2QA4P

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2qa4P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 2qa4P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 2qa4P02
1YIJP 3CC7P 1K73Q 1KQSO 1JJ2O 3CCUP 1S72P 1N8RQ 2QEXP 1VQPP 1W2BO 1VQ8P 1VQ5P 1VQKP 2QA4P 3CD6P 3CC4P 3CCMP 1Q86Q 1VQ4P 1K8AQ 1VQ7P 1YHQP 3G4SP 3G6EP 3CXCO 3CMAP 1M1KQ 3OW2O 3CCRP 3I55P 3G71P 1YJNP 1VQLP 2OTLP 1YJWP 3CCVP 3CCEP 1VQNP 1VQOP 3CPWO 1M90Q 3CC2P 1KC8Q 1VQ6P 1KD1Q 1VQ9P 3CCQP 1YI2P 1Q82Q 1NJIQ 1VQMP 1Q81Q 1QVFO 3CCJP 1YITP 3CMEP 2OTJP 1Q7YQ 3CCSP 1YJ9P 3I56P 1K9MQ 3CCLP 1QVGO
chains in the Genus database with same CATH superfamily
5AW8B 3TSIA 5E79H 5KLVJ 5KLVE 2EHTA 2IDBA 4W80A 3G6EP 1KQLA 1PGPA 2E5YA 1L0NG 2D2CB 2OGUA 1WT6A 2W6BA 2M5AA 4YTPC 1MUUA 2LTEA 3H1LG 5AW5B 4U0AA 4L76A 3UIAA 1LTGC 3EJEA 2BASA 3V2NA 2E74B 1L0NJ 1L0NE 1FC2C 3O6QA 1SQPK 3D6ZA 1RF0C 3MD0A 1URQC 3H1LJ 3H1LE 3A0BE 1K05A 2KOSA 3P8CD 3TDKA 3KDPB 3BCCG 4UB8E 2PEKA 1KTMA 1NTZK 3L72J 3MZWB 1GD2E 1OR5A 1GW4A 1LWUA 4OGQB 1T2KD 2IFNA 1N73C 1OW6A 4IPYA 1X0TA 2KODA 2KGCA 3HUSA 1M1JA 3H1KD 5CCGA 4WY4C 2Q1KA 3RG6C 1W2BO 1KB9D 3H6PA 2Q3EA 3BCCJ 2L4BA 5AVTB 3BCCE 4H13B 2LF4A 2K2QA 1ZW0A 1IK9A 2N1TA 1AJYA 2I1JA 1NU1D 2MVVA 1JY3P 2K94A 3M9QA 1BE3G 4I6MC 4IOIH 1PP9G 4WB4A 2KK7A 2NO8A 1QVGO 3L73G 2O1JA 2EHSA 2QA4P 4U0BA 1FZBA 1IMQA 2FAEA 1A43A 1L0IA 1SFCB 1BE3J 1T3JA 2XXMA 4WWIA 2K3RA 1BE3E 1PP9J 1OWAA 1PP9E 1FDMA 2A06G 2E75D 3CLQA 2QJYB 1BDCA 1S72P 2G3AA 2L91A 3HE4A 1RO2A 2PENA 5GTIE 1YHQP 5KAIH 1GU5A 2AFDA 1ZRTD 5APVA 1LTSC 2ERHA 5APYA 2KZJA 1VDFA 2QG4A 1J2JB 3G0VA 3K5BA 2A06E 3M9HA 5APTA 1JY3N 2YNYA 2N50A 2V4HA 3AEEC 1ZOYC 2JR8A 1SQVD 3MUDC 2AF8A 5CZDB 2P67A 1NTKD 3JCUE 5BVZA 2OYHA 2KOQA 1CEIA 3GG2A 1RQUA 1D1DA 2QEXP 4AQRD 2WPSA 1NVOA 3V2RA 1OVRA 4C7RA 3RL0B 2PEOA 4K3AA 2WZ7A 3B4QA 4Y99C 1L4AD 3KZIH 1VHNA 5B66H 2K0XA 3A0HE 4JYCA 4HH2A 3T97A 3AE1C 2EIAA 3F5HA 4EI2A 2L9FA 3CX5H 4EYYQ 2D2CD 3TGUD 4B86A 2H7HA 1GPJA 3V6IA 2E42A 3E1IA 1K30A 3W68A 1MZ8A 4IZ6A 5HGOA 2QJKC 2E74D 3H0DA 1FJKA 1ZLLA 3U1CA 1OW7A 3ABVC 1P84H 2N6YA 2NPSB 2FYUD 4RKUJ 3FX0A 4NEOA 1FDOA 3AEAC 5KLVD 2YKQA 2KOGA 2QE7H 1JEKA 2JU1A 2LOLA 2PNGA 1GL2B 3GF3A 3DS2A 3AE8C 2WTYA 1SQXK 1VQOP 1Z6MA 3DS3A 5AW6B 2KLVA 1NTMK 3NMDA 1RE4A 2P2UA 3H47A 4UB6H 1IFMA 1SFCC 1EDJA 2QIWA 3Q5PA 1NO4A 1L0ND 1VKUA 2IBZI 1S5LX 3L75G 3CCVP 4L73A 5CCHC 2V7QJ 3MP7B 3H1LD 2Q3IA 4YXDC 3RBXA 2BHVA 3H32A 4DJGA 2KORA 4IL6H 3HD7C 1MFZA 3VYIA 2HLOA 1JY2P 2K9JB 4OH8B 2LR2A 4OWFA 4CPGA 5BS1A 3L75J 1M6NA 3L75E 1RO0A 1N7LA 2YXRB 1RNIA 3AE9C 3LIEA 1OFCX 1UJZA 2YO3A 2XV5A 3L36A 5F2KA 1VF5C 2RH0A 1KQSO 3V2QA 3BCCD 2KOPA 1PGJA 1G1IA 1L0LJ 1OW8A 1WRGA 1L0LE 3W67A 2Y9ZA 1RH5B 3N4XA 3P8CE 3SFDC 1JY2O 1KLPA 3VMXA 2W6AA 1AVOA 2KSJA 3FWNA 3C8VA 2DNWA 3RL0C 3L74G 2FFDC 4Z1MH 1EDKA 5EJDA 4C46A 1R5SA 5EFWB 1BCCG 1H0TA 3M0DA 3RK3E 3Q3DA 1KB9E 5KP8B 1PFIA 1BE3D 4EIJA 1HTLC 2GZEA 1YI2P 2XZ1C 1PP9D 2NRGA 1L4AA 1JY2N 5AVWB 3CMEP 3L73D 3L74J 1LGHB 3L74E 2CPBA 3AE7C 3PH0A 1Z56A 1JJ2O 5KLIC 2RKLA 2KIKA 1BCCE 4DOJA 2WPRA 4HJGH 5KJ7A 3CCEP 2POHA 3HTKB 1JCCA 1FZGA 1DD4A 2M5RA 1IO4A 1G2CA 4GR6A 2A06D 2WVRA 4HB1A 1NTKK 1YIJP 4JPZB 2QSIA 2A45G 2FBWC 2R5DA 3HUSC 1VQ4P 1M1JC 4PD4H 3LMOA 2ROQA 2XNXA 1MZ9A 2ZT9C 2H43A 2ZJSE 1URQB 2WT7A 3BVHA 3KZIE 3AEDC 2KLUA 3PTZA 1IJDB 3BRTB 1T8KA 3CX5E 4Y28J 1N73B 1SVFA 2WPTA 1YJNP 1NKZB 3KXDA 1SQBG 4WY4B 5AVYB 2VRSA 3A7OA 2PP6A 4COCA 3F89A 3DTJA 3E2DA 1DIPA 4H2WC 2KS1B 3G4SP 1RHZB 2P1JA 4JBZA 3G71P 5GTHH 1LP1B 4GODA 3M91A 2AEJA 2WSEH 2MR7A 3SWFA 1SQBE 2GDXA 4IFDK 3LRYA 1JUNA 1KV4A 3RBZA 2E1MA 5BS2A 1VQPP 4XFJA 3CE7A 2WWWA 1QEXA 2M8NA 3B5NA 1AYIA 1ACPA 1ZN5A 1QX8A 1KQFB 3RGUA 3TGUJ 1A02F 2FQ2A 2BEQD 2JWDA 