;  1JCC A;  1GD2 E;  2KWL A;  1ZNV A;  3E7K A;  2E75 D;  3V2R A;  4IFD K;  4N6J A;  1FZA A;  1OIP A;  3HD7 D;  3A0B H;  1RF0 A;  1L0L J;  3GLM A;  2L22 A;  1JM0 A;  1L0L D;  3WBH A;  3H1H E;  2PRR A;  1M57 D;  1BCC D;  3V5B A;  2FY8 A;  3IN6 A;  1L4A A;  3L75 J;  2AEM A;  1S3J A;  2D2C C;  1FJK A;  3L74 J;  3BCC E;  3GHG A;  1JTH A;  2GZI A;  1K8A Q;  1HGZ A;  3GG2 A;  1Y9B A;  3GKL C;  3L74 D;  4O9B A;  5KLI B;  5EJD A;  4IFM A;  1M8O B;  2M3B A;  3H1L G;  2IDB A;  2BHV A;  2D2C D;  4K3A A;  2IZ0 A;  1KTM A;  3HD7 A;  2KOP A;  2WSF J;  2PEK A;  1S9K E;  4ZKP A;  4PH1 A;  1VQK P;  1J2J B;  2HOD A;  3KZI H;  1BDC A;  2IBZ D;  4XFY A;  4U0C A;  1H89 A;  3DS5 A;  1P84 E;  3HTK A;  1JY2 O;  2FBW C;  1P84 I;  3M0A A;  1L2P A;  2KGE A;  1KQS O;  1NVO A;  5HGL A;  2ZVN B;  1IJD B;  4I7Z B;  3AE9 C;  3L70 G;  2RH0 A;  2A45 H;  2KS1 B;  1DNY A;  1FR2 A;  1FZC C;  3KPE A;  1T8K A;  1BAJ A;  3O8Z A;  2BCC E;  1X9V A;  1NTZ G;  1EOQ A;  1W2E A;  2XZR A;  3L71 E;  2EG5 A;  2JU1 A;  1K30 A;  3L75 E;  3I55 P;  4M0I A;  1AQT A;  2QJY C;  3AEC C;  1M7L A;  2KNC B;  5KAF E;  2E76 C;  1FZG A;  2PEM A;  1NWQ A;  1LTS C;  2ZVO B;  2W6A A;  1JY2 P;  2WMM A;  2Z5I A;  2EIA A;  4DT0 A;  1IMQ A;  2K88 A;  1H0T B;  3H1J J;  1RHZ B;  1M1J C;  4U7J A;  5CCH C;  2RN0 A;  2IBZ I;  2E76 D;  1E79 H;  4H2W C;  3TNU B;  3L4F A;  2WVR A;  3CC7 P;  2QG4 A;  5KAI H;  3G1I A;  1FZC A;  4EOT A;  1SQX E;  3K5B A;  2AFD A;  3H1I J;  3V2Q A;  2M8L A;  5TIS H;  2ONT A;  2GZE A;  5F2O A;  2PEQ A;  2CG5 B;  3RBZ A;  1DD4 A;  1W5C E;  1GXG A;  1KIL C;  3F5H A;  2FKW B;  1GMJ A;  1G2C A;  4H2Y C;  3CX5 E;  2KGC A;  3CX5 I;  3CCR P;  1ZRT E;  1ACP A;  5HV8 A;  1VL2 A;  3HUS C;  3H0D A;  4GR2 A;  3BRV B;  1AA0 A;  1WRG A;  2H43 A;  2IX7 C;  2Q5U A;  1M1J A;  1Y8A A;  5CCH A;  2JDI H;  2Y0D A;  2K9J B;  1KQL A;  1LJ2 A;  1L0N G;  1N73 C;  1OWA A;  2GZF A;  1MUU A;  1VQ9 P;  1LTI C;  4HH2 A;  2KUB A;  5CCG C;  1BSH A;  2KXP B;  4I2L C;  2R5D A;  3P8M C;  4COP A;  5CBO A;  1BSN A;  2JU2 A;  1IFJ A;  4PJ0 H;  2ZT9 B;  2LKM A;  2DNW A;  4WVZ A;  1JUN A;  1T3J A;  2KW2 A;  2Q7C A;  5F2N A;  2GA1 A;  1E0H A;  1KIL A;  3P32 A;  1EDJ A;  4BWN A;  4GIF A;  3TDK A;  3B8E B;  1KD1 Q;  1Q86 Q;  3HUS A;  4IL6 E;  3RG6 C;  1USE A;  1SQQ G;  4DZO A;  4H2X C;  1IZN B;  3S1K A;  2FYU D;  3BAS A;  2X2B A;  2QRX A;  3MGE A;  3CD6 P;  2MF4 A;  1N73 A;  5BS2 A;  1NOH A;  1G1J A;  1U57 A;  1GU4 A;  2E75 B;  3G1G A;  1IFI A;  4JBZ A;  3L73 J;  1PZQ A;  5AVZ B;  1YTZ T;  5CCG A;  2J58 A;  3L73 D;  2YO2 A;  3H1L J;  3ITK A;  4R4L A;  1T2K C;  1SQP G;  2JBG A;  1KLP A;  5AW3 B;  5CJ0 A;  5KLI C;  1EIA A;  4F37 A;  2Q3I A;  1T2K D;  5H2F E;  4WWI A;  1CW5 A;  2FFD B;  1W2B O;  4C7N A;  3PH0 A;  2HPC B;  1S2E A;  3G28 A;  2JR8 A;  3LW5 J;  4U0E A;  2YKQ A;  5AVY B;  3L70 J;  2B87 A;  4XFX A;  2XXM A;  3CMA P;  2N9B A;  1PEU A;  1S1C X;  4I7Z C;  1CZQ A;  1LP1 B;  4XFZ A;  2M0B A;  3KHU A;  1RF1 A;  1RQV A;  1R5S A;  2K92 A;  3AE8 C;  3MIW A;  5JPA A;  3WUU A;  3C1L A;  4UB6 H;  2Q3E A;  1UNK A;  3CCV P;  2BAS A;  3AE1 C;  2XND H;  2KYV A;  2ZXE B;  1AV1 A;  3U1C A;  3II6 A;  3H1L E;  1KV4 A;  1KYO D;  3CXH D;  1QEX A;  1K9M Q;  1EXJ A;  2FHS C;  2Z44 A;  2POH A;  1PPJ G;  3B5N B;  2Z46 A;  1EDI A;  1NKN A;  5B5E H;  3RG2 A;  1OFC X;  2KK7 A;  5KJ7 C;  1VKU A;  2IZ1 A;  3R2P A;  1A8O A;  1JB0 J;  1N86 A;  2QJK B;  2XZ0 D;  2KS1 A;  3NTN A;  4DOJ A;  2C0X A;  3RK3 E;  3AE7 C;  3VP8 A;  3L70 E;  3G71 P;  2CWO A;  3AEE C;  2O01 J;  3CCL P;  2MD9 A;  3L72 J;  3G29 A;  3M9Q A;  3L72 D;  3CME P;  2V4H A;  2NZ2 A;  1M1K Q;  5CJ4 A;  1EDK A;  4LLH A;  4NPD A;  5CZD B;  5HVC A;  3I56 P;  4DG9 A;  1NTZ E;  2JWA A;  2W6J H;  1Y47 A;  3HRN A;  4LGD E;  5KP6 B;  2KNC A;  5KLV G;  2LOL A;  2MVV A;  3FX0 A;  2P10 A;  1KN7 A;  1A43 A;  1LWU B;  1HJB A;  5EFW B;  1H0T A;  5KJ7 A;  1KQF B;  3TNU A;  1YJN P;  3RBX A;  3ZDM A;  1OVV A;  2LTE A;  4HKG A;  1N7S A;  3QWO C;  3H1H J;  5HGM A;  1FDO A;  5APW A;  2WSC J;  3H1H D;  2W27 A;  3MD0 A;  3CL3 D;  5KP7 B;  2XT1 A;  2N5H A;  