2QA4P

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2qa4P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 2qa4P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 2qa4P02
1YITP 3CMEP 3CXCO 1Q7YQ 1K8AQ 3CCMP 1YJNP 3I55P 2QEXP 1KD1Q 1VQ8P 1VQLP 3CCEP 3CCLP 3CC2P 1VQNP 1VQ4P 1S72P 1Q81Q 1VQ7P 1Q86Q 3CPWO 1VQMP 2OTJP 1K9MQ 1YJ9P 1N8RQ 3G4SP 1VQ6P 1QVFO 1M90Q 1QVGO 3CC7P 1YIJP 3CC4P 3CCRP 3CCUP 1VQPP 3CCVP 1VQOP 1YHQP 3G6EP 3CCSP 1K73Q 3CCJP 3CCQP 1YJWP 1VQKP 2OTLP 1W2BO 3OW2O 1KC8Q 1VQ9P 3G71P 1JJ2O 3CD6P 1Q82Q 3CMAP 3I56P 1NJIQ 1M1KQ 2QA4P 1KQSO 1YI2P 1VQ5P
chains in the Genus database with same CATH superfamily
1NAFA 3P05A 3MUDA 3HTKB 4DJGA 3KPEA 1RNIA 5BVZA 4OVNF 2IDBA 2JR8A 5KAFE 1CZQA 5JPAA 1PL5A 2Q9IA 1SQPG 3M0DC 5APUA 2E5YA 4YPCA 5KLVJ 5AVUB 3TGUE 5AW9B 1A43A 2E75B 2AEFA 1VQ8P 2QG4A 2M5RA 2ZXXA 4AUWA 2C9LY 4EI2A 1NTKJ 3P32A 2AXTE 2NPSD 5AW5B 1M1JB 4IOIH 2E42A 3B5NC 1IFJA 3TGUD 1NTMG 1NQ4A 2HR3A 2I1JA 4IL6H 2X2BA 3NTEA 1RO2A 3RK3B 2BCCE 3V6IA 1FOSF 1JY2P 1BCCJ 5KLIB 2MY5A 1LP1B 3H32A 2XT1A 5DCKA 2VLNA 4B86A 2KXPB 1T2KC 1RE4C 1DD3A 2P2UA 5KLVK 1J1DC 2FYUJ 1LT1A 2BCCD 3G9RA 1NYHA 1L0IA 2N1TA 1S3JA 1QVFO 4I1LA 3NY7B 2KGEA 4L76A 4M3LA 1E0HA 1SQXJ 3G71P 2R3SA 3CMAP 1DD4A 1KZUB 3R2PA 1NU1G 4M0IA 3CCEP 1RF1C 1OWAA 1YQ4C 1P84I 4L74A 3W68A 2KG8A 3PRJA 2K5XA 5CJ0A 3Q2YA 2JQ4A 1N7SA 3H4EA 4C7RA 3L75G 1QL2A 2AEMA 3HUSC 4U0DA 1L0NK 3LW5J 5KAFH 3BCCE 3BRVB 1EQ7A 3EFGA 1SQBG 2FYUK 1H0TB 4HKZH 3VOPA 1LTJB 1M6EX 3GHGC 3O6QB 1FBMA 4COPA 2W6AA 3DS2A 1NU1E 2A45H 1GTWA 1KQSO 5HV8A 2W27A 1VDFA 2R44A 2HLOA 2AXTH 4EIJA 1EZVI 4H0LB 1KYOE 1PEUA 2WWWA 2WPVB 4C7NA 1VQ6P 3G28A 2KOGA 1NKZB 2JU1A 4RKUJ 2FY8A 2D2CD 2O1JA 4YXDC 3G26A 4LGDE 1NU1D 5KKZB 3H47A 2IZ1A 5CCGA 1KMIZ 1VF5C 3WUUA 1Q2NA 3B4QA 2OYHB 4IL6X 1KYOD 1E5WA 3VYIA 3L36A 5KLIC 5HVCA 2EIAA 1LTSC 2KZIA 2K1AA 4XFZA 3L71E 3L75D 5CZDB 3CCJP 3LRYA 4HKGA 1Z56A 1IO4A 2IFMA 1HF9A 1MZ8A 1VQ5P 2KS1A 1GL2A 2M8RA 1AV1A 2M5AA 3L71D 3MTUE 2Z5IA 2QJKB 1AVYA 2KWLA 2E76C 3AECC 2IYOA 2WSFJ 5BS2A 2VLOA 4WY4D 1FJKA 1L0NE 4QMAA 2K0XA 1S9KE 3G4SP 2WSCJ 1N86A 3GW6A 3OJAB 1S5LE 2LXCB 1T2KD 2K2QA 4OGQC 1EDLA 3CMEP 3SWKA 1L4AC 1M1JA 2QJYC 3IF4A 1S9KD 2JJLA 2KSJA 4I6MC 3OA7A 3I5CA 2WSEH 5TJHA 3H6PA 2V4HA 3M9HA 4GT1A 2NPSB 5CBNA 1KYOH 2WMMA 2LL8A 3WBHA 3CXCO 1LP1A 1URQD 2VSQA 5APSA 1VQLP 3SWFA 2MVUA 2BHVA 2H43A 3PTZA 1LNQA 1UJZA 5I4TG 3TDKA 2L4BA 2FAEA 2GUVA 2OARA 4CPGA 1JJ2O 3HE4B 2AFEA 1BGYJ 2G3AA 2Q7CA 1QL1A 1FZCC 3KQGA 4XROA 3IFMA 2YIUC 1AVOA 1VKUA 1OW8A 1HY8A 1LTGC 1HUCA 1M56D 4U0EA 2KG9A 3JCUE 3FWNA 2KGCA 1S2EA 4UB8E 4IFDK 2Q5UA 2FVFA 3CD6P 3C1LA 3MZWB 2HFED 3A0HE 1VQNP 1EXIA 2O01H 2Q1KA 1KB9I 3RGUA 5F2NA 1FZFA 1X9VA 1H0TA 4K35A 1LTJA 1M1KQ 1VF5D 4AYCA 3O6QA 1HWTC 3H1LG 1FE6A 2IBZI 2R32A 1S5LH 1MKMA 1RF0A 2ROQA 1YQ3C 2H8PD 1IZNB 3M1MA 2CWOA 1FZBA 3KHUA 2FVAA 4W7ZA 5K5GB 3Q5PA 2YMYA 1IUQA 3MGEA 2XV5A 1OW7A 1K8AQ 3ZDMA 1NTZJ 4GR6A 1KILC 3PHLA 2OYIB 2Y9YA 2C0XA 1U7JA 1HVVA 1GU5A 2KYVA 2FQ1A 2OYHA 1RHZB 1RQVA 3HD7C 3H1LE 5BU8B 1JOCA 2ZT9D 3OW2O 4EOTA 3M9QA 1ZMEC 2V7QH 2PFXA 1SFCC 1GMJA 1X22A 2GYKA 1S72P 5CCHA 2PP6A 1RQUA 3V4QA 1PPJG 2MR7A 2B89A 2C0WA 2P9XA 5KJ7D 3D71A 3MIWA 3CCRP 3H1LD 2JGPA 4IPYA 2R5DA 2Z45A 3BATA 3H1KJ 2K92A 1T8KA 1L4AD 4BRYB 3JCUH 2AF8A 3AE1C 3QH9A 4UB8H 3PLNA 4N6JA 2IYPA 1SVFA 4A7PA 3L74G 1YTZI 1XTGB 1JCDA 5KP6B 3CCSP 3A0HH 1LT9A 1YBKA 2GA1A 3V2QA 3MGNA 1NO4A 2CG5B 1Q7YQ 1SQPJ 2YO2A 1PV3A 3JC22 3VTPC 1GZLA 1JY3O 2N98A 5KTBA 1FC2C 1U57A 1T8ZA 3V2RA 2WQYC 2XV6A 2BUOA 2YKPA 1PGQA 1CI6A 1KQGB 1RY3A 3R4YA 4LC1A 1NHLA 1S5LX 3L74E 5AW7B 2NPSA 1BE3E 2RKLA 1K9MQ 1J1DB 1H8AA 1NTMJ 2BASA 2MF4A 3RG2A 4JYCA 1HJ0A 2IZ0A 1AA0A 1R5LA 3L74D 2N5IA 2FBWC 5DJUB 