5C39A 4LGDE 1AUMA 2QNWA 3KHUA 1FJPA 3CXHE 3P05A 3JSVC 1T6AA 4KJMA 2PGDA 2OYIB 4AUWA 1ZR2A 3P8MC 4XFZA 4DG9A 4GR2A 1Y9BA 3EJDA 2EFJA 3V4QA 1AVYA 3MGEA 1JB0J 3H1JG 1S5LE 2JO1A 2MVUA 1R5LA 1KYOE 2HG5D 2PEMA 1RF1A 3PJSK 2AVAA 2O3JA 3FXEA 2GA1A 4ZNCA 5KKZC 3VMYA 4PH1A 2R32A 1M7LA 2YMYA 3QH9A 3VP8A 3L75D 2L0QA 1VQ7P 2R5BA 1FAVA 3H1JJ 3HE5B 2O01H 3CMAP 2JGPA 3H1JE 1T3UA 1IFDA 4Y99B 1YJWP 4N6JA 2Q7CA 2IYOA 1NH4A 3DS4A 2HPCB 1LTJA 3G21A 3GLMA 3C1LA 1T2KC 1L0LD 1MFTA 1NKNA 2KUBA 2M0BA 2YKPA 1KN7A 2XU6A 4KT0J 2BCCG 5CMZA 3DS0A 1GW3A 4OVNF 2WPVB 2KG8A 3L70G 1LT9A 1RE3A 1YJ9P 3A3YB 2JEEA 3B4SA 2QJKB 1GDTA 1S3JA 3A2AA 4W7YA 1RE4C 1EIAA 3RK3D 2BCCJ 2BCCE 2KNCA 1SQPG 3BRVB 2WSCJ 2HODB 3E7KA 1URQD 3L70J 3L70E 3L74D 1EDIA 4GIFA 2OYOA 2KYVA 1SQQK 1BCCD 2ZFCA 1NTZG 2W8ZA 5HGLA 1L2PA 3C9IA 5I4TG 2VLOA 1SQPE 2KSEA 2XV6A 3DS1A 1DV5A 1DX7A 1CI6A 3Q1MA 2B89A 2Y0EA 4WY4D 4DZOA 3M06A 4CA3A 3PP5A 1JY3O 3L73J 3L73E 1H89A 1KB9I 2KGDA 1NTZE 1Q86Q 4PV1C 3D71A 5JPAA 3H4EA 3VOPA 2B87A 3TK1A 1L0HA 3Q5RA 4RJTA 1IFPA 3HD7B 2OYIC 1X8YA 1K9MQ 3CX5D 1N7SA 3VP9A 1KQGB 1EDLA 2LKIA 3D6YA 3CXCO 2LL8A 1ZXGA 4H0LD 1BAJA 4C7NA 1AF8A 1KILC 2IPPA 1VF5B 3P7KA 2AXTH 3AEFC 2VSQA 5F2NA 2FQ0A 1BGYG 1DH3A 4D6TG 2CNRA 1VQKP 3VMAA 3B8EB 3OJAB 1PGQA 1NYHA 1QGKB 3EQ2A 3NXSA 4PXHB 2YIUC 1AV1A 3NFQA 1SQBD 4H44C 1MV8A 3G26A 2FFDB 1S9KE 3GKLC 5TISH 2M5AB 1X22A 5KJ7C 1EZVG 2K92A 4HKGA 4D6TJ 1BGYE 3LIDA 4D6TE 2JU2A 3SSUA 4DT0A 3CCMP 5M1BA 3V2PA 3G28A 1CW5A 3PHLA 2JYLA 1FZFA 5KLIB 2J59M 1EZVE 2K0DX 2MD9A 3CXHD 5E79E 2E5TA 1M6EX 3EJBA 1RQVA 5AW3B 4ASVA 3HTKA 1HY8A 2Q5UA 1W2EA 2W90A 2FHSC 1R8EA 1QL2A 4LC1A 3TYYA 1NJIQ 3MTUE 3RK2C 2N9BA 1JMBA 1HGVA 2FADA 2HYNA 2PFXA 2XKMA 4I7ZC 2N5HA 3VTPC 2KZIA 3HUSB 1M1JB 2H8PD 1K73Q 3TNUA 4XFXA 2ZT9B 2GZFA 3BASA 2ZAEB 4NPEA 2H89C 2JWAA 4BPGA 1NAFA 3NTNA 1IK7A 4ZMDA 4BRYA 2WSFH 2FQ1A 1RF0A 3OW2O 3AECC 1KYOD 2N1TB 2Q6QA 2X2BA 2B88A 1D7MA 4OGQD 2LIWA 3M1MA 3CXHI 3WMM0 2YKOA 4IL6X 3RL0g 3CCUP 1M56D 4WVZA 3GMAA 1PEMA 3H1JD 4BPFA 3AE2C 2ZVNB 3IFMA 1N73A 3AEBC 4H13D 1X9VA 3S4RA 1L0LK 5KAFH 3LW5H 1M90Q 4U7JA 4U0EA 3WBHA 5CBNA 3B5NC 1OXZA 2OTJP 4UHPB 1VL2A 4ZKPA 3GHGA 3V4WA 1YQ3C 2PEIA 2XNDH 1SQXG 3H1IG 2Z46A 3HE4B 1KYOI 2IFMA 3H1HG 1U7MA 1NTMG 7CEIA 2JDIH 2FVFA 3OA7A 1SFCD 1Q81Q 3NTEA 1LT1A 1RY3A 1GXGA 1GU4A 5B5EH 4ASWA 1VQ9P 2QM7A 1NU1K 1HVVA 5AVVB 3TF5A 1M74A 2BCCD 1SQXJ 3H1IJ 2GDWA 1SQXE 3H1IE 5CCHD 3H1HJ 5HGNA 1NTMJ 3H1HE 3L70D 1NTME 1HUCA 1VQNP 2CQ8A 1HJBA 2OYHB 2AEFA 1JTHA 3HD7D 2QVAA 4PD4D 2IZ0A 4JQ0D 5APQA 1IC2A 1NAYA 1VQ5P 2RMZA 2QRXA 1SQPD 2P10A 2IX7C 5KAIE 4O9BA 1EXIA 1AFOA 2WSSH 3VN0A 2Z44A 4JYBA 3WUVA 4W7ZA 1XTGB 1VF5D 1PPJG 4COPA 2ZYDA 1FZCA 1NTZD 3MUDA 2M8RA 4YPCA 2CGQA 1BCCJ 4IFMA 3T97B 3WU2H 2YMKA 4UB8H 2W27A 2KR5A 1OVUA 3RL0D 5KKZB 4U0CA 1S2EA 2Q9IA 1PPJE 1SQVK 3Q5SA 1YQ4C 2Z45A 2E76C 2FY8A 3AE6C 1LWUC 1HH0A 1E6JP 1RE3C 1Y47A 2KI7B 3ZDMA 3G29A 1CZQA 5CCGC 2K1AA 2E43A 3B5IA 1VPCA 1LTTC 2MR8A 2QJPC 3KYQA 2FVEA 5DCKA 4U3FG 2N1TC 2L6EA 5B66E 3U59A 1OVVA 2SPZA 4HYTB 4HKZH 2I1KA 1S9KD 3GJNA 4GDOA 2Y0DA 3MIWA 2NPSD 4NPFX 3HZQA 3SFEC 1KFMA 1BGYD 4D6TD 2LKMA 4U3FE 3BATA 3NY7B 5AW0B 2IYPA 2ZT9D 3CI9A 3U1AA 2R3CA 1GL2D 1YBKA 2GZIA 1LJ2A 1P84E 1HF9A 3G1GA 1EZVD 2GUVA 1SQBJ 1JMMA 3R2PA 1JNMA 4R4MA 2FYUK 1KMIZ 1ZMEC 2BUOA 1A02J 5KLVK 1N7SC 1M57D 3E1RA 1KILE 3V5BA 5APWA 1SFCA 2M3EA 1KORA 4UB6E 3JCUH 1PZQA 2M8PA 1GK4A 4K35A 2DW3A 3R4YA 3JC22 1J1DC 1FOSF 2PEQA 3CCLP 2JKVA 4PV1B 1FBMA 2O1KA 2OYHC 2C9NY 5AW7B 1BSNA 1FU1A 2FXMA 2OQQA 2ITAA 5CCHA 3LW5J 3FXDA 4XA4A 4R4LA 1BDDA 1GMJA 2VLPA 1N2DC 3PRJA 1XTCC 2GUSA 1L0NK 2IBZG 2XDJA 2K0YA 1GXHA 3MGNA 2FXPA 1E79H 2KGAA 1T8ZA 5APXA 4IL6E 3GZMA 1S4XA 3CWBG 1PV3A 5AVQB 1N8RQ 5F2OA 