1BE3 G;  3PJS K;  2ZT9 C;  3EJB A;  1QLE D;  1AQ5 A;  1VQ4 P;  3BCC D;  1EZV G;  2BEQ D;  1M74 A;  1HJ0 A;  2ZT9 D;  1KYO H;  3AEB C;  3CXH H;  4RO0 A;  5EW5 E;  2GZG A;  4L73 A;  1TU3 F;  1YHQ P;  2LXB A;  2JEE A;  4WY4 D;  1PP9 D;  1URQ A;  4L75 A;  1S9K D;  3BVH A;  1Q90 D;  4B86 A;  3A0B E;  4H0L D;  2I8D A;  2Q9I A;  2K9J A;  4YXW H;  3B5I A;  2E75 C;  1P84 D;  2FQ1 A;  3DS1 A;  3VYI A;  1N7L A;  1L0N E;  1IFM A;  4OH8 B;  2FVE A;  2BUO A;  1LTG C;  3TGU G;  4GR6 A;  4MRT C;  1CI6 B;  4OGQ B;  3NXS A;  3AE4 C;  5HGN A;  3C9I A;  3CLQ A;  2P67 A;  3HYB A;  4TT3 H;  2O01 H;  3CPW O;  4R4M A;  1J1E B;  2FFD C;  5CBN A;  5AVU B;  2QIW A;  2BCC J;  5AW2 B;  3Q1M A;  3N7N A;  3L71 J;  2M5R A;  2BCC D;  2MKV A;  2I1J A;  2Z5H A;  2WPS A;  3L71 D;  4XFJ A;  1X0T A;  1SQX K;  4H44 D;  1KOR A;  2XU6 A;  4YTP C;  3A7O A;  2C0W A;  2XDJ A;  1VF5 B;  3L75 D;  5APU A;  2FYU G;  1A02 J;  2MR8 A;  1SQQ E;  1GU5 A;  3VOP A;  2AF8 A;  3D70 A;  2N98 A;  2CPS A;  2BQ1 E;  3Q5P A;  3CWB G;  1NJI Q;  2ROQ A;  1NU1 G;  3L37 A;  3VMZ A;  3PTZ A;  1PEQ A;  1SQP E;  4ASV A;  1QL1 A;  3WU2 E;  1YJW P;  3A2A A;  1SQX J;  1BGY G;  3EJE A;  4HJG H;  3KYQ A;  1R8E A;  1YTZ I;  3IR9 A;  2FFD A;  2YKO A;  2O1J A;  2PEO A;  1SQX D;  1HTL C;  1ZR2 A;  2HPC A;  3P8C E;  1HQB A;  3V4Q A;  2IYP A;  2ZYG A;  4GOF A;  1PL5 A;  1SLQ A;  3B5N C;  2AXC A;  3EQ2 A;  1S5L H;  1NTM G;  2KLU A;  3MGN A;  3SWF A;  2R3C A;  3CX5 D;  5GTI E;  1ZRT D;  2QJK C;  3B5N D;  1RO2 A;  1P84 H;  1D1D A;  2QA4 P;  3SFE C;  1NTK G;  2PP6 A;  2NPS D;  3VMX A;  3HZQ A;  5KAI E;  4PH0 A;  3CC4 P;  3JCU E;  5KP8 B;  3CC2 P;  3MUD C;  1Z56 A;  3EFG A;  3W67 A;  1OW8 A;  1GL2 B;  2WPT A;  1ZV8 A;  2YNY A;  5AVR B;  1USD A;  1VQL P;  3H1J D;  3B4S A;  5TJH A;  4L74 A;  4JYB A;  3AE2 C;  2PNG A;  3WUT A;  1MV8 A;  2FAC A;  2VRS A;  3Q5S A;  2KSE A;  2YXR B;  2OTK E;  4JYC A;  1Q81 Q;  3KXD A;  1LWU C;  1IK7 A;  3H6P A;  4XA4 A;  2KI7 B;  1PPJ E;  1SQB G;  1SQV G;  3H1I D;  3AE6 C;  1YJ9 P;  2ITA A;  4KJM A;  