4BPGA

Crystal structure of bacillus subtilis dltc
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
79
Chain Sequence
MDFKQEVLDVLAEVCQDDIVKENPDIEIFEEGLLDFGTVELLLAIENRFDILVPITEFDRDVWNTPNNIVNQLSELKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ALANINE--POLY(PHOSPHORIBITOL) LIGASE SUBUNIT 2
publication title High-Resolution Structures of the D-Alanyl Carrier Protein (Dcp) Dltc from Bacillus Subtilis Reveal Equivalent Conformations of Apo- and Holo-Forms
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 24
structure length 79
sequence length 80
chains with identical sequence B
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2013-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4bpgA00
5KP8B 2MF4A 2MVVA 4DG9A 2KGEA 5KP6B 2EHSA 2CGQA 2ROQA 2N98A 2LMLA 1F80D 4NEOA 2M5RA 2LL8A 1L0IA 2L9FA 2L4BA 2KG8A 1L0HA 2PNGA 2LIWA 1T8KA 2AF8A 2GDXA 2LOLA 4MRTC 2K92A 2EHTA 3GZMA 2MR8A 3NY7B 2MD9A 2FADA 1OR5A 2MVUA 2AFEA 2XZ0D 3EJEA 4H2YC 2K0XA 3EJBA 1HQBA 2N6YA 2CQ8A 2AVAA 2KGAA 2N5IA 2VSQA 2GDYA 2XZ1C 2CG5B 2FQ1A 2L0QA 2QNWA 2JGPA 2X2BA 2N50A 1DV5A 5HV8A 4BPHA 4CA3A 2LKIA 2FQ2A 3GZLA 4BPGA 1DNYA 2K94A 5KP7B 2DNWA 1AF8A 5HVCA 2MR7A 2CNRA 2KG9A 2KGDA 3RG2A 4BPFA 2K2QA 1VKUA 2KOSA 3CE7A 4IZ6A 3EJDA 1ACPA 2FAEA 4H2WC 4PWVB 2KOOA 2FQ0A 5CZDB 2FHSC 2MY5A 2N6ZA 4R0MA 2KOPA 2GDWA 2KORA 5EJDA 2N5HA 2FVFA 4HKGA 2JU2A 2JQ4A 2FACA 2LTEA 2K0YA 2JU1A 2KR5A 2KWLA 3LMOA 1X3OA 2AFDA 2LPKA 2KW2A 2KOQA 2KG6A 4H2XC 2L22A 2LIUA 4PXHB 1NQ4A 2KGCA 1HY8A 2FVEA 2K93A 1KLPA 2FVAA
chains in the Genus database with same CATH superfamily
5KP8B 3HZQA 1VQOP 3CCSP 2MF4A 1A8OA 4M0IA 1VQ7P 2MVVA 2K0DX 4XRQA 2EHSA 2VLOA 3G1GA 1RO0A 2JB0A 2NO8A 2PEQA 1RO2A 2GDXA 2M8NA 2MR8A 3NY7B 2MD9A 2OARA 4PH1A 2XZ0D 3I55P 1VQLP 1EMVA 2K0XA 1M74A 1IMPA 2K5XA 2GDYA 4QNBA 2GZEA 3G21A 2JGPA 1DV5A 1E0HA 5HV8A 1K73Q 2LKIA 2BHVA 3GZLA 1DNYA 1CEIA 1Q81Q 2JBGA 2K94A 1AF8A 5HVCA 2CNRA 3H47A 2KG9A 1YITP 4GR6A 2GZJA 1VKUA 4IZ6A 2VLQA 2FAEA 3G1IA 1ZNVA 3DTJA 2MY5A 3B4QA 1K30A 3G4SP 2L6EA 