1H88A 1NOHA 3CC4P 2CWOA 1JOCA 1FZAA 1KILB 2FVAA 2Z5HA 3A0HH 1H0TB 4TT3H 2KW2A 3P32A 2EG5A 1YTZI 2N5IA 5B5EE 3B71A 3GW6A 2IBZE 1TU3F 3L71G 3G9RA 3CWBJ 2YO2A 4LLHA 3CWBE 2K9YA 2YIUB 3I5CA 2JB0A 4H44B 4PJ0H 4BWNA 1IFJA 2C9LY 2PEJA 2W83C 2FFDA 1G2CB 1LTIC 4MRTC 4PWVB 3L71J 2AEMA 3CL3D 3L71E 1SQXD 3H1ID 1UNKA 4XROA 2MKVA 1YYCA 1IFIA 3H1HD 1NTMD 3L72G 1USEA 3RK3C 5HGMA 5EW5E 2WT7B 1KD1Q 1Q82Q 5AVXB 3OAKA 1BSHA 2O01N 4QKOA 2C0XA 2K88A 3GZLA 1EQ7A 1LTBC 1HJ0A 5AW2B 3WU2E 4JF7A 3AEGC 3HRNA 2JYGA 3RK2B 3L72E 1PL5A 4I7ZB 1DD3A 2NPSA 1Y8AA 1AQTA 5KTBA 1YITP 2Z5IA 4NPDA 2V7QH 1VQ8P 2ZXEB 4GKGA 2JP3A 2L5GB 3EFFK 4GT1A 4PD4E 1GL2A 5AW4B 2E75C 3GHGC 2PAJA 2W6JH 3G1IA 1SQPJ 4PH0A 1PPJD 2GZGA 1JO5A 1EOQA 1J1EC 2UWJE 1S1CX 3S9OA 2LXBA 1H8AA 2GZJA 3FGAD 5APUA 1NTZJ 1EMVA 1OX3A 2CPSA 3B5NB 3L35A 3IF4A 2LPKA 4H0LC 5BU8B 4RO0A 2P9XA 1SQQG 2ZXXA 1ZR4A 3CC7P 3WUTA 5DJTB 2JBGA 2K9JA 5GTHE 2WSEJ 1FR2A 1WMKA 3CCRP 3IAOA 1JCDA 3D70A 1KB9H 1VQ6P 1SLQA 2MJZA 1E5WA 4U3FD 1SQQJ 1N86A 3M0DC 2N9YB 1SQQE 1FZEA 4PV1D 1DEEG 1L4AC 1ZV8A 4BXLA 1P84D 1FZCC 4TLFA 4YXWH 1CSBA 5L8RJ 4XFYA 1M1KQ 2FYNB 1KC8Q 1RF1B 2D2CC 1MKMA 4N78E 2A45I 3Q2YA 3CX5I 2R3SA 1BGYJ 3VRLC 3L4FA 2MY5A 3SWKA 3A5TA 1KILD 2KP8A 5CHXA 1LNQA 1NWQA 1QRJA 3O6QB 4GOFA 2E74C 1K04A 2FKWB 1LTJB 1OMIA 3AE4C 3DS5A 1P84I 3SWYA 4DCKA 2GM4A 4H44D 3CD6P 3ITKA 2A45H 2E76B 5KJ7D 2AXCA 2XT1A 4EOTA 3O8ZA 1ZP0C 1LT9B 1LWUB 5APSA 3DPHA 2QM8A 4OGQC 2KG6A 2XZRA 4PJ0E 4M3LA 4H2XC 5HVCA 1FS0E 2O01J 2DGYA 2KG9A 2J5UA 4KHXA 2QJPB 2M3BA 2I8DA 4IFFA 2KNCB 2IBZD 5CJ4A 1URQA 2WMMA 3HYBA 1YTZT 4H13C 4M0IA 2Z4EA 2WQYC 3CWBD 1HGZA 2NZ2A 2N98A 4XRQA 1M8OB 3VMZA 3MHVA 4I1LA 3RK2D 3PLNA 4BPHA 2LMLA 3H25A 1CI6B 4WBAA 3L71D 2JQ4A 4L74A 3CCJP 3AE5C 4WY4A 1JM0A 2GDYA 1Q7YQ 4F37A 2PRRA 2WITA 5H2FH 5TJHA 4L75A 2G8YA 2KGEA 3CXHH 2KS1A 3N7NA 2QJYC 1IFNA 1E0HA 1LP1A 5HV8A 2B87B 2RN0A 2OARA 1AQ5A 2YXQB 1U7JA 3M0AA 1BXIA 1HBWA 2ZYAA 1ZMBA 1Q90D 1IUQA 1N7SB 3S1KA 3L72D 1L0LG 3G3ZA 4ZKUA 3B5ND 1VQLP 4R0MA 1J1DB 2KXPB 5KP7B 1S5LH 1HQBA 2JJLA 4C7NB 2K5XA 5AVSB 2GYKA 4U0FA 1KYOH 2FYNC 3I56P 2CG5B 1FE6A 2KWLA 3II6A 3H1KG 1RF1C 5CBOA 2L22A 2P58A 3WUUA 5AVRB 2OYIA 4U0DA 2OTLP 4QNBA 1LTAC 3AE3C 2LXCB 1U57A 1A8OA 1NU1G 2VLNA 1AA0A 2M8LA 1PEOA 4I2LC 2XZ0D 2H88C 1G1JA 3M9BA 3H1KJ 3GF7A 3H1KE 1KILA 1LTJC 2KB7P 3A0BH 3Q20A 2PY8A 1PIXA 1KFNA 2K93A 2B9BA 2VLQA 2AXTE 4A7PA 1NU1J 2HR3A 1NU1E 2C0WA 2Y9YA 4PD4I 5AVUB 1UIXA 2BEZF 3EFGA 2OTKE 4WYMA 2LIUA 2R44A 1LT9C 2ZVOB 2MF4A 1PGOA 3HE5A 1SP4A 5TISE 1Q2NA 1KZUB 1SQQD 3EWKA 1VQMP 2WSCH 1PEUA 2HPCA 3L37A 3U43A 2JO0A 1SQBK 4EDFA 2NPSC 3TNUB 3RK3B 4AYCA 2J58A 1K8AQ 4BRYB 3FWLA 1OIPA 1EC5A 2E76D 1SQVG 4H2YC 1GL2C 5DJUB 1UIIA 3KQGA 4N78D 1QVFO 1NTKG 1IZNB 1IMPA 1QLED 3IR9A 4RESB 1ZRTE 4U3FJ 5KP6B 5AW9B 1PEQA 5CCGD 1HWTC 2P7JA 1ZNVA 1DEBA 1W5CE 1X3OA 1SQVJ 4XE5B 5GTIH 2HODA 1SQVE 2N1TD 1FDIA 1QL1A 1NTKJ 1NTKE 3USSA 2JAZA 2E75B 3GHGB 3H32B 5K5GB 2WSFJ 2K37A 2CK3H 1J1EB 1FOSE 2ONTA 2FYZA 2WPQA 3TGUG 1USDA 2Y0CA 3CCSP 2N6ZA 1DNYA 1OZHA 4N3YB 5AVZB 3KPEA 1EXJA 1GK6A 2AFEA 5KAFE 4H0LB 3I55P 1SS1A 2FXOA 1NHLA 3CC2P 1EZVI 3TGUE 1GTWA 2KOOA 1JTHB 3HD7A 5H2FE 2FYUG 1X79B 5BU5A 4MN4C 3QWOC 1N7SD 2ZYGA 5KLVG 5CJ0A 3RG2A 4QMAA 1F80D 3CPWO 1NQ4A 3CCQP 5AW1B 1NGMB 1GZLA 1L4AB 2FYUJ 4GOEA 2HFED 2FYUE 2BQ1E 3IN6A 2FACA 1FZCB 2IZ1A
chains in the Genus database with same CATH topology
