4BPGA

Crystal structure of bacillus subtilis dltc
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
79
Chain Sequence
MDFKQEVLDVLAEVCQDDIVKENPDIEIFEEGLLDFGTVELLLAIENRFDILVPITEFDRDVWNTPNNIVNQLSELKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Structures of the D-Alanyl Carrier Protein (Dcp) Dltc from Bacillus Subtilis Reveal Equivalent Conformations of Apo- and Holo-Forms
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
molecule keywords D-ALANINE--POLY(PHOSPHORIBITOL) LIGASE SUBUNIT 2
total genus 24
structure length 79
sequence length 80
chains with identical sequence B
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2013-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4bpgA00
2QNWA 1HY8A 4IZ6A 2AF8A 2FADA 4NEOA 2ROQA 2MR7A 2PNGA 2EHSA 2AFEA 2FQ1A 3RG2A 2K0YA 2L22A 2AVAA 1L0IA 2KGDA 2GDYA 3EJDA 4MRTC 2FQ2A 2KOPA 2X2BA 2N5IA 2KOSA 3NY7B 2N6ZA 2FVEA 4DG9A 3CE7A 2KOOA 2MD9A 4BPGA 2KW2A 2EHTA 2N50A 3GZMA 5KP6B 2M5RA 2KGAA 2MR8A 5EJDA 4BPFA 2LOLA 2AFDA 2LIWA 1OR5A 4PXHB 2JU1A 2JU2A 2K93A 2FVAA 2JQ4A 5HVCA 2KGEA 2FAEA 1ACPA 5KP8B 2LL8A 2MVUA 4BPHA 2K92A 2N98A 5KP7B 2KGCA 1VKUA 2K2QA 4H2XC 1F80D 2XZ0D 2FVFA 2GDXA 2KG8A 2MF4A 2VSQA 3EJBA 1HQBA 2MY5A 1AF8A 1X3OA 1DNYA 2K0XA 2N5HA 2FACA 2KOQA 2KORA 2XZ1C 2LPKA 2L4BA 2LMLA 2KWLA 2KG9A 1DV5A 1L0HA 5HV8A 5CZDB 2GDWA 2CNRA 2FQ0A 1NQ4A 3EJEA 2L0QA 2MVVA 4CA3A 2KG6A 2LTEA 3GZLA 2CGQA 2DNWA 2FHSC 3LMOA 2JGPA 2CG5B 4HKGA 2L9FA 4R0MA 2KR5A 4H2YC 2K94A 2CQ8A 2N6YA 1T8KA 1KLPA 4H2WC 2LIUA 4PWVB 2LKIA
chains in the Genus database with same CATH superfamily
2JAZA 2ROQA 2EHSA 2XXMA 1AUMA 1L0IA 2VLQA 4WYMA 3EJDA 1VQ4P 4MRTC 1IMPA 3CCEP 3E2DA 2KOPA 1N8RQ 2N5IA 1VQNP 3NY7B 4QNBA 5BS2A 2KOOA 4XFZA 2N50A 1JJ2O 4GR6A 1AYIA 3H4EA 2KGAA 3I56P 1A8OA 1GXHA 2AFDA 2LIWA 1KD1Q 1M74A 1VQPP 2FAEA 5KP8B 2LL8A 4GR2A 3G71P 4BPHA 4U0DA 5F2NA 1W2BO 1MZ8A 5KP7B 3G4SP 2KGCA 2K2QA 3DS3A 2GDXA 3G26A 2KODA 2P9XA 1HQBA 2GZEA 1DNYA 3G21A 7CEIA 2FACA 4XRQA 2KORA 3I55P 1E6JP 2L4BA 1GXGA 3G1GA 1M90Q 3CC4P 2PEOA 1YJWP 1L0HA 5HV8A 3DS1A 5CZDB 4U0EA 2PEIA 2KG6A 1K9MQ 4HKGA 1RO0A 