1BE3D 3L72J 2BQ1E 1VHNA 1L0LJ 3AEEC 3CWBG 3HE4A 4EDFA 1HH0A 1SQVK 2D2CC 1M8OB 1VQOP 5KAIE 4DOJA 5AW3B 1X8YA 3V2NA 1R5SA 1MFTA 1JO5A 2KODA 3HUSB 1M74A 1IK7A 1ZR2A 2K9JB 1KILE 1IFNA 4EYYQ 3ABVC 1NU1J 2JB0A 3G21A 1JY3N 3TK1A 3GHGB 1GK4A 2BCCG 1ZNVA 1FDMA 2VLPA 1UNKA 4I7ZC 2LKIA 2LMLA 3L70E 1IFMA 4U3FG 2NO8A 1KILD 3CWBE 3N7NA 3L75J 4D6TJ 1IC2A 2WSSH 1L0LK 1GXGA 4NPEA 1H89A 1USEA 2AXCA 1SQBJ 1N7LA 3HD7D 2L9FA 2LR2A 3OAKA 3L70D 4WY4C 3CWBD 1VF5B 1SFCD 2H89C 2CPBA 5L8RJ 1M6NA 1FR2A 1VPCA 4Y28J 5AVRB 2WT7B 4U3FE 2OYIA 5APYA 1BDDA 2OTKE 1P84E 4GDOA 1FDOA 2L6EA 2ZAEB 3AEAC 3AE2C 3GJNA 4RO0A 2GZGA 3Q5RA 2MKVA 2WTYA 1N8RQ 1SQQJ 5CBOA 1FAVA 3BCCG 2QE7H 3FXDA 1NTKK 1EOQA 1X79B 3L73E 1FZAA 2CK3H 4U3FD 2YNYA 2K0DX 1SQBK 1NKNA 1P84D 4N3YB 5BU5A 2L0QA 3H1IE 2E76B 2N50A 1S4XA 5AW2B 2FADA 3G0VA 4GOEA 1URQC 3MHVA 5CHXA 2P58A 3CX5I 5KAIH 4U0AA 2XZ0D 1KORA 3L73D 3H1HG 3M0DA 2N9BA 3HRNA 1NOHA 2M8LA 3C9IA 3H1ID 3LIDA 1EZVE 1E6JP 3AE7C 4KT0J 3EFFK 5APVA 3VN0A 2QNWA 3RL0C 1M7LA 4OGQB 2W83C 2POHA 4R4MA 3KYQA 5E79E 1HBWA 1L4AB 2QJYB 2CNRA 1SQQK 3B5NA 3WUVA 5KLVG 1UIIA 1EZVD 3NTNA 3V4WA 3TYYA 1Y8AA 3L71G 4R0MA 3H1JE 3U1AA 2JDIH 1SQXK 2LOLA 3BCCD 1LTIC 2FKWB 3EJEA 3GLMA 2P7JA 3H1HE 1LWUC 2M3EA 4BPHA 2Q3IA 1PP9J 2MR8A 1RE4A 4IFFA 4JPZB 4GKGA 2L22A 2Z5HA 3H1HD 1TU3F 4PWVB 3P8CE 3M9BA 3RL0g 1PFIA 3CXHI 5KLVE 1FZCB 3CI9A 2E74D 3LMOA 2XZ1C 1MZ9A 1P84H 2YIUB 1L0NG 3SWYA 2WPTA 1NTKE 1KQLA 4Z1MH 2FYUG 2N5HA 1AYIA 1LTAC 2XXMA 4TLFA 1NWQA 1RF1A 2Z4EA 2FFDC 3BASA 3P8CD 1PGOA 2MJZA 1KV4A 3D6ZA 5KLVD 4H44C 3PJSK 2YXRB 5BS1A 3G1GA 1OW6A 2EHTA 1PGPA 1NTKD 5EFWB 4HB1A 4BXLA 2ZFCA 3HUSA 3HTKA 1BCCE 2N6ZA 1OVRA 4ZMDA 1T3JA 2ZT9C 1A02F 2LPKA 1Q82Q 2WPSA 1NGMB 2XNDH 2K88A 2O01N 3GHGA 3EJDA 3AEFC 2AEJA 2PENA 4BPFA 4UB6E 2FYUE 5KJ7C 1KFMA 3G6EP 2JEEA 3AE3C 2KB7P 3TNUB 1FZEA 5E79H 1JCCA 2Z46A 2ZVOB 1SQXE 3U1CA 1RH5B 1L0ND 3RK2D 1KILB 2I1KA 2FYUD 3NXSA 2QRXA 4KHXA 1RE3C 2K0YA 1ACPA 1LJ2A 5AVSB 1Y9BA 2OTLP 1K05A 2PRRA 1HTLC 3HD7B 1SQXD 3DS5A 3G29A 1WMKA 2WT7A 3GKLC 5CCGD 2KI7B 1XTCC 2WZ7A 1SFCB 2KZJA 4H2XC 1FDIA 5APWA 3HE5B 5F2KA 1PEQA 3AEBC 3JSVC 1KB9E 2YXQB 3RL0D 3P8MC 5H2FE 1Y47A 1KN7A 2RN0A 1JMBA 4JQ0D 4QKOA 1ZRTE 2IBZE 2C9NY 7CEIA 1W2BO 1KB9D 2NRGA 2ZVNB 3GG2A 3DPHA 2KGDA 5AVYB 3II6A 2L91A 1MUUA 1DV5A 5HGLA 3WU2E 2PAJA 3E1IA 2AVAA 1ZRTD 2IBZD 1K73Q 3VP8A 2WITA 5AVVB 2K9YA 2ZYAA 1L4AA 4L75A 4JBZA 4UB6H 3K5BA 2P10A 3UIAA 2KLUA 2CPSA 2JAZA 3FX0A 1Q86Q 1D1DA 3CE7A 1JTHB 1YJ9P 1K04A 3RG6C 1N2DC 2PNGA 2HYNA 1GW4A 1ZOYC 3WUTA 3KXDA 2DNWA 4ZNCA 4PJ0E 2OGUA 1JUNA 1NVOA 2QA4P 3QWOC 1EDIA 2A06G 4H44D 3TF5A 1IFPA 1PIXA 3AEDC 5AW0B 1AUMA 4H13C 2WVRA 2XU6A 2PEQA 2W8ZA 2QIWA 4GOFA 2KLVA 4L73A 3P7KA 2NZ2A 2M8PA 1N73B 5AVZB 2D2CB 1FZCA 3CLQA 3NMDA 2JWDA 1VL2A 2KW2A 5AW1B 2N6YA 2IX7C 1QGKB 2OQQA 2B87B 1QEXA 1YTZT 2HPCB 2E74B 1SLQA 1BGYG 1HQBA 3HZQA 1KB9H 3TGUJ 2GZIA 3USSA 2A06E 5H2FH 3CWBJ 4F37A 3AE6C 4I7ZB 4W80A 4GIFA 1NTZK 2PEMA 4WBAA 1PGJA 5KP7B 1AQ5A 3DS1A 2W6BA 1BE3G 1KFNA 3F89A 4U0CA 2JO1A 2A06D 1IFIA 3DS0A 3A0BE 3Q1MA 3A3YB 1JM0A 3U59A 3SFDC 3WU2H 4DCKA 2GM4A 2BCCJ 4WY4B 4COCA 2MVVA 3GZMA 1OVUA 5C39A 4WYMA 1VQ7P 1BGYE 3TNUA 3MUDC 2JYLA 3M0AA 1JEKA 2ZXEB 4Y99C 2PEKA 2QJPC 5GTHE 2P67A 2Y0EA 3TSIA 1KILA 3IN6A 4U0FA 1A8OA 4U7JA 2O3JA 1OVVA 3CCMP 1BGYD 1AF8A 3AE8C 4PJ0H 3RK2B 1DH3A 3HD7A 3B8EB 2J58A 4QNBA 2YKQA 3GF7A 2WSFH 2JWAA 3B71A 2JYGA 1SFCA 1S1CX 2CQ8A 3DS3A 3HE5A 1JY3P 2KOOA 1SQPK 2WSCH 1URQB 1EMVA 3L70G 1ZW0A 2YMKA 1N73C 2FQ2A 1LTTC 2LIWA 3BCCJ 4C46A 4PXHB 3I56P 5GTIE 3KDPB 2KGAA 3B5IA 1WT6A 3A7OA 3RL0B 1NTZE 2E74C 3L37A 1NTMK 1GPJA 3A2AA 2WSEJ 4GODA 3H1KG 2N1TC 3DS4A 4CA3A 3B4SA 1EXJA 4XFJA 4U0BA 1T6AA 4NPFX 5EW5E 1GXHA 5KP8B 1Q81Q 1ZMBA 