1YIJP 3CC7P 3CCUP 1EIAA 4XROA 2DGYA 1VQKP 1PEMA 3P05A 2QA4P 4U0BA 2BUOA 1VQ4P 2EIAA 3G6EP 5BS1A 1M6NA 4U0DA 3CCRP 2OTLP 5HGMA 1RO0A 1A43A 4QNBA 1M90Q 1VQ6P 4U0CA 3G26A 3HYBA 4XFZA 1RNIA 1Q82Q 1KD1Q 2XXMA 4U0EA 4M0IA 1A8OA 3WBHA 2M8PA 2M8LA 2Z45A 2OTJP 4GR2A 1PEOA 2PEQA 5F2KA 3CCLP 4U0AA 4XRQA 1KQSO 2PEIA 1S72P 1K30A 1E6JP 2EFJA 5HGOA 2Z46A 5HGLA 3CCMP 1RO2A 2JYGA 2PENA 3MGEA 5I4TG 1YHQP 3G29A 3G28A 3H0DA 4XFYA 3Q20A 2PY8A 1M1KQ 3B5IA 1YJNP 2ONTA 2JYLA 2XV6A 3DS1A 1KC8Q 1Q81Q 3NTEA 2PEMA 3CCJP 1YITP 5DCKA 1Q7YQ 3CCSP 3G0VA 1VQ8P 1VQ9P 2L6EA 4WYMA 4COCA 1M74A 3VRLC 3DTJA 1N8RQ 5F2OA 4PH1A 1M6EX 3E2DA 3CC4P 2CWOA 2PEKA 3DS2A 1Q86Q 1VQ7P 5JPAA 3G4SP 3H4EA 3CMAP 5HGNA 3G1IA 3I55P 3G71P 4PH0A 1YJWP 1VQNP 1VQOP 2EG5A 3CC2P 3DS3A 1EOQA 1YI2P 1NJIQ 1QRJA 2OARA 1VQMP 3HZQA 1PEUA 3DS4A 3CMEP 3H47A 4IPYA 3LRYA 3G21A 2JO0A 2KODA 1K9MQ 1ZMBA 1K73Q 3DS5A 4XFXA 1JJ2O 1IUQA 1D1DA 2QEXP 2E1MA 5BS2A 1VQPP 3RG6C 1W2BO 1VQ5P 3CD6P 1K8AQ 2M8NA 2LF4A 3CXCO 3DS0A 2Z44A 3OW2O 2PEJA 1VQLP 3CCEP 3CCVP 3CPWO 1BAJA 3G1GA 2XT1A 3CCQP 2PEOA 1QVFO 4COPA 4GR6A 3M1MA 3DPHA 2P9XA 4U0FA 5F2NA 1YJ9P 2BQ1E 3I56P 1AUMA 2BHVA 1QVGO 1PEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ P;  3CC7 P;  1K73 Q;  1KQS O;  1JJ2 O;  3CCU P;  1S72 P;  1N8R Q;  2QEX P;  1VQP P;  1W2B O;  1VQ8 P;  1VQ5 P;  1VQK P;  2QA4 P;  3CD6 P;  3CC4 P;  3CCM P;  1Q86 Q;  1VQ4 P;  1K8A Q;  1VQ7 P;  1YHQ P;  3G4S P;  3G6E P;  3CXC O;  3CMA P;  1M1K Q;  3OW2 O;  3CCR P;  3I55 P;  3G71 P;  1YJN P;  1VQL P;  2OTL P;  1YJW P;  3CCV P;  3CCE P;  1VQN P;  1VQO P;  3CPW O;  1M90 Q;  3CC2 P;  1KC8 Q;  1VQ6 P;  1KD1 Q;  1VQ9 P;  3CCQ P;  1YI2 P;  1Q82 Q;  1NJI Q;  1VQM P;  1Q81 Q;  1QVF O;  3CCJ P;  1YIT P;  3CME P;  2OTJ P;  1Q7Y Q;  3CCS P;  1YJ9 P;  3I56 P;  1K9M Q;  3CCL P;  1QVG O; 
#chains in the Genus database with same CATH topology
 5AW8 B;  3TSI A;  5E79 H;  5KLV J;  5KLV E;  2EHT A;  2IDB A;  4W80 A;  3G6E P;  1KQL A;  1PGP A;  2E5Y A;  1L0N G;  2D2C B;  2OGU A;  1WT6 A;  2W6B A;  2M5A A;  4YTP C;  1MUU A;  2LTE A;  3H1L G;  5AW5 B;  4U0A A;  4L76 A;  3UIA A;  1LTG C;  3EJE A;  2BAS A;  3V2N A;  2E74 B;  1L0N J;  1L0N E;  1FC2 C;  3O6Q A;  1SQP K;  3D6Z A;  1RF0 C;  3MD0 A;  1URQ C;  3H1L J;  3H1L E;  3A0B E;  1K05 A;  2KOS A;  3P8C D;  3TDK A;  3KDP B;  3BCC G;  4UB8 E;  2PEK A;  1KTM A;  1NTZ K;  3L72 J;  3MZW B;  1GD2 E;  1OR5 A;  1GW4 A;  1LWU A;  4OGQ B;  1T2K D;  2IFN A;  1N73 C;  1OW6 A;  4IPY A;  1X0T A;  2KOD A;  2KGC A;  3HUS A;  1M1J A;  3H1K D;  5CCG A;  4WY4 C;  2Q1K A;  3RG6 C;  1W2B O;  1KB9 D;  3H6P A;  2Q3E A;  3BCC J;  2L4B A;  5AVT B;  3BCC E;  4H13 B;  2LF4 A;  2K2Q A;  1ZW0 A;  1IK9 A;  2N1T A;  1AJY A;  2I1J A;  1NU1 D;  2MVV A;  1JY3 P;  2K94 A;  3M9Q A;  1BE3 G;  4I6M C;  4IOI H;  1PP9 G;  4WB4 A;  2KK7 A;  2NO8 A;  1QVG O;  3L73 G;  2O1J A;  2EHS A;  2QA4 P;  4U0B A;  1FZB A;  1IMQ A;  2FAE A;  1A43 A;  1L0I A;  1SFC B;  1BE3 J;  1T3J A;  2XXM A;  4WWI A;  2K3R A;  1BE3 E;  1PP9 J;  1OWA A;  1PP9 E;  1FDM A;  2A06 G;  2E75 D;  3CLQ A;  2QJY B;  1BDC A;  1S72 P;  2G3A A;  2L91 A;  3HE4 A;  1RO2 A;  2PEN A;  5GTI E;  1YHQ P;  5KAI H;  1GU5 A;  2AFD A;  1ZRT D;  5APV A;  1LTS C;  2ERH A;  5APY A;  2KZJ A;  1VDF A;  2QG4 A;  1J2J B;  3G0V A;  3K5B A;  2A06 E;  3M9H A;  5APT A;  1JY3 N;  2YNY A;  2N50 A;  2V4H A;  3AEE C;  1ZOY C;  2JR8 A;  1SQV D;  3MUD C;  2AF8 A;  5CZD B;  2P67 A;  1NTK D;  3JCU E;  5BVZ A;  2OYH A;  2KOQ A;  1CEI A;  3GG2 A;  1RQU A;  1D1D A;  2QEX P;  4AQR D;  2WPS A;  1NVO A;  3V2R A;  1OVR A;  4C7R A;  3RL0 B;  2PEO A;  4K3A A;  2WZ7 A;  3B4Q A;  4Y99 C;  1L4A D;  3KZI H;  1VHN A;  5B66 H;  2K0X A;  3A0H E;  4JYC A;  4HH2 A;  3T97 A;  3AE1 C;  2EIA A;  3F5H A;  4EI2 A;  2L9F A;  3CX5 H;  4EYY Q;  2D2C D;  3TGU D;  4B86 A;  2H7H A;  1GPJ A;  3V6I A;  2E42 A;  3E1I A;  1K30 A;  3W68 A;  1MZ8 A;  4IZ6 A;  5HGO A;  2QJK C;  2E74 D;  3H0D A;  1FJK A;  1ZLL A;  3U1C A;  1OW7 A;  3ABV C;  1P84 H;  2N6Y A;  2NPS