2EFJA 1QRJA 2JO0A 4UHPB 3CC7P 4COPA 2QNWA 3Q20A 4IZ6A 2AF8A 4U0CA 5I4TG 2PNGA 2K0YA 2L22A 2AVAA 1YI2P 2KGDA 1A43A 3DS2A 2OARA 1VQLP 1EIAA 1BAJA 2KOSA 3H47A 2ERHA 5EW5E 2NO8A 2FVEA 2MD9A 4BPGA 2Z44A 1Q86Q 2KW2A 3GZMA 1FR2A 1YHQP 1YJ9P 1M1KQ 1IUQA 3U43A 2MR8A 3CD6P 4U0AA 3G28A 4XFYA 1K73Q 2GZJA 4PXHB 2JU1A 2JU2A 2K93A 2JQ4A 1S72P 3VRLC 2ONTA 2K0DX 3CCLP 1M6EX 2PEMA 1VKUA 3DS5A 4PH1A 2PEKA 1F80D 2XZ0D 2FVFA 2OTJP 4COCA 2MF4A 2MY5A 1UNKA 4XROA 2XZ1C 2K5XA 2JYGA 5F2KA 1VQMP 3B5IA 1VQ9P 1KC8Q 2VLPA 2L6EA 2KG9A 2GDWA 2CNRA 2PY8A 2M8LA 2BUOA 1NQ4A 2GZIA 3B4QA 3EJEA 4CA3A 4U0BA 1VQOP 2DNWA 2FHSC 2JGPA 2DGYA 1GPJA 2KR5A 1BXIA 2K94A 1QVFO 2N6YA 1T8KA 1KLPA 2LIUA 1HY8A 4M0IA 1Q81Q 3CCRP 2E1MA 4NEOA 2GYKA 1VQ6P 2MR7A 2FQ1A 5HGMA 3RG2A 1CEIA 5F2OA 1VHNA 2M8NA 1D1DA 1YIJP 2N6ZA 1Q82Q 5BS1A 2EHTA 3P05A 2EG5A 5KP6B 2OTLP 2BHVA 2PENA 1ZMBA 4XFXA 1M6NA 5EJDA 2LOLA 3HYBA 1OR5A 2CWOA 1KQSO 3DS4A 5HVCA 2PEQA 2GZFA 2LF4A 2XT1A 3HZQA 4U0FA 3CMEP 2K92A 2N98A 3CMAP 3NTEA 1VQ5P 4IPYA 1QVGO 1ZNVA 4QKOA 1IMQA 2KG8A 2QEXP 1YITP 2VSQA 3EJBA 2Z45A 1X3OA 3GJNA 1RNIA 3OW2O 2XV6A 2LPKA 2LMLA 2QA4P 1UJZA 3G1IA 2FQ0A 2L0QA 3GZLA 1VQ7P 3LMOA 2WPTA 4R0MA 2JYLA 4H2YC 2CQ8A 4H2WC 4PWVB 3G29A 3WBHA 2JBGA 3CXCO 1NJIQ 3CCUP 2FADA 3RG6C 2AFEA 3M1MA 1RO2A 3CCMP 5JPAA 2GDYA 2FQ2A 2X2BA 4F37A 3CC2P 4DG9A 3CE7A 1VQ8P 5DCKA 2Z46A 2M8PA 2M5RA 3CPWO 5HGLA 4BPFA 3CCSP 4PH0A 1Q7YQ 2EIAA 5HGNA 2FVAA 2GZGA 3CCQP 2KGEA 1ACPA 2PEJA 2MVUA 1Z6MA 1K8AQ 5HGOA 4H2XC 1YJNP 1K30A 1AF8A 3GKLC 1E0HA 1EMVA 2K0XA 2N5HA 3DPHA 3LRYA 3MGEA 3G0VA 2KOQA 3G6EP 3CCJP 2JB0A 3CCVP 3DTJA 2KWLA 1DV5A 3DS0A 2MVVA 2LTEA 1EOQA 2CGQA 2VLNA 3H0DA 2CG5B 1VQKP 2L9FA 2VLOA 2LKIA
chains in the Genus database with same CATH topology
2QNWA 1HY8A 4IZ6A 2AF8A 2FADA 4NEOA 2ROQA 2MR7A 2PNGA 2EHSA 2AFEA 2FQ1A 3RG2A 2K0YA 2L22A 2AVAA 1L0IA 2KGDA 2GDYA 3EJDA 4MRTC 2FQ2A 2KOPA 2X2BA 2N5IA 2KOSA 3NY7B 2N6ZA 2FVEA 4DG9A 3CE7A 2KOOA 2MD9A 4BPGA 2KW2A 2EHTA 2N50A 3GZMA 5KP6B 2M5RA 2KGAA 2MR8A 5EJDA 4BPFA 2LOLA 2AFDA 2LIWA 1OR5A 4PXHB 2JU1A 2JU2A 2K93A 2FVAA 2JQ4A 5HVCA 2KGEA 2FAEA 1ACPA 5KP8B 2LL8A 