1NTZD 4O9BA 4OH8B 2QM7A 1OFCX 1FOSE 3A0BH 1M57D 2GZFA 1LWUB 2KNCB 2BEQD 4H13D 1A02J 1E79H 1JY2O 1PEOA 1DEBA 3L35A 1JTHA 2GUSA 2KP8A 3L73G 1N7SC 5AVXB 2FACA 1SQVG 1W2EA 3L71J 3H1IG 3HYBA 5GTHH 3V2PA 1IK9A 3H1KE 4ASVA 3KZIE 4IZ6A 1CSBA 1NU1K 3C8VA 3CX5E 4GR2A 1KC8Q 1IMPA 3S9OA 1YI2P 2R5BA 5F2OA 5CJ4A 1EZVG 2QEXP 2FFDB 1BSNA 3RK2C 1R8EA 3H1KD 1N73A 3M91A 2FYNC 4XFXA 4H44B 1SQPE 3AE9C 2O01J 2JBGA 1F80D 1WRGA 1T3UA 3CX5D 3IR9A 3RBZA 3E2DA 2A45I 3L72G 2B87A 1SQVE 4WB4A 4K3AA 3S1KA 1X3OA 2M0BA 1L0LG 1L0NJ 2HPCA 4NEOA 2ZT9B 1KD1Q 5CCGC 4PV1D 2GDYA 3H1JG 1AFOA 2LF4A 1SQPD 4TT3H 1VQMP 2PEIA 1KTMA 1W5CE 4MRTC 1QVGO 5APTA 5GTIH 1NTME 1SQVD 1ZN5A 2RH0A 2B88A 2Z44A 4BRYA 4W7YA 3D70A 2ZYGA 1BSHA 1JY2N 1SP4A 1L2PA 3GMAA 2JP3A 3VMAA 2LXBA 4HH2A 2G8YA 1GL2C 1BDCA 3L72E 1CW5A 2Q3EA 1NTMD 1DX7A 3GZLA 4WY4A 1L0LE 2FYZA 3AE5C 3CXHE 2QVAA 4D6TG 2SPZA 1L0HA 1NTKG 3D6YA 2V7QJ 3L72D 4PH0A 1AJYA 1L0LD 4PH1A 3CXHD 1DNYA 1QX8A 5TISE 3V5BA 3H1JD 1NH4A 2E75C 3KZIH 2FXMA 4AQRD 1BCCG 3A5TA 2Y0CA 5AVWB 3FGAD 4MN4C 3T97B 1DEEG 2JO0A 3CX5H 2KOPA 1Z6MA 4XA4A 1M1JC 2ERHA 3L75E 1YIJP 4D6TE 1FZGA 1FU1A 2N1TD 4BWNA 2Q6QA 4NPDA 1URQA 3FWLA 4HYTB 4BPGA 3Q3DA 1OR5A 2DGYA 2JU2A 1SQBE 1SQQG 3L4FA 3N4XA 1QLED 2KOSA 2LTEA 3CCLP 3RK3C 4ASWA 1LTBC 3H25A 1SQXG 4D6TD 3EJBA 1M90Q 3SSUA 2FQ0A 1KYOI 2KIKA 1GK6A 1PEMA 4H2WC 3EQ2A 2K9JA 1SQBD 4KJMA 2N9YB 4JF7A 4XRQA 1N7SD 2HG5D 1YJNP 3WMM0 1YYCA 4JYBA 2PEOA 1SS1A 2BEZF 3DTJA 2PEJA 2M3BA 4HJGH 1BCCD 1SQQE 3B5ND 2VLQA 2EHSA 2W6JH 1LWUA 2KNCA 2PGDA 1AQTA 5M1BA 1LT9B 1BAJA 1J1EB 2HODB 2FXPA 3G1IA 1HGVA 3CPWO 1GW3A 3CXHH 3H1LJ 5HGOA 1SQQD 3S4RA 2R3CA 4RESB 4H13B 3VMXA 1D7MA 1YJWP 3PH0A 4N78E 1PZQA 3LIEA 1PP9G 3MD0A 1OZHA 3M06A 2IBZG 4R4LA 2XZRA 1LTJC 3CC2P 4DG9A 1ZR4A 5TISH 1GD2E 2AFDA 5APXA 2ZYDA 3GF3A 1CI6B 4I2LC 1KLPA 2UWJE 2XKMA 1RF0C 1YHQP 2FFDA 4N78D 3VP9A 2Y9ZA 1K30A 1G2CB 3CC7P 2KG6A 4H0LC 2WPRA 4LLHA 2H88C 1GL2D 1OMIA 1USDA 4YXWH 5KKZC 1UIXA 2CGQA 1PP9E 2K3RA 4OWFA 2XDJA 3EWKA 1EDKA 1QRJA 3G3ZA 2OYHC 1X0TA 1IJDB 3E1RA 5KJ7A 4PV1B 3RBXA 1PP9D 4WVZA 2RMZA 5CCHC 4XFYA 1OIPA 2K93A 4Y99B 2QJPB 3BVHA 2E75D 3L74J 2ONTA 1ZLLA 1BE3J 2XNXA 2DW3A 2OYOA 2QJKC 3RK3E 1RE3A 5AW6B 1JNMA 2K37A 3PP5A 3ITKA 3CCUP 3CCVP 2GZJA 3AE4C 3O8ZA 5B66E 3Q20A 5APQA 1LT9C 1J1EC 3FXEA 2QM8A 3RK3D 2LIUA 4DZOA 2OTJP 4H2YC 2FHSC 2B9BA 3NFQA 3T97A 1LGHB 5B5EE 1VQ9P 1EIAA 3LW5H 1GU4A 2WPQA 3H32B 2GZEA 4PD4E 1VQ4P 5HGNA 2KR5A 2ITAA 1U7MA 2E5TA 3MP7B 3E7KA 4DT0A 2EG5A 3BRTB 2NPSC 5HGMA 2E76D 2PY8A 1ZP0C 3L70J 1DIPA 2N1TB 2KSEA 2J5UA 2Y0DA 4PD4D 1Q90D 4WWIA 3I55P 3U43A 1KQFB 1JB0J 1G1IA 2O1KA 2QSIA 1HGZA 4YTPC 1IMQA 4PD4I 2JKVA 4UHPB 1EC5A 2LKMA 2E43A 2YKOA 5AW4B 4OGQD 4ZKPA 2KORA 4PV1C 1N7SB 2GDXA 3VMZA 3Q5SA 5AW8B 2L5GB 3W67A 4U3FJ 2HODA 5AVQB 2VRSA 1J2JB 4XE5B 1CEIA 3B5NB 3CL3D 1PPJE 4H0LD 2MD9A 5DJTB 3L73J 2J59M 1IFDA 2IFNA 3SFEC 5B66H 2H7HA 2K94A 1SQVJ 2FYNB 4RJTA 4IL6E 3CC4P 3H1IJ 1GDTA 4IFMA 3VMYA 1NTZG 1BXIA 3AEGC 4C7NB 2M8NA 2IPPA 1NAYA 1NJIQ 1PPJD 2P1JA 2FVEA 1MFZA 2KUBA 1EDJA 5B5EH 3IAOA 3H0DA 1HJBA 1G2CA 5AVTB 2EFJA 5EJDA 1VQPP 1H88A 5CCHD 4ZKUA 3CCQP 4PD4H 1OX3A 1FJPA 2YO3A 2I8DA 2ZJSE 1RO0A 1VQKP 1G1JA 1YITP 2OYIC 1FS0E 1ZV8A 2W90A 5CMZA 3TGUG 1RF1B 1ZXGA 1JMMA 2KS1B 3F5HA 1GL2B 3VRLC 2A45G 3H1JJ 2GDWA 2FXOA 2M5AB 3H1HJ 1MV8A 2E1MA 2KOQA 2KK7A 1OXZA
chains in the Genus database with same CATH topology