5BS1A 5F2NA 3CMAP 5EJDA 1KD1Q 2Z45A 3H0DA 2JU2A 2LTEA 2KR5A 1M1KQ 1MZ8A 7CEIA 3CCQP 1EIAA 5EW5E 1VQ9P 1ZMBA 2OTLP 1X3OA 4H2XC 2VLNA 2M8LA 2LIUA 1NQ4A 4COCA 1HY8A 4U0BA 2JYLA 2FVAA 4UHPB 3WBHA 1VQ6P 3LRYA 1QVGO 2KODA 4DG9A 2KGEA 2CGQA 2LMLA 1F80D 2LL8A 2L9FA 4F37A 1L0HA 1AUMA 1GXGA 2K92A 2EHTA 3GZMA 1FR2A 3E2DA 5JPAA 4U0AA 1VQNP 3EJBA 3G71P 1K8AQ 3P05A 2AVAA 2KGAA 1EOQA 3DS5A 2ONTA 4GR2A 2XXMA 2N50A 2Z44A 5HGLA 3CC7P 4WYMA 1QRJA 5KP7B 2GZGA 1KC8Q 3G6EP 3U43A 2KGDA 2KOSA 3CE7A 1UJZA 3DS3A 2FQ0A 1S72P 2FHSC 2N6ZA 2E1MA 3CCJP 3Q20A 2PEKA 4U0FA 2FVFA 3MGEA 3CCRP 2JYGA 2FACA 4COPA 1AYIA 2VLPA 3LMOA 2L22A 3H4EA 1VQ4P 2KGCA 2FVEA 4XFZA 1M6NA 1UNKA 2PENA 2EFJA 2P9XA 4XFXA 5KP6B 1Q7YQ 1D1DA 2ROQA 2N98A 1IMQA 4NEOA 2XV6A 2ERHA 1L0IA 3CD6P 2L4BA 1RNIA 2GZIA 2PNGA 2AF8A 2LOLA 4MRTC 3CC4P 1M90Q 1N8RQ 4H2YC 5BS2A 3DS0A 1HQBA 3CCUP 3CPWO 2N5IA 2VSQA 2EIAA 2DGYA 2CG5B 1YI2P 2FQ1A 2L0QA 4CA3A 5I4TG 4BPGA 4XROA 3G29A 3RG6C 2Z46A 3HYBA 2MR7A 3RG2A 1VQKP 1BAJA 1ACPA 3EJDA 1GXHA 3CCVP 3DPHA 1W2BO 2KOOA 2QA4P 1IUQA 1Q82Q 1YJWP 5CZDB 1YJNP 3B5IA 3CCLP 2GDWA 5F2KA 2KORA 3CMEP 1BXIA 1Z6MA 4HKGA 1VQ5P 4U0EA 2KWLA 2JAZA 2PEMA 2LF4A 5HGMA 4BPHA 2AFDA 2LPKA 2KOQA 4PXHB 2XT1A 1VHNA 2K93A 1KLPA 3M1MA 5HGNA 1VQPP 4U0DA 1M6EX 2PEOA 4PH0A 3DS2A 2M5RA 3CCMP 2OTJP 3NTEA 2KG8A 1GPJA 5HGOA 1VQ8P 4IPYA 2LIWA 3G28A 1T8KA 3GKLC 2PY8A 2FADA 1OR5A 2MVUA 2AFEA 1K9MQ 3EJEA 3GJNA 2GYKA 1Q86Q 2N6YA 2CQ8A 2BUOA 3I56P 3G0VA 2GZFA 3OW2O 1A43A 1NJIQ 2XZ1C 2QEXP 2QNWA 2X2BA 1JJ2O 3G26A 2FQ2A 2EG5A 4QKOA 1KQSO 1YIJP 2PEJA 2DNWA 4U0CA 4BPFA 3DS4A 2K2QA 5DCKA 2JO0A 4H2WC 4PWVB 2CWOA 4R0MA 2KOPA 1VQMP 2M8PA 3DS1A 2N5HA 3CXCO 1QVFO 2JQ4A 1YJ9P 1YHQP 2K0YA 2JU1A 1E6JP 3VRLC 3CCEP 2KW2A 2KG6A 2PEIA 5F2OA 3CC2P 4XFYA 2WPTA
chains in the Genus database with same CATH topology