2MVUA 4BPHA 2K92A 2N98A 5KP7B 2KGCA 1VKUA 2K2QA 4H2XC 1F80D 2XZ0D 2FVFA 2GDXA 2KG8A 2MF4A 2VSQA 3EJBA 1HQBA 2MY5A 1AF8A 1X3OA 1DNYA 2K0XA 2N5HA 2FACA 2KOQA 2KORA 2XZ1C 2LPKA 2L4BA 2LMLA 2KWLA 2KG9A 1DV5A 1L0HA 5HV8A 5CZDB 2GDWA 2CNRA 2FQ0A 1NQ4A 3EJEA 2L0QA 2MVVA 4CA3A 2KG6A 2LTEA 3GZLA 2CGQA 2DNWA 2FHSC 3LMOA 2JGPA 2CG5B 4HKGA 2L9FA 4R0MA 2KR5A 4H2YC 2K94A 2CQ8A 2N6YA 1T8KA 1KLPA 4H2WC 2LIUA 4PWVB 2LKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QNW A;  1HY8 A;  4IZ6 A;  2AF8 A;  2FAD A;  4NEO A;  2ROQ A;  2MR7 A;  2PNG A;  2EHS A;  2AFE A;  2FQ1 A;  3RG2 A;  2K0Y A;  2L22 A;  2AVA A;  1L0I A;  2KGD A;  2GDY A;  3EJD A;  4MRT C;  2FQ2 A;  2KOP A;  2X2B A;  2N5I A;  2KOS A;  3NY7 B;  2N6Z A;  2FVE A;  4DG9 A;  3CE7 A;  2KOO A;  2MD9 A;  4BPG A;  2KW2 A;  2EHT A;  2N50 A;  3GZM A;  5KP6 B;  2M5R A;  2KGA A;  2MR8 A;  5EJD A;  4BPF A;  2LOL A;  2AFD A;  2LIW A;  1OR5 A;  4PXH B;  2JU1 A;  2JU2 A;  2K93 A;  2FVA A;  2JQ4 A;  5HVC A;  2KGE A;  2FAE A;  1ACP A;  5KP8 B;  2LL8 A;  2MVU A;  4BPH A;  2K92 A;  2N98 A;  5KP7 B;  2KGC A;  1VKU A;  2K2Q A;  4H2X C;  1F80 D;  2XZ0 D;  2FVF A;  2GDX A;  2KG8 A;  2MF4 A;  2VSQ A;  3EJB A;  1HQB A;  2MY5 A;  1AF8 A;  1X3O A;  1DNY A;  2K0X A;  2N5H A;  2FAC A;  2KOQ A;  2KOR A;  2XZ1 C;  2LPK A;  2L4B A;  2LML A;  2KWL A;  2KG9 A;  1DV5 A;  1L0H A;  5HV8 A;  5CZD B;  2GDW A;  2CNR A;  2FQ0 A;  1NQ4 A;  3EJE A;  2L0Q A;  2MVV A;  4CA3 A;  2KG6 A;  2LTE A;  3GZL A;  2CGQ A;  2DNW A;  2FHS C;  3LMO A;  2JGP A;  2CG5 B;  4HKG A;  2L9F A;  4R0M A;  2KR5 A;  4H2Y C;  2K94 A;  2CQ8 A;  2N6Y A;  1T8K A;  1KLP A;  4H2W C;  2LIU A;  4PWV B;  2LKI A; 
#chains in the Genus database with same CATH topology
 2JAZ A;  2ROQ A;  2EHS A;  2XXM A;  1AUM A;  1L0I A;  2VLQ A;  4WYM A;  3EJD A;  1VQ4 P;  4MRT C;  1IMP A;  3CCE P;  3E2D A;  2KOP A;  1N8R Q;  2N5I A;  1VQN P;  3NY7 B;  4QNB A;  5BS2 A;  2KOO A;  4XFZ A;  2N50 A;  1JJ2 O;  4GR6 A;  1AYI A;  3H4E A;  2KGA A;  3I56 P;  1A8O A;  1GXH A;  2AFD A;  2LIW A;  1KD1 Q;  1M74 A;  1VQP P;  2FAE A;  5KP8 B;  2LL8 A;  4GR2 A;  