3G29A 3P05A 2L6EA 3CCMP 1BAJA 4M0IA 3CCEP 3G1IA 3HYBA 1S72P 1RNIA 3CPWO 4XROA 2BQ1E 1N8RQ 4PH0A 1AUMA 2P9XA 4U0EA 1EOQA 2PEQA 5HGOA 4PH1A 3CCRP 3CCUP 1VQOP 4QNBA 3CCVP 5JPAA 5F2KA 1PEQA 2M8PA 1YJWP 2JYGA 2QA4P 3H4EA 4GR2A 1KC8Q 4IPYA 3CD6P 2XXMA 5BS2A 2Z45A 3Q20A 1YI2P 3G0VA 4U0DA 3DS3A 5F2OA 1A43A 2KODA 2QEXP 1VQ8P 1M74A 3CC2P 1VQNP 4U0AA 2JO0A 2OTJP 5BS1A 4XFXA 3G1GA 3G4SP 1M6EX 5F2NA 1YIJP 3G21A 3HZQA 3CC4P 1YHQP 3CCSP 4COPA 3E2DA 2M8LA 3DS2A 1E6JP 1W2BO 1VQ9P 2M8NA 1EIAA 1Q82Q 1NJIQ 3I56P 1K30A 2DGYA 1M1KQ 1KQSO 3CC7P 3CMEP 1Q7YQ 3DPHA 3CCLP 1KD1Q 3NTEA 1VQ4P 3B5IA 2LF4A 1PEUA 2PEMA 1VQMP 5HGNA 1RO2A 2PENA 1VQ6P 3H0DA 2PEIA 5HGLA 3G28A 3M1MA 2CWOA 2EG5A 3DS1A 1M90Q 1QVGO 2XT1A 5HGMA 2EFJA 1VQPP 3G26A 3G6EP 2PY8A 5DCKA 4U0CA 1PEMA 1K73Q 3CCQP 3DS4A 2XV6A 2Z44A 3DS0A 2BUOA 1QRJA 3H47A 1IUQA 3MGEA 1A8OA 1RO0A 4U0BA 1VQKP 3WBHA 4XRQA 1YITP 2Z46A 3CXCO 1K8AQ 4GR6A 4COCA 3I55P 1YJNP 1VQLP 4WYMA 1ZMBA 1Q81Q 1VQ7P 2PEOA 1Q86Q 1D1DA 2BHVA 2EIAA 1K9MQ 1YJ9P 3RG6C 4XFZA 1M6NA 2JYLA 3DTJA 2PEJA 1QVFO 5I4TG 3VRLC 2PEKA 4XFYA 2OARA 3CCJP 1PEOA 2OTLP 3LRYA 3OW2O 3G71P 1JJ2O 4U0FA 3CMAP 2E1MA 2ONTA 1VQ5P 3DS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT P;  3CME P;  3CXC O;  1Q7Y Q;  1K8A Q;  3CCM P;  1YJN P;  3I55 P;  2QEX P;  1KD1 Q;  1VQ8 P;  1VQL P;  3CCE P;  3CCL P;  3CC2 P;  1VQN P;  1VQ4 P;  1S72 P;  1Q81 Q;  1VQ7 P;  1Q86 Q;  3CPW O;  1VQM P;  2OTJ P;  1K9M Q;  1YJ9 P;  1N8R Q;  3G4S P;  1VQ6 P;  1QVF O;  1M90 Q;  1QVG O;  3CC7 P;  1YIJ P;  3CC4 P;  3CCR P;  3CCU P;  1VQP P;  3CCV P;  1VQO P;  1YHQ P;  3G6E P;  3CCS P;  1K73 Q;  3CCJ P;  3CCQ P;  1YJW P;  1VQK P;  2OTL P;  1W2B O;  3OW2 O;  1KC8 Q;  1VQ9 P;  3G71 P;  1JJ2 O;  3CD6 P;  1Q82 Q;  3CMA P;  3I56 P;  1NJI Q;  1M1K Q;  2QA4 P;  1KQS O;  1YI2 P;  1VQ5 P; 
#chains in the Genus database with same CATH topology
 1NAF A;  3P05 A;  3MUD A;  3HTK B;  4DJG A;  3KPE A;  1RNI A;  5BVZ A;  4OVN F;  2IDB A;  2JR8 A;  5KAF E;  1CZQ A;  5JPA A;  1PL5 A;  2Q9I A;  1SQP G;  3M0D C;  5APU A;  2E5Y A;  4YPC A;  5KLV J;  5AVU B;  3TGU E;  5AW9 B;  1A43 A;  2E75 B;  2AEF A;  1VQ8 P;  2QG4 A;  2M5R A;  2ZXX A;  4AUW A;  2C9L Y;  4EI2 A;  1NTK J;  3P32 A;  2AXT E;  2NPS D;  5AW5 B;  1M1J B;  4IOI H;  2E42 A;  3B5N C;  1IFJ A;  3TGU D;  1NTM G;  1NQ4 A;  2HR3 A;  2I1J A;  4IL6 H;  2X2B A;  3NTE A;  1RO2 A;  3RK3 B;  2BCC E;  3V6I A;  1FOS F;  1JY2 P;  1BCC J;  5KLI B;  2MY5 A;  1LP1 B;  3H32 A;  2XT1 A;  5DCK A;  2VLN A;  4B86 A;  2KXP B;  1T2K C;  1RE4 C;  1DD3 A;  2P2U A;  5KLV K;  1J1D C;  2FYU J;  1LT1 A;  2BCC D;  3G9R A;  1NYH A;  1L0I A;  2N1T A;  1S3J A;  1QVF O;  4I1L A;  3NY7 B;  2KGE A;  4L76 A;  4M3L A;  1E0H A;  1SQX J;  3G71 P;  2R3S A;  3CMA P;  1DD4 A;  1KZU B;  3R2P A;  1NU1 G;  4M0I A;  3CCE P;  1RF1 C;  1OWA A;  1YQ4 C;  1P84 I;  4L74 A;  3W68 A;  2KG8 A;  3PRJ A;  2K5X A;  5CJ0 A;  3Q2Y A;  2JQ4 A;  1N7S A;  3H4E A;  4C7R A;  3L75 G;  1QL2 A;  2AEM A;  3HUS C;  4U0D A;  1L0N K;  3LW5 J;  5KAF H;  3BCC E;  3BRV B;  1EQ7 A;  3EFG A;  1SQB G;  2FYU K;  1H0T B;  4HKZ H;  3VOP A;  1LTJ B;  1M6E X;  3GHG C;  3O6Q B;  1FBM A;  4COP A;  2W6A A;  3DS2 A;  1NU1 E;  2A45 H;  1GTW A;  1KQS O;  5HV8 A;  2W27 A;  1VDF A;  2R44 A;  2HLO A;  2AXT H;  4EIJ A;  1EZV I;  4H0L B;  1KYO E;  1PEU A;  2WWW A;  2WPV B;  4C7N A;  1VQ6 P;  3G28 A;  2KOG A;  1NKZ B;  2JU1 A;  4RKU J;  2FY8 A;  2D2C D;  2O1J A;  4YXD C;  3G26 A;  4LGD E;  1NU1 D;  5KKZ B;  3H47 A;  2IZ1 A;  5CCG A;  1KMI Z;  1VF5 C;  3WUU A;  1Q2N A;  3B4Q A;  2OYH B;  4IL6 X;  1KYO D;  1E5W A;  3VYI A;  3L36 A;  5KLI C;  5HVC A;  2EIA A;  1LTS C;  2KZI A;  2K1A A;  4XFZ A;  3L71 E;  3L75 D;  5CZD B;  3CCJ P;  3LRY A;  4HKG A;  1Z56 A;  1IO4 A;  2IFM A;  1HF9 A;  1MZ8 A;  1VQ5 P;  2KS1 A;  1GL2 A;  2M8R A;  1AV1 A;  2M5A A;  3L71 D;  3MTU E;  2Z5I A;  2QJK B;  1AVY A;  2KWL A;  2E76 C;  3AEC C;  2IYO A;  2WSF J;  5BS2 A;  2VLO A;  4WY4 D;  1FJK A;  1L0N E;  4QMA A;  2K0X A;  1S9K E;  3G4S