B;  2FYU D;  4RKU J;  3FX0 A;  4NEO A;  1FDO A;  3AEA C;  5KLV D;  2YKQ A;  2KOG A;  2QE7 H;  1JEK A;  2JU1 A;  2LOL A;  2PNG A;  1GL2 B;  3GF3 A;  3DS2 A;  3AE8 C;  2WTY A;  1SQX K;  1VQO P;  1Z6M A;  3DS3 A;  5AW6 B;  2KLV A;  1NTM K;  3NMD A;  1RE4 A;  2P2U A;  3H47 A;  4UB6 H;  1IFM A;  1SFC C;  1EDJ A;  2QIW A;  3Q5P A;  1NO4 A;  1L0N D;  1VKU A;  2IBZ I;  1S5L X;  3L75 G;  3CCV P;  4L73 A;  5CCH C;  2V7Q J;  3MP7 B;  3H1L D;  2Q3I A;  4YXD C;  3RBX A;  2BHV A;  3H32 A;  4DJG A;  2KOR A;  4IL6 H;  3HD7 C;  1MFZ A;  3VYI A;  2HLO A;  1JY2 P;  2K9J B;  4OH8 B;  2LR2 A;  4OWF A;  4CPG A;  5BS1 A;  3L75 J;  1M6N A;  3L75 E;  1RO0 A;  1N7L A;  2YXR B;  1RNI A;  3AE9 C;  3LIE A;  1OFC X;  1UJZ A;  2YO3 A;  2XV5 A;  3L36 A;  5F2K A;  1VF5 C;  2RH0 A;  1KQS O;  3V2Q A;  3BCC D;  2KOP A;  1PGJ A;  1G1I A;  1L0L J;  1OW8 A;  1WRG A;  1L0L E;  3W67 A;  2Y9Z A;  1RH5 B;  3N4X A;  3P8C E;  3SFD C;  1JY2 O;  1KLP A;  3VMX A;  2W6A A;  1AVO A;  2KSJ A;  3FWN A;  3C8V A;  2DNW A;  3RL0 C;  3L74 G;  2FFD C;  4Z1M H;  1EDK A;  5EJD A;  4C46 A;  1R5S A;  5EFW B;  1BCC G;  1H0T A;  3M0D A;  3RK3 E;  3Q3D A;  1KB9 E;  5KP8 B;  1PFI A;  1BE3 D;  4EIJ A;  1HTL C;  2GZE A;  1YI2 P;  2XZ1 C;  1PP9 D;  2NRG A;  1L4A A;  1JY2 N;  5AVW B;  3CME P;  3L73 D;  3L74 J;  1LGH B;  3L74 E;  2CPB A;  3AE7 C;  3PH0 A;  1Z56 A;  1JJ2 O;  5KLI C;  2RKL A;  2KIK A;  1BCC E;  4DOJ A;  2WPR A;  4HJG H;  5KJ7 A;  3CCE P;  2POH A;  3HTK B;  1JCC A;  1FZG A;  1DD4 A;  2M5R A;  1IO4 A;  1G2C A;  4GR6 A;  2A06 D;  2WVR A;  4HB1 A;  1NTK K;  1YIJ P;  4JPZ B;  2QSI A;  2A45 G;  2FBW C;  2R5D A;  3HUS C;  1VQ4 P;  1M1J C;  4PD4 H;  3LMO A;  2ROQ A;  2XNX A;  1MZ9 A;  2ZT9 C;  2H43 A;  2ZJS E;  1URQ B;  2WT7 A;  3BVH A;  3KZI E;  3AED C;  2KLU A;  3PTZ A;  1IJD B;  3BRT B;  1T8K A;  3CX5 E;  4Y28 J;  1N73 B;  1SVF A;  2WPT A;  1YJN P;  1NKZ B;  3KXD A;  1SQB G;  4WY4 B;  5AVY B;  2VRS A;  3A7O A;  2PP6 A;  4COC A;  3F89 A;  3DTJ A;  3E2D A;  1DIP A;  4H2W C;  2KS1 B;  3G4S P;  1RHZ B;  2P1J A;  4JBZ A;  3G71 P;  5GTH H;  1LP1 B;  4GOD A;  3M91 A;  2AEJ A;  2WSE H;  2MR7 A;  3SWF A;  1SQB E;  2GDX A;  4IFD K;  3LRY A;  1JUN A;  1KV4 A;  3RBZ A;  2E1M A;  5BS2 A;  1VQP P;  4XFJ A;  3CE7 A;  2WWW A;  1QEX A;  2M8N A;  3B5N A;  1AYI A;  1ACP A;  1ZN5 A;  1QX8 A;  1KQF B;  3RGU A;  3TGU J;  1A02 F;  2FQ2 A;  2BEQ D;  2JWD A;  5C39 A;  4LGD E;  1AUM A;  2QNW A;  3KHU A;  1FJP A;  3CXH E;  3P05 A;  3JSV C;  1T6A A;  4KJM A;  2PGD A;  2OYI B;  4AUW A;  1ZR2 A;  3P8M C;  4XFZ A;  4DG9 A;  4GR2 A;  1Y9B A;  3EJD A;  2EFJ A;  3V4Q A;  1AVY A;  3MGE A;  1JB0 J;  3H1J G;  1S5L E;  2JO1 A;  2MVU A;  1R5L A;  1KYO E;  2HG5 D;  2PEM A;  1RF1 A;  3PJS K;  2AVA A;  2O3J A;  3FXE A;  2GA1 A;  4ZNC A;  5KKZ C;  3VMY A;  4PH1 A;  2R32 A;  1M7L A;  2YMY A;  3QH9 A;  3VP8 A;  3L75 D;  2L0Q A;  1VQ7 P;  2R5B A;  1FAV A;  3H1J J;  3HE5 B;  2O01 H;  3CMA P;  2JGP A;  3H1J E;  1T3U A;  1IFD A;  4Y99 B;  1YJW P;  4N6J A;  2Q7C A;  2IYO A;  1NH4 A;  3DS4 A;  2HPC B;  1LTJ A;  3G21 A;  3GLM A;  3C1L A;  1T2K C;  1L0L D;  1MFT A;  1NKN A;  2KUB A;  2M0B A;  2YKP A;  1KN7 A;  2XU6 A;  4KT0 J;  2BCC G;  5CMZ A;  3DS0 A;  1GW3 A;  4OVN F;  2WPV B;  2KG8 A;  3L70 G;  1LT9 A;  1RE3 A;  1YJ9 P;  3A3Y B;  2JEE A;  3B4S A;  2QJK B;  1GDT A;  1S3J A;  3A2A A;  4W7Y A;  1RE4 C;  1EIA A;  3RK3 D;  2BCC J;  2BCC E;  2KNC A;  1SQP G;  3BRV B;  2WSC J;  2HOD B;  3E7K A;  1URQ D;  3L70 J;  3L70 E;  3L74 D;  1EDI A;  4GIF A;  2OYO A;  2KYV A;  1SQQ K;  1BCC D;  2ZFC A;  1NTZ G;  2W8Z A;  5HGL A;  1L2P A;  3C9I A;  5I4T G;  2VLO A;  1SQP E;  2KSE A;  2XV6 A;  3DS1 A;  1DV5 