3LID A;  5KAF H;  1GK6 A;  2KOR A;  2E43 A;  2RMZ A;  4GT1 A;  2K93 A;  2L4B A;  3QH9 A;  3EWK A;  5M1B A;  1YQ3 C;  1VQ6 P;  2WSF H;  3MUD A;  1X22 A;  3LRY A;  2EHS A;  2KB7 P;  4IFF A;  5F2K A;  3MZW B;  1HVV A;  2PEI A;  2JO0 A;  2LIU A;  1NGM B;  5I4T G;  1U7M A;  4UB8 E;  1VPC A;  1SFC D;  4U3F G;  1JY3 O;  1QL2 A;  4JPZ B;  2FQ2 A;  3RL0 B;  1HWT C;  2GDX A;  5CMZ A;  3PP5 A;  2G3A A;  4QNB A;  1LWU A;  2YKP A;  1DX7 A;  4EDF A;  5KLV E;  1X8Y A;  1IUQ A;  1HBW A;  1FZE A;  1RQU A;  1Q82 Q;  3CX5 H;  4OWF A;  2AFE A;  2SPZ A;  1AVO A;  1NYH A;  5C39 A;  4WY4 B;  3Q3D A;  4NPF X;  1PV3 A;  3E2D A;  1ZLL A;  4H0L B;  3OW2 O;  5BVZ A;  3VTP C;  2KR5 A;  2PEN A;  2E74 D;  5AVS B;  1JCD A;  3GF3 A;  4OGQ C;  4EI2 A;  1MFT A;  3PRJ A;  1LNQ A;  2Y0E A;  1FBM A;  1IFP A;  2NRG A;  1SP4 A;  1BE3 E;  1J1E C;  2JQ4 A;  1XTC C;  1LGH B;  4OGQ D;  1NAF A;  4DJG A;  2A45 G;  1JY3 P;  1S72 P;  1L4A B;  4AUW A;  1IMP A;  1LTJ B;  2FXP A;  1EZV E;  1NQ4 A;  1EZV I;  5GTH E;  3H1L D;  2A06 G;  3M9B A;  1QRJ A;  4GDO A;  2FQ0 A;  1LTB C;  1VF5 C;  4YPC A;  2UWJ E;  4HB1 A;  1NU1 J;  4D6T G;  1YBK A;  1KIL E;  3RL0 g;  1M56 D;  2WSE J;  4H44 B;  4IL6 H;  1VF5 D;  3H1K G;  1NTZ K;  3NFQ A;  1L0H A;  1LT1 A;  1BGY J;  1FDM A;  1X3O A;  2AXT E;  3M1M A;  1CI6 A;  1JOC A;  2FXO A;  2MVU A;  2PAJ A;  5APT A;  1LTT C;  2FAE A;  3RK3 D;  3DS3 A;  2M5A B;  3LMO A;  3SWK A;  4UB6 E;  3TGU E;  1VHN A;  3L70 D;  4N78 E;  1UII A;  1DIP A;  5AW9 B;  1L0L G;  3TF5 A;  1FC2 C;  2M3E A;  2KZJ A;  1ZW0 A;  4U0B A;  2WT7 B;  2ERH A;  1VQ5 P;  1BCC G;  4GKG A;  5BU8 B;  2I1K A;  1HH0 A;  1NTM J;  3JC2 2;  2DGY A;  1NTZ J;  1JJ2 O;  5H2F H;  4BRY B;  1NTZ D;  2JAZ A;  3G9R A;  1L0I A;  3SFD C;  2N50 A;  3L74 G;  1QVG O;  3MHV A;  2YO3 A;  1NTK J;  1MZ9 A;  3T97 B;  4YXD C;  2FYU E;  3F89 A;  1DEB A;  1RE4 C;  1JY2 N;  3CXC O;  1D7M A;  4UHP B;  3UIA A;  3H32 B;  5DJT B;  4K35 A;  2XZ1 C;  2IBZ G;  1OW7 A;  2JYL A;  4NPE A;  2FAD A;  2MJZ A;  3RK2 D;  3CWB E;  4U0F A;  1NU1 