P;  2WSC J;  1N86 A;  3GW6 A;  3OJA B;  1S5L E;  2LXC B;  1T2K D;  2K2Q A;  4OGQ C;  1EDL A;  3CME P;  3SWK A;  1L4A C;  1M1J A;  2QJY C;  3IF4 A;  1S9K D;  2JJL A;  2KSJ A;  4I6M C;  3OA7 A;  3I5C A;  2WSE H;  5TJH A;  3H6P A;  2V4H A;  3M9H A;  4GT1 A;  2NPS B;  5CBN A;  1KYO H;  2WMM A;  2LL8 A;  3WBH A;  3CXC O;  1LP1 A;  1URQ D;  2VSQ A;  5APS A;  1VQL P;  3SWF A;  2MVU A;  2BHV A;  2H43 A;  3PTZ A;  1LNQ A;  1UJZ A;  5I4T G;  3TDK A;  2L4B A;  2FAE A;  2GUV A;  2OAR A;  4CPG A;  1JJ2 O;  3HE4 B;  2AFE A;  1BGY J;  2G3A A;  2Q7C A;  1QL1 A;  1FZC C;  3KQG A;  4XRO A;  3IFM A;  2YIU C;  1AVO A;  1VKU A;  1OW8 A;  1HY8 A;  1LTG C;  1HUC A;  1M56 D;  4U0E A;  2KG9 A;  3JCU E;  3FWN A;  2KGC A;  1S2E A;  4UB8 E;  4IFD K;  2Q5U A;  2FVF A;  3CD6 P;  3C1L A;  3MZW B;  2HFE D;  3A0H E;  1VQN P;  1EXI A;  2O01 H;  2Q1K A;  1KB9 I;  3RGU A;  5F2N A;  1FZF A;  1X9V A;  1H0T A;  4K35 A;  1LTJ A;  1M1K Q;  1VF5 D;  4AYC A;  3O6Q A;  1HWT C;  3H1L G;  1FE6 A;  2IBZ I;  2R32 A;  1S5L H;  1MKM A;  1RF0 A;  2ROQ A;  1YQ3 C;  2H8P D;  1IZN B;  3M1M A;  2CWO A;  1FZB A;  3KHU A;  2FVA A;  4W7Z A;  5K5G B;  3Q5P A;  2YMY A;  1IUQ A;  3MGE A;  2XV5 A;  1OW7 A;  1K8A Q;  3ZDM A;  1NTZ J;  4GR6 A;  1KIL C;  3PHL A;  2OYI B;  2Y9Y A;  2C0X A;  1U7J A;  1HVV A;  1GU5 A;  2KYV A;  2FQ1 A;  2OYH A;  1RHZ B;  1RQV A;  3HD7 C;  3H1L E;  5BU8 B;  1JOC A;  2ZT9 D;  3OW2 O;  4EOT A;  3M9Q A;  1ZME C;  2V7Q H;  2PFX A;  1SFC C;  1GMJ A;  1X22 A;  2GYK A;  1S72 P;  5CCH A;  2PP6 A;  1RQU A;  3V4Q A;  1PPJ G;  2MR7 A;  2B89 A;  2C0W A;  2P9X A;  5KJ7 D;  3D71 A;  3MIW A;  3CCR P;  3H1L D;  2JGP A;  4IPY A;  2R5D A;  2Z45 A;  3BAT A;  3H1K J;  2K92 A;  1T8K A;  1L4A D;  4BRY B;  3JCU H;  2AF8 A;  3AE1 C;  3QH9 A;  4UB8 H;  3PLN A;  4N6J A;  2IYP A;  1SVF A;  4A7P A;  3L74 G;  1YTZ I;  1XTG B;  1JCD A;  5KP6 B;  3CCS P;  3A0H H;  1LT9 A;  1YBK A;  2GA1 A;  3V2Q A;  3MGN A;  1NO4 A;  2CG5 B;  1Q7Y Q;  1SQP J;  2YO2 A;  1PV3 A;  3JC2 2;  3VTP C;  1GZL A;  1JY3 O;  2N98 A;  5KTB A;  1FC2 C;  1U57 A;  1T8Z A;  3V2R A;  2WQY C;  2XV6 A;  2BUO A;  2YKP A;  1PGQ A;  1CI6 A;  1KQG B;  1RY3 A;  3R4Y A;  4LC1 A;  1NHL A;  1S5L X;  3L74 E;  5AW7 B;  2NPS A;  1BE3 E;  2RKL A;  1K9M Q;  1J1D B;  1H8A A;  1NTM J;  2BAS A;  2MF4 A;  3RG2 A;  4JYC A;  1HJ0 A;  2IZ0 A;  1AA0 A;  1R5L A;  3L74 D;  2N5I A;  2FBW C;  5DJU B;  1BE3 D;  3L72 J;  2BQ1 E;  1VHN A;  1L0L J;  3AEE C;  3CWB G;  3HE4 A;  4EDF A;  1HH0 A;  1SQV K;  2D2C C;  1M8O B;  1VQO P;  5KAI E;  4DOJ A;  5AW3 B;  1X8Y A;  3V2N A;  1R5S A;  1MFT A;  1JO5 A;  2KOD A;  3HUS B;  1M74 A;  1IK7 A;  1ZR2 A;  2K9J B;  1KIL E;  1IFN A;  4EYY Q;  3ABV C;  1NU1 J;  2JB0 A;  3G21 A;  1JY3 N;  3TK1 A;  3GHG B;  1GK4 A;  2BCC G;  1ZNV A;  1FDM A;  2VLP A;  1UNK A;  4I7Z C;  2LKI A;  2LML A;  3L70 E;  1IFM A;  4U3F G;  2NO8 A;  1KIL D;  3CWB E;  3N7N A;  3L75 J;  4D6T J;  1IC2 A;  2WSS H;  1L0L K;  1GXG A;  4NPE A;  1H89 A;  1USE A;  2AXC A;  1SQB J;  1N7L A;  3HD7 D;  2L9F A;  2LR2 A;  3OAK A;  3L70 D;  4WY4 C;  3CWB D;  1VF5 B;  1SFC D;  2H89 C;  2CPB A;  5L8R J;  1M6N A;  1FR2 A;  1VPC A;  4Y28 J;  5AVR B;  2WT7 B;  4U3F E;  2OYI A;  5APY A;  1BDD A;  2OTK E;  1P84 E;  4GDO A;  1FDO A;  2L6E A;  2ZAE B;  3AEA C;  3AE2 C;  3GJN A;  4RO0 A;  2GZG A;  3Q5R A;  2MKV A;  2WTY A;  1N8R Q;  1SQQ J;  5CBO A;  1FAV A;  3BCC G;  2QE7 H;  3FXD A;  1NTK K;  1EOQ A;  1X79 B;  3L73 E;  1FZA A;  2CK3 H;  4U3F D;  2YNY A;  2K0D X;  1SQB K;  1NKN A;  1P84 D;  4N3Y B;  5BU5 A;  2L0Q A;  3H1I E;  2E76 B;  2N50 A;  1S4X A;  5AW2 B;  2FAD A;  3G0V A;  4GOE A;  1URQ C;  3MHV A;  5CHX A;  2P58 A;  3CX5 