A;  1DX7 A;  1CI6 A;  3Q1M A;  2B89 A;  2Y0E A;  4WY4 D;  4DZO A;  3M06 A;  4CA3 A;  3PP5 A;  1JY3 O;  3L73 J;  3L73 E;  1H89 A;  1KB9 I;  2KGD A;  1NTZ E;  1Q86 Q;  4PV1 C;  3D71 A;  5JPA A;  3H4E A;  3VOP A;  2B87 A;  3TK1 A;  1L0H A;  3Q5R A;  4RJT A;  1IFP A;  3HD7 B;  2OYI C;  1X8Y A;  1K9M Q;  3CX5 D;  1N7S A;  3VP9 A;  1KQG B;  1EDL A;  2LKI A;  3D6Y A;  3CXC O;  2LL8 A;  1ZXG A;  4H0L D;  1BAJ A;  4C7N A;  1AF8 A;  1KIL C;  2IPP A;  1VF5 B;  3P7K A;  2AXT H;  3AEF C;  2VSQ A;  5F2N A;  2FQ0 A;  1BGY G;  1DH3 A;  4D6T G;  2CNR A;  1VQK P;  3VMA A;  3B8E B;  3OJA B;  1PGQ A;  1NYH A;  1QGK B;  3EQ2 A;  3NXS A;  4PXH B;  2YIU C;  1AV1 A;  3NFQ A;  1SQB D;  4H44 C;  1MV8 A;  3G26 A;  2FFD B;  1S9K E;  3GKL C;  5TIS H;  2M5A B;  1X22 A;  5KJ7 C;  1EZV G;  2K92 A;  4HKG A;  4D6T J;  1BGY E;  3LID A;  4D6T E;  2JU2 A;  3SSU A;  4DT0 A;  3CCM P;  5M1B A;  3V2P A;  3G28 A;  1CW5 A;  3PHL A;  2JYL A;  1FZF A;  5KLI B;  2J59 M;  1EZV E;  2K0D X;  2MD9 A;  3CXH D;  5E79 E;  2E5T A;  1M6E X;  3EJB A;  1RQV A;  5AW3 B;  4ASV A;  3HTK A;  1HY8 A;  2Q5U A;  1W2E A;  2W90 A;  2FHS C;  1R8E A;  1QL2 A;  4LC1 A;  3TYY A;  1NJI Q;  3MTU E;  3RK2 C;  2N9B A;  1JMB A;  1HGV A;  2FAD A;  2HYN A;  2PFX A;  2XKM A;  4I7Z C;  2N5H A;  3VTP C;  2KZI A;  3HUS B;  1M1J B;  2H8P D;  1K73 Q;  3TNU A;  4XFX A;  2ZT9 B;  2GZF A;  3BAS A;  2ZAE B;  4NPE A;  2H89 C;  2JWA A;  4BPG A;  1NAF A;  3NTN A;  1IK7 A;  4ZMD A;  4BRY A;  2WSF H;  2FQ1 A;  1RF0 A;  3OW2 O;  3AEC C;  1KYO D;  2N1T B;  2Q6Q A;  2X2B A;  2B88 A;  1D7M A;  4OGQ D;  2LIW A;  3M1M A;  3CXH I;  3WMM 0;  2YKO A;  4IL6 X;  3RL0 g;  3CCU P;  1M56 D;  4WVZ A;  3GMA A;  1PEM A;  3H1J D;  4BPF A;  3AE2 C;  2ZVN B;  3IFM A;  1N73 A;  3AEB C;  4H13 D;  1X9V A;  3S4R A;  1L0L K;  5KAF H;  3LW5 H;  1M90 Q;  4U7J A;  4U0E A;  3WBH A;  5CBN A;  3B5N C;  1OXZ A;  2OTJ P;  4UHP B;  1VL2 A;  4ZKP A;  3GHG A;  3V4W A;  1YQ3 C;  2PEI A;  2XND H;  1SQX G;  3H1I G;  2Z46 A;  3HE4 B;  1KYO I;  2IFM A;  3H1H G;  1U7M A;  1NTM G;  7CEI A;  2JDI H;  2FVF A;  3OA7 A;  1SFC D;  1Q81 Q;  3NTE A;  1LT1 A;  1RY3 A;  1GXG A;  1GU4 A;  5B5E H;  4ASW A;  1VQ9 P;  2QM7 A;  1NU1 K;  1HVV A;  5AVV B;  3TF5 A;  1M74 A;  2BCC D;  1SQX J;  3H1I J;  2GDW A;  1SQX E;  3H1I E;  5CCH D;  3H1H J;  5HGN A;  1NTM J;  3H1H E;  3L70 D;  1NTM E;  1HUC A;  1VQN P;  2CQ8 A;  1HJB A;  2OYH B;  2AEF A;  1JTH A;  3HD7 D;  2QVA A;  4PD4 D;  2IZ0 A;  4JQ0 D;  5APQ A;  1IC2 A;  1NAY A;  1VQ5 P;  2RMZ A;  2QRX A;  1SQP D;  2P10 A;  2IX7 C;  5KAI E;  4O9B A;  1EXI A;  1AFO A;  2WSS H;  3VN0 A;  2Z44 A;  4JYB A;  3WUV A;  4W7Z A;  1XTG B;  1VF5 D;  1PPJ G;  4COP A;  2ZYD A;  1FZC A;  1NTZ D;  3MUD A;  2M8R A;  4YPC A;  2CGQ A;  1BCC J;  4IFM A;  3T97 B;  3WU2 H;  2YMK A;  4UB8 H;  2W27 A;  2KR5 A;  1OVU A;  3RL0 D;  5KKZ B;  4U0C A;  1S2E A;  2Q9I A;  1PPJ E;  1SQV K;  3Q5S A;  1YQ4 C;  2Z45 A;  2E76 C;  2FY8 A;  3AE6 C;  1LWU C;  1HH0 A;  1E6J P;  1RE3 C;  1Y47 A;  2KI7 B;  3ZDM A;  3G29 A;  1CZQ A;  5CCG C;  2K1A A;  2E43 A;  3B5I A;  1VPC A;  1LTT C;  2MR8 A;  2QJP C;  3KYQ A;  2FVE A;  5DCK A;  4U3F G;  2N1T C;  2L6E A;  5B66 E;  3U59 A;  1OVV A;  2SPZ A;  4HYT B;  4HKZ H;  2I1K A;  1S9K D;  3GJN A;  4GDO A;  2Y0D A;  3MIW A;  2NPS D;  4NPF X;  3HZQ A;  3SFE C;  1KFM A;  1BGY D;  4D6T D;  2LKM A;  4U3F E;  3BAT A;  3NY7 B;  5AW0 B;  2IYP A;  2ZT9 D;  3CI9 A;  3U1A A;  2R3C A;  1GL2 D;  1YBK A;  2GZI A;  1LJ2 A;  1P84 E;  1HF9 A;  3G1G A;  1EZV D;  2GUV A;  1SQB J;  1JMM A;  3R2P A;  1JNM A;  4R4M A;  2FYU K;  1KMI Z;  1ZME C;  2BUO A;  1A02 J;  5KLV K;  1N7S C;  1M57 D;  3E1R A;  1KIL E;  3V5B