E;  4PV1 D;  1E6J P;  2C9L Y;  5BS1 A;  3O6Q B;  2V7Q J;  1LT9 B;  1GL2 C;  2IPP A;  2NPS B;  2QE7 H;  3GZL A;  1KB9 E;  3DTJ A;  1BGY E;  1KB9 I;  4A7P A;  2PFX A;  1L0N K;  1GL2 D;  4I1L A;  1SQB J;  3R4Y A;  1N2D C;  1Q2N A;  4DCK A;  1KC8 Q;  2LR2 A;  3E1I A;  5BU5 A;  2QM8 A;  2FXM A;  2MY5 A;  2ZAE B;  4IOI H;  3A5T A;  1DD3 A;  2CNR A;  1RE4 A;  1BDD A;  2Z4E A;  3H25 A;  2W6B A;  3DS4 A;  3C8V A;  1EXI A;  1K73 Q;  1NTM E;  3WUV A;  1JO5 A;  3DS2 A;  3AEG C;  1E5W A;  1DEE G;  2WQY C;  5B66 E;  1X79 B;  4EIJ A;  5AW1 B;  2N6Y A;  1L0N J;  2K3R A;  3FWN A;  1ZMB A;  1NTK E;  1L0N D;  3LW5 H;  2Q1K A;  3HE4 B;  2M8N A;  4QMA A;  2OYI B;  4MN4 C;  1SQQ K;  2CGQ A;  5APQ A;  1VQM P;  1NO4 A;  3AE5 C;  1QGK B;  4U0A A;  1EDL A;  3H1J G;  3VP9 A;  1ZME C;  1FZF A;  4PD4 E;  1GPJ A;  3S4R A;  4PD4 I;  1QX8 A;  1S5L X;  2K37 A;  3H47 A;  1OZH A;  3RL0 C;  2JP3 A;  1FDI A;  2J59 M;  2P9X A;  3NTE A;  3A3Y B;  1R5L A;  1SFC B;  2VLQ A;  1SQP K;  3CE7 A;  1KFN A;  1K05 A;  3RL0 D;  5AVQ B;  2QSI A;  2PY8 A;  5AW4 B;  3VMA A;  1OVU A;  3SWY A;  1K04 A;  3A0H H;  1FU1 A;  4Y99 B;  5K5G B;  1SQB E;  1SQQ J;  4WY4 C;  4HYT B;  2N1T D;  1SQV E;  2N9Y B;  2RKL A;  1SQQ D;  2K0D X;  4H0L C;  2DW3 A;  3B4Q A;  3L36 A;  1JY3 N;  3AED C;  4OVN F;  2WPR A;  1IK9 A;  2H88 C;  1YI2 P;  2L6E A;  2XV5 A;  1SQP J;  5AW8 B;  4ZNC A;  2B88 A;  2E74 B;  1SQP D;  2V7Q H;  2QJP B;  1L4A C;  1LTJ C;  2H89 C;  5AW6 B;  4U3F E;  2JO1 A;  4WYM A;  3EJD A;  5APV A;  3L35 A;  2K1A A;  3TK1 A;  3P8C D;  2P58 A;  5AW7 B;  3P05 A;  2OYO A;  1L4A D;  2OQQ A;  4Y28 J;  1AJY A;  4C7N B;  2IFN A;  1H8A A;  3IF4 A;  4H13 B;  4WY4 A;  4H44 C;  4ZKU A;  2J5U A;  2R5B A;  3CCU P;  2JJL A;  1KQG B;  2B87 B;  2JYG A;  2KG8 A;  3KZI E;  3MP7 B;  5E79 H;  2KOD A;  3AEA C;  1RH5 B;  1BCC J;  3RGU A;  4XE5 B;  2W83 C;  4AYC A;  2FYN B;  1QVF O;  3OJA B;  3VMY A;  1UIX A;  3G21 A;  1T3U A;  2JKV A;  1LTJ A;  1SS1 A;  1M6N A;  1RF1 B;  3L73 G;  3RK3 B;  1F80 D;  3I5C A;  3V4W A;  3VN0 A;  1AUM