I;  5KAI H;  4U0A A;  2XZ0 D;  1KOR A;  3L73 D;  3H1H G;  3M0D A;  2N9B A;  3HRN A;  1NOH A;  2M8L A;  3C9I A;  3H1I D;  3LID A;  1EZV E;  1E6J P;  3AE7 C;  4KT0 J;  3EFF K;  5APV A;  3VN0 A;  2QNW A;  3RL0 C;  1M7L A;  4OGQ B;  2W83 C;  2POH A;  4R4M A;  3KYQ A;  5E79 E;  1HBW A;  1L4A B;  2QJY B;  2CNR A;  1SQQ K;  3B5N A;  3WUV A;  5KLV G;  1UII A;  1EZV D;  3NTN A;  3V4W A;  3TYY A;  1Y8A A;  3L71 G;  4R0M A;  3H1J E;  3U1A A;  2JDI H;  1SQX K;  2LOL A;  3BCC D;  1LTI C;  2FKW B;  3EJE A;  3GLM A;  2P7J A;  3H1H E;  1LWU C;  2M3E A;  4BPH A;  2Q3I A;  1PP9 J;  2MR8 A;  1RE4 A;  4IFF A;  4JPZ B;  4GKG A;  2L22 A;  2Z5H A;  3H1H D;  1TU3 F;  4PWV B;  3P8C E;  3M9B A;  3RL0 g;  1PFI A;  3CXH I;  5KLV E;  1FZC B;  3CI9 A;  2E74 D;  3LMO A;  2XZ1 C;  1MZ9 A;  1P84 H;  2YIU B;  1L0N G;  3SWY A;  2WPT A;  1NTK E;  1KQL A;  4Z1M H;  2FYU G;  2N5H A;  1AYI A;  1LTA C;  2XXM A;  4TLF A;  1NWQ A;  1RF1 A;  2Z4E A;  2FFD C;  3BAS A;  3P8C D;  1PGO A;  2MJZ A;  1KV4 A;  3D6Z A;  5KLV D;  4H44 C;  3PJS K;  2YXR B;  5BS1 A;  3G1G A;  1OW6 A;  2EHT A;  1PGP A;  1NTK D;  5EFW B;  4HB1 A;  4BXL A;  2ZFC A;  3HUS A;  3HTK A;  1BCC E;  2N6Z A;  1OVR A;  4ZMD A;  1T3J A;  2ZT9 C;  1A02 F;  2LPK A;  1Q82 Q;  2WPS A;  1NGM B;  2XND H;  2K88 A;  2O01 N;  3GHG A;  3EJD A;  3AEF C;  2AEJ A;  2PEN A;  4BPF A;  4UB6 E;  2FYU E;  5KJ7 C;  1KFM A;  3G6E P;  2JEE A;  3AE3 C;  2KB7 P;  3TNU B;  1FZE A;  5E79 H;  1JCC A;  2Z46 A;  2ZVO B;  1SQX E;  3U1C A;  1RH5 B;  1L0N D;  3RK2 D;  1KIL B;  2I1K A;  2FYU D;  3NXS A;  2QRX A;  4KHX A;  1RE3 C;  2K0Y A;  1ACP A;  1LJ2 A;  5AVS B;  1Y9B A;  2OTL P;  1K05 A;  2PRR A;  1HTL C;  3HD7 B;  1SQX D;  3DS5 A;  3G29 A;  1WMK A;  2WT7 A;  3GKL C;  5CCG D;  2KI7 B;  1XTC C;  2WZ7 A;  1SFC B;  2KZJ A;  4H2X C;  1FDI A;  5APW A;  3HE5 B;  5F2K A;  1PEQ A;  3AEB C;  3JSV C;  1KB9 E;  2YXQ B;  3RL0 D;  3P8M C;  5H2F E;  1Y47 A;  1KN7 A;  2RN0 A;  1JMB A;  4JQ0 D;  4QKO A;  1ZRT E;  2IBZ E;  2C9N Y;  7CEI A;  1W2B O;  1KB9 D;  2NRG A;  2ZVN B;  3GG2 A;  3DPH A;  2KGD A;  5AVY B;  3II6 A;  2L91 A;  1MUU A;  1DV5 A;  5HGL A;  3WU2 E;  2PAJ A;  3E1I A;  2AVA A;  1ZRT D;  2IBZ D;  1K73 Q;  3VP8 A;  2WIT A;  5AVV B;  2K9Y A;  2ZYA A;  1L4A A;  4L75 A;  4JBZ A;  4UB6 H;  3K5B A;  2P10 A;  3UIA A;  2KLU A;  2CPS A;  2JAZ A;  3FX0 A;  1Q86 Q;  1D1D A;  3CE7 A;  1JTH B;  1YJ9 P;  1K04 A;  3RG6 C;  1N2D C;  2PNG A;  2HYN A;  1GW4 A;  1ZOY C;  3WUT A;  3KXD A;  2DNW A;  4ZNC A;  4PJ0 E;  2OGU A;  1JUN A;  1NVO A;  2QA4 P;  3QWO C;  1EDI A;  2A06 G;  4H44 D;  3TF5 A;  1IFP A;  1PIX A;  3AED C;  5AW0 B;  1AUM A;  4H13 C;  2WVR A;  2XU6 A;  2PEQ A;  2W8Z A;  2QIW A;  4GOF A;  2KLV A;  4L73 A;  3P7K A;  2NZ2 A;  2M8P A;  1N73 B;  5AVZ B;  2D2C B;  1FZC A;  3CLQ A;  3NMD A;  2JWD A;  1VL2 A;  2KW2 A;  5AW1 B;  2N6Y A;  2IX7 C;  1QGK B;  2OQQ A;  2B87 B;  1QEX A;  1YTZ T;  2HPC B;  2E74 B;  1SLQ A;  1BGY G;  1HQB A;  3HZQ A;  1KB9 H;  3TGU J;  2GZI A;  3USS A;  2A06 E;  5H2F H;  3CWB J;  4F37 A;  3AE6 C;  4I7Z B;  4W80 A;  4GIF A;  1NTZ K;  2PEM A;  4WBA A;  1PGJ A;  5KP7 B;  1AQ5 A;  3DS1 A;  2W6B A;  1BE3 G;  1KFN A;  3F89 A;  4U0C A;  2JO1 A;  2A06 D;  1IFI A;  3DS0 A;  3A0B E;  3Q1M A;  3A3Y B;  1JM0 A;  3U59 A;  3SFD C;  3WU2 H;  4DCK A;  2GM4 A;  2BCC J;  4WY4 B;  4COC A;  2MVV A;  3GZM A;  1OVU A;  5C39 A;  4WYM A;  1VQ7 P;  1BGY E;  3TNU A;  3MUD C;  2JYL A;  3M0A A;  1JEK A;  2ZXE B;  4Y99 C;  2PEK A;  2QJP C;  5GTH E;  2P67 A;  2Y0E A;  3TSI A;  1KIL A;  3IN6 A;  4U0F A;  1A8O A;  4U7J A;  2O3J A;  1OVV A;  3CCM P;  1BGY D;  1AF8 A;  3AE8 C;  4PJ0 H;  3RK2 B;  1DH3 A;  3HD7 A;  3B8E