A;  5APW A;  1SFC A;  2M3E A;  1KOR A;  4UB6 E;  3JCU H;  1PZQ A;  2M8P A;  1GK4 A;  4K35 A;  2DW3 A;  3R4Y A;  3JC2 2;  1J1D C;  1FOS F;  2PEQ A;  3CCL P;  2JKV A;  4PV1 B;  1FBM A;  2O1K A;  2OYH C;  2C9N Y;  5AW7 B;  1BSN A;  1FU1 A;  2FXM A;  2OQQ A;  2ITA A;  5CCH A;  3LW5 J;  3FXD A;  4XA4 A;  4R4L A;  1BDD A;  1GMJ A;  2VLP A;  1N2D C;  3PRJ A;  1XTC C;  2GUS A;  1L0N K;  2IBZ G;  2XDJ A;  2K0Y A;  1GXH A;  3MGN A;  2FXP A;  1E79 H;  2KGA A;  1T8Z A;  5APX A;  4IL6 E;  3GZM A;  1S4X A;  3CWB G;  1PV3 A;  5AVQ B;  1N8R Q;  5F2O A;  1H88 A;  1NOH A;  3CC4 P;  2CWO A;  1JOC A;  1FZA A;  1KIL B;  2FVA A;  2Z5H A;  3A0H H;  1H0T B;  4TT3 H;  2KW2 A;  3P32 A;  2EG5 A;  1YTZ I;  2N5I A;  5B5E E;  3B71 A;  3GW6 A;  2IBZ E;  1TU3 F;  3L71 G;  3G9R A;  3CWB J;  2YO2 A;  4LLH A;  3CWB E;  2K9Y A;  2YIU B;  3I5C A;  2JB0 A;  4H44 B;  4PJ0 H;  4BWN A;  1IFJ A;  2C9L Y;  2PEJ A;  2W83 C;  2FFD A;  1G2C B;  1LTI C;  4MRT C;  4PWV B;  3L71 J;  2AEM A;  3CL3 D;  3L71 E;  1SQX D;  3H1I D;  1UNK A;  4XRO A;  2MKV A;  1YYC A;  1IFI A;  3H1H D;  1NTM D;  3L72 G;  1USE A;  3RK3 C;  5HGM A;  5EW5 E;  2WT7 B;  1KD1 Q;  1Q82 Q;  5AVX B;  3OAK A;  1BSH A;  2O01 N;  4QKO A;  2C0X A;  2K88 A;  3GZL A;  1EQ7 A;  1LTB C;  1HJ0 A;  5AW2 B;  3WU2 E;  4JF7 A;  3AEG C;  3HRN A;  2JYG A;  3RK2 B;  3L72 E;  1PL5 A;  4I7Z B;  1DD3 A;  2NPS A;  1Y8A A;  1AQT A;  5KTB A;  1YIT P;  2Z5I A;  4NPD A;  2V7Q H;  1VQ8 P;  2ZXE B;  4GKG A;  2JP3 A;  2L5G B;  3EFF K;  4GT1 A;  4PD4 E;  1GL2 A;  5AW4 B;  2E75 C;  3GHG C;  2PAJ A;  2W6J H;  3G1I A;  1SQP J;  4PH0 A;  1PPJ D;  2GZG A;  1JO5 A;  1EOQ A;  1J1E C;  2UWJ E;  1S1C X;  3S9O A;  2LXB A;  1H8A A;  2GZJ A;  3FGA D;  5APU A;  1NTZ J;  1EMV A;  1OX3 A;  2CPS A;  3B5N B;  3L35 A;  3IF4 A;  2LPK A;  4H0L C;  5BU8 B;  4RO0 A;  2P9X A;  1SQQ G;  2ZXX A;  1ZR4 A;  3CC7 P;  3WUT A;  5DJT B;  2JBG A;  2K9J A;  5GTH E;  2WSE J;  1FR2 A;  1WMK A;  3CCR P;  3IAO A;  1JCD A;  3D70 A;  1KB9 H;  1VQ6 P;  1SLQ A;  2MJZ A;  1E5W A;  4U3F D;  1SQQ J;  1N86 A;  3M0D C;  2N9Y B;  1SQQ E;  1FZE A;  4PV1 D;  1DEE G;  1L4A C;  1ZV8 A;  4BXL A;  1P84 D;  1FZC C;  4TLF A;  4YXW H;  1CSB A;  5L8R J;  4XFY A;  1M1K Q;  2FYN B;  1KC8 Q;  1RF1 B;  2D2C C;  1MKM A;  4N78 E;  2A45 I;  3Q2Y A;  3CX5 I;  2R3S A;  1BGY J;  3VRL C;  3L4F A;  2MY5 A;  3SWK A;  3A5T A;  1KIL D;  2KP8 A;  5CHX A;  1LNQ A;  1NWQ A;  1QRJ A;  3O6Q B;  4GOF A;  2E74 C;  1K04 A;  2FKW B;  1LTJ B;  1OMI A;  3AE4 C;  3DS5 A;  1P84 I;  3SWY A;  4DCK A;  2GM4 A;  4H44 D;  3CD6 P;  3ITK A;  2A45 H;  2E76 B;  5KJ7 D;  2AXC A;  2XT1 A;  4EOT A;  3O8Z A;  1ZP0 C;  1LT9 B;  1LWU B;  5APS A;  3DPH A;  2QM8 A;  4OGQ C;  2KG6 A;  2XZR A;  4PJ0 E;  4M3L A;  4H2X C;  5HVC A;  1FS0 E;  2O01 J;  2DGY A;  2KG9 A;  2J5U A;  4KHX A;  2QJP B;  2M3B A;  2I8D A;  4IFF A;  2KNC B;  2IBZ D;  5CJ4 A;  1URQ A;  2WMM A;  3HYB A;  1YTZ T;  4H13 C;  4M0I A;  2Z4E A;  2WQY C;  3CWB D;  1HGZ A;  2NZ2 A;  2N98 A;  4XRQ A;  1M8O B;  3VMZ A;  3MHV A;  4I1L A;  3RK2 D;  3PLN A;  4BPH A;  2LML A;  3H25 A;  1CI6 B;  4WBA A;  3L71 D;  2JQ4 A;  4L74 A;  3CCJ P;  3AE5 C;  4WY4 A;  1JM0 A;  2GDY A;  1Q7Y Q;  4F37 A;  2PRR A;  2WIT A;  5H2F H;  5TJH A;  4L75 A;  2G8Y A;  2KGE A;  3CXH H;  2KS1 A;  3N7N A;  2QJY C;  1IFN A;  1E0H A;  1LP1 A;  5HV8 A;  2B87 B;  2RN0 A;  2OAR A;  1AQ5 A;  2YXQ B;  1U7J A;  3M0A A;  1BXI A;  1HBW A;  2ZYA A;  1ZMB A;  1Q90 D;  1IUQ A;  1N7S B;  3S1K A;  3L72 D;  1L0L G;  3G3Z A;  4ZKU A;  3B5N D;  1VQL P;  4R0M A;  1J1D B;  2KXP B;  5KP7 B;  1S5L H;  1HQB A;  2JJL A;  4C7N B;  2K5X A;  5AVS B;  2GYK A;  4U0F A;  1KYO H;  2FYN C;  3I56 