3G71 P;  4BPH A;  4U0D A;  5F2N A;  1W2B O;  1MZ8 A;  5KP7 B;  3G4S P;  2KGC A;  2K2Q A;  3DS3 A;  2GDX A;  3G26 A;  2KOD A;  2P9X A;  1HQB A;  2GZE A;  1DNY A;  3G21 A;  7CEI A;  2FAC A;  4XRQ A;  2KOR A;  3I55 P;  1E6J P;  2L4B A;  1GXG A;  3G1G A;  1M90 Q;  3CC4 P;  2PEO A;  1YJW P;  1L0H A;  5HV8 A;  3DS1 A;  5CZD B;  4U0E A;  2PEI A;  2KG6 A;  1K9M Q;  4HKG A;  1RO0 A;  2EFJ A;  1QRJ A;  2JO0 A;  4UHP B;  3CC7 P;  4COP A;  2QNW A;  3Q20 A;  4IZ6 A;  2AF8 A;  4U0C A;  5I4T G;  2PNG A;  2K0Y A;  2L22 A;  2AVA A;  1YI2 P;  2KGD A;  1A43 A;  3DS2 A;  2OAR A;  1VQL P;  1EIA A;  1BAJ A;  2KOS A;  3H47 A;  2ERH A;  5EW5 E;  2NO8 A;  2FVE A;  2MD9 A;  4BPG A;  2Z44 A;  1Q86 Q;  2KW2 A;  3GZM A;  1FR2 A;  1YHQ P;  1YJ9 P;  1M1K Q;  1IUQ A;  3U43 A;  2MR8 A;  3CD6 P;  4U0A A;  3G28 A;  4XFY A;  1K73 Q;  2GZJ A;  4PXH B;  2JU1 A;  2JU2 A;  2K93 A;  2JQ4 A;  1S72 P;  3VRL C;  2ONT A;  2K0D X;  3CCL P;  1M6E X;  2PEM A;  1VKU A;  3DS5 A;  4PH1 A;  2PEK A;  1F80 D;  2XZ0 D;  2FVF A;  2OTJ P;  4COC A;  2MF4 A;  2MY5 A;  1UNK A;  4XRO A;  2XZ1 C;  2K5X A;  2JYG A;  5F2K A;  1VQM P;  3B5I A;  1VQ9 P;  1KC8 Q;  2VLP A;  2L6E A;  2KG9 A;  2GDW A;  2CNR A;  2PY8 A;  2M8L A;  2BUO A;  1NQ4 A;  2GZI A;  3B4Q A;  3EJE A;  4CA3 A;  4U0B A;  1VQO P;  2DNW A;  2FHS C;  2JGP A;  2DGY A;  1GPJ A;  2KR5 A;  1BXI A;  2K94 A;  1QVF O;  2N6Y A;  1T8K A;  1KLP A;  2LIU A;  1HY8 A;  4M0I A;  1Q81 Q;  3CCR P;  2E1M A;  4NEO A;  2GYK A;  1VQ6 P;  2MR7 A;  2FQ1 A;  5HGM A;  3RG2 A;  1CEI A;  5F2O A;  1VHN A;  2M8N A;  1D1D A;  1YIJ P;  2N6Z A;  1Q82 Q;  5BS1 A;  2EHT A;  3P05 A;  2EG5 A;  5KP6 B;  2OTL P;  2BHV A;  2PEN A;  1ZMB A;  4XFX A;  1M6N A;  5EJD A;  2LOL A;  3HYB A;  1OR5 A;  2CWO A;  1KQS O;  3DS4 A;  5HVC A;  2PEQ A;  2GZF A;  2LF4 A;  2XT1 A;  3HZQ A;  4U0F A;  3CME P;  2K92 A;  2N98 A;  3CMA P;  3NTE A;  1VQ5 P;  4IPY A;  1QVG O;  1ZNV A;  4QKO A;  1IMQ A;  2KG8 A;  2QEX P;  1YIT P;  2VSQ A;  3EJB A;  2Z45 A;  1X3O A;  3GJN A;  1RNI A;  3OW2 O;  2XV6 A;  2LPK A;  2LML A;  2QA4 P;  1UJZ A;  3G1I A;  2FQ0 A;  2L0Q