B;  2J58 A;  4QNB A;  2YKQ A;  3GF7 A;  2WSF H;  2JWA A;  3B71 A;  2JYG A;  1SFC A;  1S1C X;  2CQ8 A;  3DS3 A;  3HE5 A;  1JY3 P;  2KOO A;  1SQP K;  2WSC H;  1URQ B;  1EMV A;  3L70 G;  1ZW0 A;  2YMK A;  1N73 C;  2FQ2 A;  1LTT C;  2LIW A;  3BCC J;  4C46 A;  4PXH B;  3I56 P;  5GTI E;  3KDP B;  2KGA A;  3B5I A;  1WT6 A;  3A7O A;  3RL0 B;  1NTZ E;  2E74 C;  3L37 A;  1NTM K;  1GPJ A;  3A2A A;  2WSE J;  4GOD A;  3H1K G;  2N1T C;  3DS4 A;  4CA3 A;  3B4S A;  1EXJ A;  4XFJ A;  4U0B A;  1T6A A;  4NPF X;  5EW5 E;  1GXH A;  5KP8 B;  1Q81 Q;  1ZMB A;  1NTZ D;  4O9B A;  4OH8 B;  2QM7 A;  1OFC X;  1FOS E;  3A0B H;  1M57 D;  2GZF A;  1LWU B;  2KNC B;  2BEQ D;  4H13 D;  1A02 J;  1E79 H;  1JY2 O;  1PEO A;  1DEB A;  3L35 A;  1JTH A;  2GUS A;  2KP8 A;  3L73 G;  1N7S C;  5AVX B;  2FAC A;  1SQV G;  1W2E A;  3L71 J;  3H1I G;  3HYB A;  5GTH H;  3V2P A;  1IK9 A;  3H1K E;  4ASV A;  3KZI E;  4IZ6 A;  1CSB A;  1NU1 K;  3C8V A;  3CX5 E;  4GR2 A;  1KC8 Q;  1IMP A;  3S9O A;  1YI2 P;  2R5B A;  5F2O A;  5CJ4 A;  1EZV G;  2QEX P;  2FFD B;  1BSN A;  3RK2 C;  1R8E A;  3H1K D;  1N73 A;  3M91 A;  2FYN C;  4XFX A;  4H44 B;  1SQP E;  3AE9 C;  2O01 J;  2JBG A;  1F80 D;  1WRG A;  1T3U A;  3CX5 D;  3IR9 A;  3RBZ A;  3E2D A;  2A45 I;  3L72 G;  2B87 A;  1SQV E;  4WB4 A;  4K3A A;  3S1K A;  1X3O A;  2M0B A;  1L0L G;  1L0N J;  2HPC A;  4NEO A;  2ZT9 B;  1KD1 Q;  5CCG C;  4PV1 D;  2GDY A;  3H1J G;  1AFO A;  2LF4 A;  1SQP D;  4TT3 H;  1VQM P;  2PEI A;  1KTM A;  1W5C E;  4MRT C;  1QVG O;  5APT A;  5GTI H;  1NTM E;  1SQV D;  1ZN5 A;  2RH0 A;  2B88 A;  2Z44 A;  4BRY A;  4W7Y A;  3D70 A;  2ZYG A;  1BSH A;  1JY2 N;  1SP4 A;  1L2P A;  3GMA A;  2JP3 A;  3VMA A;  2LXB A;  4HH2 A;  2G8Y A;  1GL2 C;  1BDC A;  3L72 E;  1CW5 A;  2Q3E A;  1NTM D;  1DX7 A;  3GZL A;  4WY4 A;  1L0L E;  2FYZ A;  3AE5 C;  3CXH E;  2QVA A;  4D6T G;  2SPZ A;  1L0H A;  1NTK G;  3D6Y A;  2V7Q J;  3L72 D;  4PH0 A;  1AJY A;  1L0L D;  4PH1 A;  3CXH D;  1DNY A;  1QX8 A;  5TIS E;  3V5B A;  3H1J D;  1NH4 A;  2E75 C;  3KZI H;  2FXM A;  4AQR D;  1BCC G;  3A5T A;  2Y0C A;  5AVW B;  3FGA D;  4MN4 C;  3T97 B;  1DEE G;  2JO0 A;  3CX5 H;  2KOP A;  1Z6M A;  4XA4 A;  1M1J C;  2ERH A;  3L75 E;  1YIJ P;  4D6T E;  1FZG A;  1FU1 A;  2N1T D;  4BWN A;  2Q6Q A;  4NPD A;  1URQ A;  3FWL A;  4HYT B;  4BPG A;  3Q3D A;  1OR5 A;  2DGY A;  2JU2 A;  1SQB E;  1SQQ G;  3L4F A;  3N4X A;  1QLE D;  2KOS A;  2LTE A;  3CCL P;  3RK3 C;  4ASW A;  1LTB C;  3H25 A;  1SQX G;  4D6T D;  3EJB A;  1M90 Q;  3SSU A;  2FQ0 A;  1KYO I;  2KIK A;  1GK6 A;  1PEM A;  4H2W C;  3EQ2 A;  2K9J A;  1SQB D;  4KJM A;  2N9Y B;  4JF7 A;  4XRQ A;  1N7S D;  2HG5 D;  1YJN P;  3WMM 0;  1YYC A;  4JYB A;  2PEO A;  1SS1 A;  2BEZ F;  3DTJ A;  2PEJ A;  2M3B A;  4HJG H;  1BCC D;  1SQQ E;  3B5N D;  2VLQ A;  2EHS A;  2W6J H;  1LWU A;  2KNC A;  2PGD A;  1AQT A;  5M1B A;  1LT9 B;  1BAJ A;  1J1E B;  2HOD B;  2FXP A;  3G1I A;  1HGV A;  3CPW O;  1GW3 A;  3CXH H;  3H1L J;  5HGO A;  1SQQ D;  3S4R A;  2R3C A;  4RES B;  4H13 B;  3VMX A;  1D7M A;  1YJW P;  3PH0 A;  4N78 E;  1PZQ A;  3LIE A;  1PP9 G;  3MD0 A;  1OZH A;  3M06 A;  2IBZ G;  4R4L A;  2XZR A;  1LTJ C;  3CC2 P;  4DG9 A;  1ZR4 A;  5TIS H;  1GD2 E;  2AFD A;  5APX A;  2ZYD A;  3GF3 A;  1CI6 B;  4I2L C;  1KLP A;  2UWJ E;  2XKM A;  1RF0 C;  1YHQ P;  2FFD A;  4N78 D;  3VP9 A;  2Y9Z A;  1K30 A;  1G2C B;  3CC7 P;  2KG6 A;  4H0L C;  2WPR A;  4LLH A;  2H88 C;  1GL2 D;  1OMI A;  1USD A;  4YXW H;  5KKZ C;  1UIX A;  2CGQ A;  1PP9 E;  2K3R A;  4OWF A;  2XDJ A;  3EWK A;  1EDK A;  1QRJ A;  3G3Z A;  2OYH C;  1X0T A;  1IJD B;  3E1R A;  5KJ7 A;  4PV1 B;  3RBX A;  1PP9 D;  4WVZ A;  2RMZ A;  5CCH C;  4XFY A;  1OIP