5KP8B 2MF4A 2MVVA 4DG9A 2KGEA 5KP6B 2EHSA 2CGQA 2ROQA 2N98A 2LMLA 1F80D 4NEOA 2M5RA 2LL8A 1L0IA 2L9FA 2L4BA 2KG8A 1L0HA 2PNGA 2LIWA 1T8KA 2AF8A 2GDXA 2LOLA 4MRTC 2K92A 2EHTA 3GZMA 2MR8A 3NY7B 2MD9A 2FADA 1OR5A 2MVUA 2AFEA 2XZ0D 3EJEA 4H2YC 2K0XA 3EJBA 1HQBA 2N6YA 2CQ8A 2AVAA 2KGAA 2N5IA 2VSQA 2GDYA 2XZ1C 2CG5B 2FQ1A 2L0QA 2QNWA 2JGPA 2X2BA 2N50A 1DV5A 5HV8A 4BPHA 4CA3A 2LKIA 2FQ2A 3GZLA 4BPGA 1DNYA 2K94A 5KP7B 2DNWA 1AF8A 5HVCA 2MR7A 2CNRA 2KG9A 2KGDA 3RG2A 4BPFA 2K2QA 1VKUA 2KOSA 3CE7A 4IZ6A 3EJDA 1ACPA 2FAEA 4H2WC 4PWVB 2KOOA 2FQ0A 5CZDB 2FHSC 2MY5A 2N6ZA 4R0MA 2KOPA 2GDWA 2KORA 5EJDA 2N5HA 2FVFA 4HKGA 2JU2A 2JQ4A 2FACA 2LTEA 2K0YA 2JU1A 2KR5A 2KWLA 3LMOA 1X3OA 2AFDA 2LPKA 2KW2A 2KOQA 2KG6A 4H2XC 2L22A 2LIUA 4PXHB 1NQ4A 2KGCA 1HY8A 2FVEA 2K93A 1KLPA 2FVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KP8 B;  2MF4 A;  2MVV A;  4DG9 A;  2KGE A;  5KP6 B;  2EHS A;  2CGQ A;  2ROQ A;  2N98 A;  2LML A;  1F80 D;  4NEO A;  2M5R A;  2LL8 A;  1L0I A;  2L9F A;  2L4B A;  2KG8 A;  1L0H A;  2PNG A;  2LIW A;  1T8K A;  2AF8 A;  2GDX A;  2LOL A;  4MRT C;  2K92 A;  2EHT A;  3GZM A;  2MR8 A;  3NY7 B;  2MD9 A;  2FAD A;  1OR5 A;  2MVU A;  2AFE A;  2XZ0 D;  3EJE A;  4H2Y C;  2K0X A;  3EJB A;  1HQB A;  2N6Y A;  2CQ8 A;  2AVA A;  2KGA A;  2N5I A;  2VSQ A;  2GDY A;  2XZ1 C;  2CG5 B;  2FQ1 A;  2L0Q A;  2QNW A;  2JGP A;  2X2B A;  2N50 A;  1DV5 A;  5HV8 A;  4BPH A;  4CA3 A;  2LKI A;  2FQ2 A;  3GZL A;  4BPG A;  1DNY A;  2K94 A;  5KP7 B;  2DNW A;  1AF8 A;  5HVC A;  2MR7 A;  2CNR A;  2KG9 A;  2KGD A;  3RG2 A;  4BPF A;  2K2Q A;  1VKU A;  2KOS A;  3CE7 A;  4IZ6 A;  3EJD A;  1ACP A;  2FAE A;  4H2W C;  4PWV B;  2KOO A;  2FQ0 A;  5CZD B;  2FHS C;  2MY5 A;  2N6Z A;  4R0M A;  2KOP A;  2GDW A;  2KOR A;  5EJD A;  2N5H A;  2FVF A;  4HKG A;  2JU2 A;  2JQ4 A;  2FAC A;  2LTE A;  2K0Y A;  2JU1 A;  2KR5 A;  2KWL A;  3LMO A;  1X3O A;  2AFD A;  2LPK A;  2KW2 A;  2KOQ A;  2KG6 A;  4H2X C;  2L22 A;  2LIU A;  4PXH B;  1NQ4 A;  2KGC A;  1HY8 A;  2FVE A;  2K93 A;  1KLP A;  2FVA A; 
#chains in the Genus database with same CATH topology