A;  2KLV A;  2A45 I;  4C46 A;  1AVY A;  2R44 A;  4HKZ H;  1IFD A;  2WSC H;  2VLO A;  3V6I A;  2A06 E;  1PP9 E;  1CSB A;  1S5L E;  1EC5 A;  3HE5 B;  4TLF A;  1JMB A;  1KFM A;  2KIK A;  3IAO A;  4D6T E;  2E1M A;  1PPJ D;  3Q2Y A;  2GDY A;  3H1K E;  2EFJ A;  3E1R A;  2GYK A;  2QM7 A;  5AVT B;  2M5A A;  1AF8 A;  5KLV K;  1JEK A;  2VLN A;  3G3Z A;  4WBA A;  1GZL A;  3D6Z A;  1LT9 C;  3D71 A;  2Z45 A;  2WT7 A;  2NPS C;  1LP1 A;  1GTW A;  1H88 A;  3RK2 B;  4COC A;  1L0L E;  4PV1 B;  1PGJ A;  3WU2 H;  2AEJ A;  5HGO A;  4BRY A;  1BCC E;  3EFF K;  3ABV C;  2NO8 A;  4JF7 A;  4NEO A;  1VDF A;  2IYO A;  2KSJ A;  4IL6 X;  1OVR A;  2ZYA A;  1IC2 A;  3Q20 A;  4N3Y B;  2C9N Y;  5KTB A;  3V2P A;  1VQP P;  4GOD A;  3MTU E;  3OAK A;  2XNX A;  3T97 A;  2O01 N;  2ZJS E;  5KLV J;  3L74 E;  1YIT P;  3H4E A;  2OTJ P;  5TIS E;  3M91 A;  3H32 A;  2JGP A;  2LKI A;  5KLV D;  5DCK A;  1YIJ P;  1M6E X;  5DJU B;  1M90 Q;  3GW6 A;  1HF9 A;  3GMA A;  5GTI H;  3B5N A;  3O6Q A;  5APY A;  2IBZ E;  1IFN A;  3GF7 A;  1LT9 A;  1VQN P;  2K0Y A;  2NPS A;  4CPG A;  2OYI C;  5L8R J;  2GUS A;  1N7S B;  1HUC A;  2YIU B;  1OX3 A;  3JCU H;  5CCH D;  4L76 A;  2R3S A;  4R0M A;  4KHX A;  1BE3 J;  2YMY A;  1PFI A;  3JSV C;  1RY3 A;  2E5Y A;  1GK4 A;  3CI9 A;  1BE3 D;  3AEF C;  2K94 A;  2CQ8 A;  2H8P D;  1FZB A;  2KG6 A;  3Q5R A;  1SFC C;  1EQ7 A;  2KGD A;  1EZV D;  4C7R A;  4PJ0 E;  3L72 G;  1U7J A;  3V2N A;  2FYZ A;  2KOQ A;  2WZ7 A;  4Y99 C;  2Y9Z A;  1IO4 A;  3G0V A;  2OTL P;  2QEX P;  3VRL C;  4JQ0 D;  1N8R Q;  2KGA A;  1KIL D;  2R32 A;  1URQ B;  4CA3 A;  2YXQ B;  2CPB A;  1KZU B;  4BXL A;  3HE4 A;  2M8P A;  3OA7 A;  2LXC B;  2B9B A;  2IFM A;  2E5T A;  2N1T B;  1OMI A;  2OYI A;  2OYH B;  1XTG B;  3SSU A;  1PGO A;  1YYC A;  1RE3 C;  2YMK A;  3TGU J;  1PGQ A;  1J1D B;  2FYU K;  2E74 C;  3USS A;  1OW6 A;  1A02 F;  5KKZ B;  3TGU D;  2QJP C;  1Q7Y Q;  2BEZ F;  4N78 D;  4XRQ A;  3H1J E;  5CCG D;  2GDW A;  3H1H G;  2LF4 A;  1SFC A;  2AVA A;  1YQ4 C;  2H7H A;  4UB8 H;  1NU1 K;  2GM4 A;  4W80 A;  3BCC G;  4H13 C;  2E42 A;  2FVF A;  3GJN A;  3G6E P;  3H1I E;  2FYU J;  4WB4 A;  2HYN A;  2CK3 H;  3GHG B;  2XV6 A;  1JTH B;  2Y0C A;  1VQO P;  4H13 D;  4RKU J;  1PP9 G;  2K9Y A;  3WMM 0;  3P7K A; 