P;  2CG5 B;  1FE6 A;  2KWL A;  3II6 A;  3H1K G;  1RF1 C;  5CBO A;  2L22 A;  2P58 A;  3WUU A;  5AVR B;  2OYI A;  4U0D A;  2OTL P;  4QNB A;  1LTA C;  3AE3 C;  2LXC B;  1U57 A;  1A8O A;  1NU1 G;  2VLN A;  1AA0 A;  2M8L A;  1PEO A;  4I2L C;  2XZ0 D;  2H88 C;  1G1J A;  3M9B A;  3H1K J;  3GF7 A;  3H1K E;  1KIL A;  1LTJ C;  2KB7 P;  3A0B H;  3Q20 A;  2PY8 A;  1PIX A;  1KFN A;  2K93 A;  2B9B A;  2VLQ A;  2AXT E;  4A7P A;  1NU1 J;  2HR3 A;  1NU1 E;  2C0W A;  2Y9Y A;  4PD4 I;  5AVU B;  1UIX A;  2BEZ F;  3EFG A;  2OTK E;  4WYM A;  2LIU A;  2R44 A;  1LT9 C;  2ZVO B;  2MF4 A;  1PGO A;  3HE5 A;  1SP4 A;  5TIS E;  1Q2N A;  1KZU B;  1SQQ D;  3EWK A;  1VQM P;  2WSC H;  1PEU A;  2HPC A;  3L37 A;  3U43 A;  2JO0 A;  1SQB K;  4EDF A;  2NPS C;  3TNU B;  3RK3 B;  4AYC A;  2J58 A;  1K8A Q;  4BRY B;  3FWL A;  1OIP A;  1EC5 A;  2E76 D;  1SQV G;  4H2Y C;  1GL2 C;  5DJU B;  1UII A;  3KQG A;  4N78 D;  1QVF O;  1NTK G;  1IZN B;  1IMP A;  1QLE D;  3IR9 A;  4RES B;  1ZRT E;  4U3F J;  5KP6 B;  5AW9 B;  1PEQ A;  5CCG D;  1HWT C;  2P7J A;  1ZNV A;  1DEB A;  1W5C E;  1X3O A;  1SQV J;  4XE5 B;  5GTI H;  2HOD A;  1SQV E;  2N1T D;  1FDI A;  1QL1 A;  1NTK J;  1NTK E;  3USS A;  2JAZ A;  2E75 B;  3GHG B;  3H32 B;  5K5G B;  2WSF J;  2K37 A;  2CK3 H;  1J1E B;  1FOS E;  2ONT A;  2FYZ A;  2WPQ A;  3TGU G;  1USD A;  2Y0C A;  3CCS P;  2N6Z A;  1DNY A;  1OZH A;  4N3Y B;  5AVZ B;  3KPE A;  1EXJ A;  1GK6 A;  2AFE A;  5KAF E;  4H0L B;  3I55 P;  1SS1 A;  2FXO A;  1NHL A;  3CC2 P;  1EZV I;  3TGU E;  1GTW A;  2KOO A;  1JTH B;  3HD7 A;  5H2F E;  2FYU G;  1X79 B;  5BU5 A;  4MN4 C;  3QWO C;  1N7S D;  2ZYG A;  5KLV G;  5CJ0 A;  3RG2 A;  4QMA A;  1F80 D;  3CPW O;  1NQ4 A;  3CCQ P;  5AW1 B;  1NGM B;  1GZL A;  1L4A B;  2FYU J;  4GOE A;  2HFE D;  2FYU E;  2BQ1 E;  3IN6 A;  2FAC A;  1FZC B;  2IZ1 A; 
#chains in the Genus database with same CATH homology
 1YIJ P;  3CC7 P;  3CCU P;  1EIA A;  4XRO A;  2DGY A;  1VQK P;  1PEM A;  3P05 A;  2QA4 P;  4U0B A;  2BUO A;  1VQ4 P;  2EIA A;  3G6E P;  5BS1 A;  1M6N A;  4U0D A;  3CCR P;  2OTL P;  5HGM A;  1RO0 A;  1A43 A;  4QNB A;  1M90 Q;  1VQ6 P;  4U0C A;  3G26 A;  3HYB A;  4XFZ A;  1RNI A;  1Q82 Q;  1KD1 Q;  2XXM A;  4U0E A;  4M0I A;  1A8O A;  3WBH A;  2M8P A;  2M8L A;  2Z45 A;  2OTJ P;  4GR2 A;  1PEO A;  2PEQ A;  5F2K A;  3CCL P;  4U0A A;  4XRQ A;  1KQS O;  2PEI A;  1S72 P;  1K30 A;  1E6J P;  2EFJ A;  5HGO A;  2Z46 A;  5HGL A;  3CCM P;  1RO2 A;  2JYG A;  2PEN A;  3MGE A;  5I4T G;  1YHQ P;  3G29 A;  3G28 A;  3H0D A;  4XFY A;  3Q20 A;  2PY8 A;  1M1K Q;  3B5I A;  1YJN P;  2ONT A;  2JYL A;  2XV6 A;  3DS1 A;  1KC8 Q;  1Q81 Q;  3NTE A;  2PEM A;  3CCJ P;  1YIT P;  5DCK A;  1Q7Y Q;  3CCS P;  3G0V A;  1VQ8 P;  1VQ9 P;  2L6E A;  4WYM A;  4COC A;  1M74 A;  3VRL C;  3DTJ A;  1N8R Q;  5F2O A;  4PH1 A;  1M6E X;  3E2D A;  3CC4 P;  2CWO A;  2PEK A;  3DS2 A;  1Q86 Q;  1VQ7 P;  5JPA A;  3G4S P;  3H4E A;  3CMA P;  5HGN A;  3G1I A;  3I55 P;  3G71 P;  4PH0 A;  1YJW P;  1VQN P;  1VQO P;  2EG5 A;  3CC2 P;  3DS3 A;  1EOQ A;  1YI2 P;  1NJI Q;  1QRJ A;  2OAR A;  1VQM P;  3HZQ A;  1PEU A;  3DS4 A;  3CME P;  3H47 A;  4IPY A;  3LRY A;  3G21 A;  2JO0 A;  2KOD A;  1K9M Q;  1ZMB A;  1K73 Q;  3DS5 A;  4XFX A;  1JJ2 O;  1IUQ A;  1D1D A;  2QEX P;  2E1M A;  5BS2 A;  1VQP P;  3RG6 C;  1W2B O;  1VQ5 P;  3CD6 P;  1K8A Q;  2M8N A;  2LF4 A;  3CXC O;  3DS0 A;  2Z44 A;  3OW2 O;  2PEJ A;  1VQL P;  3CCE P;  3CCV P;  3CPW O;  1BAJ A;  3G1G A;  2XT1 A;  3CCQ P;  2PEO A;  1QVF O;  4COP A;  4GR6 A;  3M1M A;  3DPH A;  2P9X A;  4U0F A;  5F2N A;  1YJ9 P;  2BQ1 E;  3I56 P;  1AUM A;  2BHV A;  1QVG O;  1PEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...