A;  2K93 A;  4Y99 B;  2QJP B;  3BVH A;  2E75 D;  3L74 J;  2ONT A;  1ZLL A;  1BE3 J;  2XNX A;  2DW3 A;  2OYO A;  2QJK C;  3RK3 E;  1RE3 A;  5AW6 B;  1JNM A;  2K37 A;  3PP5 A;  3ITK A;  3CCU P;  3CCV P;  2GZJ A;  3AE4 C;  3O8Z A;  5B66 E;  3Q20 A;  5APQ A;  1LT9 C;  1J1E C;  3FXE A;  2QM8 A;  3RK3 D;  2LIU A;  4DZO A;  2OTJ P;  4H2Y C;  2FHS C;  2B9B A;  3NFQ A;  3T97 A;  1LGH B;  5B5E E;  1VQ9 P;  1EIA A;  3LW5 H;  1GU4 A;  2WPQ A;  3H32 B;  2GZE A;  4PD4 E;  1VQ4 P;  5HGN A;  2KR5 A;  2ITA A;  1U7M A;  2E5T A;  3MP7 B;  3E7K A;  4DT0 A;  2EG5 A;  3BRT B;  2NPS C;  5HGM A;  2E76 D;  2PY8 A;  1ZP0 C;  3L70 J;  1DIP A;  2N1T B;  2KSE A;  2J5U A;  2Y0D A;  4PD4 D;  1Q90 D;  4WWI A;  3I55 P;  3U43 A;  1KQF B;  1JB0 J;  1G1I A;  2O1K A;  2QSI A;  1HGZ A;  4YTP C;  1IMQ A;  4PD4 I;  2JKV A;  4UHP B;  1EC5 A;  2LKM A;  2E43 A;  2YKO A;  5AW4 B;  4OGQ D;  4ZKP A;  2KOR A;  4PV1 C;  1N7S B;  2GDX A;  3VMZ A;  3Q5S A;  5AW8 B;  2L5G B;  3W67 A;  4U3F J;  2HOD A;  5AVQ B;  2VRS A;  1J2J B;  4XE5 B;  1CEI A;  3B5N B;  3CL3 D;  1PPJ E;  4H0L D;  2MD9 A;  5DJT B;  3L73 J;  2J59 M;  1IFD A;  2IFN A;  3SFE C;  5B66 H;  2H7H A;  2K94 A;  1SQV J;  2FYN B;  4RJT A;  4IL6 E;  3CC4 P;  3H1I J;  1GDT A;  4IFM A;  3VMY A;  1NTZ G;  1BXI A;  3AEG C;  4C7N B;  2M8N A;  2IPP A;  1NAY A;  1NJI Q;  1PPJ D;  2P1J A;  2FVE A;  1MFZ A;  2KUB A;  1EDJ A;  5B5E H;  3IAO A;  3H0D A;  1HJB A;  1G2C A;  5AVT B;  2EFJ A;  5EJD A;  1VQP P;  1H88 A;  5CCH D;  4ZKU A;  3CCQ P;  4PD4 H;  1OX3 A;  1FJP A;  2YO3 A;  2I8D A;  2ZJS E;  1RO0 A;  1VQK P;  1G1J A;  1YIT P;  2OYI C;  1FS0 E;  1ZV8 A;  2W90 A;  5CMZ A;  3TGU G;  1RF1 B;  1ZXG A;  1JMM A;  2KS1 B;  3F5H A;  1GL2 B;  3VRL C;  2A45 G;  3H1J J;  2GDW A;  2FXO A;  2M5A B;  3H1H J;  1MV8 A;  2E1M A;  2KOQ A;  2KK7 A;  1OXZ A; 
#chains in the Genus database with same CATH homology
 3G29 A;  3P05 A;  2L6E A;  3CCM P;  1BAJ A;  4M0I A;  3CCE P;  3G1I A;  3HYB A;  1S72 P;  1RNI A;  3CPW O;  4XRO A;  2BQ1 E;  1N8R Q;  4PH0 A;  1AUM A;  2P9X A;  4U0E A;  1EOQ A;  2PEQ A;  5HGO A;  4PH1 A;  3CCR P;  3CCU P;  1VQO P;  4QNB A;  3CCV P;  5JPA A;  5F2K A;  1PEQ A;  2M8P A;  1YJW P;  2JYG A;  2QA4 P;  3H4E A;  4GR2 A;  1KC8 Q;  4IPY A;  3CD6 P;  2XXM A;  5BS2 A;  2Z45 A;  3Q20 A;  1YI2 P;  3G0V A;  4U0D A;  3DS3 A;  5F2O A;  1A43 A;  2KOD A;  2QEX P;  1VQ8 P;  1M74 A;  3CC2 P;  1VQN P;  4U0A A;  2JO0 A;  2OTJ P;  5BS1 A;  4XFX A;  3G1G A;  3G4S P;  1M6E X;  5F2N A;  1YIJ P;  3G21 A;  3HZQ A;  3CC4 P;  1YHQ P;  3CCS P;  4COP A;  3E2D A;  2M8L A;  3DS2 A;  1E6J P;  1W2B O;  1VQ9 P;  2M8N A;  1EIA A;  1Q82 Q;  1NJI Q;  3I56 P;  1K30 A;  2DGY A;  1M1K Q;  1KQS O;  3CC7 P;  3CME P;  1Q7Y Q;  3DPH A;  3CCL P;  1KD1 Q;  3NTE A;  1VQ4 P;  3B5I A;  2LF4 A;  1PEU A;  2PEM A;  1VQM P;  5HGN A;  1RO2 A;  2PEN A;  1VQ6 P;  3H0D A;  2PEI A;  5HGL A;  3G28 A;  3M1M A;  2CWO A;  2EG5 A;  3DS1 A;  1M90 Q;  1QVG O;  2XT1 A;  5HGM A;  2EFJ A;  1VQP P;  3G26 A;  3G6E P;  2PY8 A;  5DCK A;  4U0C A;  1PEM A;  1K73 Q;  3CCQ P;  3DS4 A;  2XV6 A;  2Z44 A;  3DS0 A;  2BUO A;  1QRJ A;  3H47 A;  1IUQ A;  3MGE A;  1A8O A;  1RO0 A;  4U0B A;  1VQK P;  3WBH A;  4XRQ A;  1YIT P;  2Z46 A;  3CXC O;  1K8A Q;  4GR6 A;  4COC A;  3I55 P;  1YJN P;  1VQL P;  4WYM A;  1ZMB A;  1Q81 Q;  1VQ7 P;  2PEO A;  1Q86 Q;  1D1D A;  2BHV A;  2EIA A;  1K9M Q;  1YJ9 P;  3RG6 C;  4XFZ A;  1M6N A;  2JYL A;  3DTJ A;  2PEJ A;  1QVF O;  5I4T G;  3VRL C;  2PEK A;  4XFY A;  2OAR A;  3CCJ P;  1PEO A;  2OTL P;  3LRY A;  3OW2 O;  3G71 P;  1JJ2 O;  4U0F A;  3CMA P;  2E1M A;  2ONT A;  1VQ5 P;  3DS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...