A;  3GZL A;  1VQ7 P;  3LMO A;  2WPT A;  4R0M A;  2JYL A;  4H2Y C;  2CQ8 A;  4H2W C;  4PWV B;  3G29 A;  3WBH A;  2JBG A;  3CXC O;  1NJI Q;  3CCU P;  2FAD A;  3RG6 C;  2AFE A;  3M1M A;  1RO2 A;  3CCM P;  5JPA A;  2GDY A;  2FQ2 A;  2X2B A;  4F37 A;  3CC2 P;  4DG9 A;  3CE7 A;  1VQ8 P;  5DCK A;  2Z46 A;  2M8P A;  2M5R A;  3CPW O;  5HGL A;  4BPF A;  3CCS P;  4PH0 A;  1Q7Y Q;  2EIA A;  5HGN A;  2FVA A;  2GZG A;  3CCQ P;  2KGE A;  1ACP A;  2PEJ A;  2MVU A;  1Z6M A;  1K8A Q;  5HGO A;  4H2X C;  1YJN P;  1K30 A;  1AF8 A;  3GKL C;  1E0H A;  1EMV A;  2K0X A;  2N5H A;  3DPH A;  3LRY A;  3MGE A;  3G0V A;  2KOQ A;  3G6E P;  3CCJ P;  2JB0 A;  3CCV P;  3DTJ A;  2KWL A;  1DV5 A;  3DS0 A;  2MVV A;  2LTE A;  1EOQ A;  2CGQ A;  2VLN A;  3H0D A;  2CG5 B;  1VQK P;  2L9F A;  2VLO A;  2LKI A; 
#chains in the Genus database with same CATH homology
 2QNW A;  1HY8 A;  4IZ6 A;  2AF8 A;  2FAD A;  4NEO A;  2ROQ A;  2MR7 A;  2PNG A;  2EHS A;  2AFE A;  2FQ1 A;  3RG2 A;  2K0Y A;  2L22 A;  2AVA A;  1L0I A;  2KGD A;  2GDY A;  3EJD A;  4MRT C;  2FQ2 A;  2KOP A;  2X2B A;  2N5I A;  2KOS A;  3NY7 B;  2N6Z A;  2FVE A;  4DG9 A;  3CE7 A;  2KOO A;  2MD9 A;  4BPG A;  2KW2 A;  2EHT A;  2N50 A;  3GZM A;  5KP6 B;  2M5R A;  2KGA A;  2MR8 A;  5EJD A;  4BPF A;  2LOL A;  2AFD A;  2LIW A;  1OR5 A;  4PXH B;  2JU1 A;  2JU2 A;  2K93 A;  2FVA A;  2JQ4 A;  5HVC A;  2KGE A;  2FAE A;  1ACP A;  5KP8 B;  2LL8 A;  2MVU A;  4BPH A;  2K92 A;  2N98 A;  5KP7 B;  2KGC A;  1VKU A;  2K2Q A;  4H2X C;  1F80 D;  2XZ0 D;  2FVF A;  2GDX A;  2KG8 A;  2MF4 A;  2VSQ A;  3EJB A;  1HQB A;  2MY5 A;  1AF8 A;  1X3O A;  1DNY A;  2K0X A;  2N5H A;  2FAC A;  2KOQ A;  2KOR A;  2XZ1 C;  2LPK A;  2L4B A;  2LML A;  2KWL A;  2KG9 A;  1DV5 A;  1L0H A;  5HV8 A;  5CZD B;  2GDW A;  2CNR A;  2FQ0 A;  1NQ4 A;  3EJE A;  2L0Q A;  2MVV A;  4CA3 A;  2KG6 A;  2LTE A;  3GZL A;  2CGQ A;  2DNW A;  2FHS C;  3LMO A;  2JGP A;  2CG5 B;  4HKG A;  2L9F A;  4R0M A;  2KR5 A;  4H2Y C;  2K94 A;  2CQ8 A;  2N6Y A;  1T8K A;  1KLP A;  4H2W C;  2LIU A;  4PWV B;  2LKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...