#chains in the Genus database with same CATH homology
 1RO2 A;  3DS3 A;  1D1D A;  5JPA A;  3CCM P;  2EFJ A;  2BHV A;  3DS4 A;  2QA4 P;  4QNB A;  1K73 Q;  3G4S P;  3CCV P;  1KD1 Q;  1Q86 Q;  1YJN P;  3RG6 C;  4XRO A;  4WYM A;  3HZQ A;  4IPY A;  4PH0 A;  1IUQ A;  3CC4 P;  2PEK A;  3CC7 P;  3DS2 A;  3G1I A;  4U0B A;  3CC2 P;  4PH1 A;  1VQK P;  1VQ5 P;  3P05 A;  5HGM A;  3MGE A;  2Z45 A;  3CD6 P;  1Q82 Q;  3G0V A;  2OTL P;  5BS2 A;  2QEX P;  4XFY A;  4U0C A;  3VRL C;  1ZMB A;  2DGY A;  3G1G A;  1JJ2 O;  3DS5 A;  4COC A;  1N8R Q;  1K9M Q;  3CCE P;  3DPH A;  3E2D A;  2XT1 A;  2M8N A;  2M8L A;  3CCQ P;  1VQL P;  2ONT A;  5HGO A;  1KQS O;  5F2O A;  3OW2 O;  2PEQ A;  2Z44 A;  2PEN A;  5HGL A;  2M8P A;  4U0D A;  1VQM P;  1QVG O;  2PEJ A;  3DS0 A;  2Z46 A;  3CCU P;  4U0A A;  1VQ4 P;  2BQ1 E;  1Q81 Q;  2JYG A;  1NJI Q;  1M74 A;  2KOD A;  3H47 A;  3Q20 A;  1VQ7 P;  3CXC O;  1VQ8 P;  1A8O A;  3G26 A;  3CCR P;  1VQP P;  1EIA A;  1PEQ A;  2P9X A;  3H0D A;  4GR2 A;  3NTE A;  1Q7Y Q;  1YIT P;  3H4E A;  2OTJ P;  1W2B O;  1PEM A;  1YJW P;  2JYL A;  1YHQ P;  1S72 P;  4XRQ A;  1QVF O;  1YJ9 P;  3G71 P;  5DCK A;  1BAJ A;  1YIJ P;  3G21 A;  2CWO A;  4U0F A;  2LF4 A;  2PY8 A;  2PEO A;  1M6E X;  1E6J P;  3G28 A;  5BS1 A;  1M90 Q;  1VQ9 P;  1M6N A;  3CCL P;  1EOQ A;  4U0E A;  1QRJ A;  1RNI A;  3B5I A;  1AUM A;  1VQ6 P;  3G29 A;  2EG5 A;  3LRY A;  1K30 A;  3DTJ A;  4XFX A;  5F2K A;  2XXM A;  3DS1 A;  3CME P;  4COP A;  3WBH A;  3CMA P;  3I55 P;  1M1K Q;  1VQN P;  4M0I A;  3G6E P;  2PEI A;  3I56 P;  2JO0 A;  2BUO A;  1RO0 A;  1PEU A;  2OAR A;  1PEO A;  5I4T G;  2PEM A;  4GR6 A;  2XV6 A;  1KC8 Q;  4XFZ A;  1VQO P;  1YI2 P;  3CCJ P;  2L6E A;  5HGN A;  2E1M A;  2EIA A;  3CCS P;  3M1M A;  5F2N A;  3HYB A;  1K8A Q;  1A43 A;  3CPW O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...