 5KP8 B;  3HZQ A;  1VQO P;  3CCS P;  2MF4 A;  1A8O A;  4M0I A;  1VQ7 P;  2MVV A;  2K0D X;  4XRQ A;  2EHS A;  2VLO A;  3G1G A;  1RO0 A;  2JB0 A;  2NO8 A;  2PEQ A;  1RO2 A;  2GDX A;  2M8N A;  2MR8 A;  3NY7 B;  2MD9 A;  2OAR A;  4PH1 A;  2XZ0 D;  3I55 P;  1VQL P;  1EMV A;  2K0X A;  1M74 A;  1IMP A;  2K5X A;  2GDY A;  4QNB A;  2GZE A;  3G21 A;  2JGP A;  1DV5 A;  1E0H A;  5HV8 A;  1K73 Q;  2LKI A;  2BHV A;  3GZL A;  1DNY A;  1CEI A;  1Q81 Q;  2JBG A;  2K94 A;  1AF8 A;  5HVC A;  2CNR A;  3H47 A;  2KG9 A;  1YIT P;  4GR6 A;  2GZJ A;  1VKU A;  4IZ6 A;  2VLQ A;  2FAE A;  3G1I A;  1ZNV A;  3DTJ A;  2MY5 A;  3B4Q A;  1K30 A;  3G4S P;  2L6E A;  5BS1 A;  5F2N A;  3CMA P;  5EJD A;  1KD1 Q;  2Z45 A;  3H0D A;  2JU2 A;  2LTE A;  2KR5 A;  1M1K Q;  1MZ8 A;  7CEI A;  3CCQ P;  1EIA A;  5EW5 E;  1VQ9 P;  1ZMB A;  2OTL P;  1X3O A;  4H2X C;  2VLN A;  2M8L A;  2LIU A;  1NQ4 A;  4COC A;  1HY8 A;  4U0B A;  2JYL A;  2FVA A;  4UHP B;  3WBH A;  1VQ6 P;  3LRY A;  1QVG O;  2KOD A;  4DG9 A;  2KGE A;  2CGQ A;  2LML A;  1F80 D;  2LL8 A;  2L9F A;  4F37 A;  1L0H A;  1AUM A;  1GXG A;  2K92 A;  2EHT A;  3GZM A;  1FR2 A;  3E2D A;  5JPA A;  4U0A A;  1VQN P;  3EJB A;  3G71 P;  1K8A Q;  3P05 A;  2AVA A;  2KGA A;  1EOQ A;  3DS5 A;  2ONT A;  4GR2 A;  2XXM A;  2N50 A;  2Z44 A;  5HGL A;  3CC7 P;  4WYM A;  1QRJ A;  5KP7 B;  2GZG A;  1KC8 Q;  3G6E P;  3U43 A;  2KGD A;  2KOS A;  3CE7 A;  1UJZ A;  3DS3 A;  2FQ0 A;  1S72 P;  2FHS C;  2N6Z A;  2E1M A;  3CCJ P;  3Q20 A;  2PEK A;  4U0F A;  2FVF A;  3MGE A;  3CCR P;  2JYG A;  2FAC A;  4COP A;  1AYI A;  2VLP A;  3LMO A;  2L22 A;  3H4E A;  1VQ4 P;  2KGC A;  2FVE A;  4XFZ A;  1M6N A;  1UNK A;  2PEN A;  2EFJ A;  2P9X A;  4XFX A;  5KP6 B;  1Q7Y Q;  1D1D A;  2ROQ A;  2N98 A;  1IMQ A;  4NEO A;  2XV6 A;  2ERH A;  1L0I A;  3CD6 P;  2L4B A;  1RNI A;  2GZI A;  2PNG A;  2AF8 A;  2LOL A;  4MRT C;  3CC4 P;  1M90 Q;  1N8R Q;  4H2Y C;  5BS2 A;  3DS0 A;  1HQB A;  3CCU P;  3CPW O;  2N5I A;  2VSQ A;  2EIA A;  2DGY A;  2CG5 B;  1YI2 P;  2FQ1 A;  2L0Q A;  4CA3 A;  5I4T G;  4BPG A;  4XRO A;  3G29 A;  3RG6 C;  2Z46 A;  3HYB A;  2MR7 A;  3RG2 A;  1VQK P;  1BAJ A;  1ACP A;  3EJD A;  1GXH A;  3CCV P;  3DPH A;  1W2B O;  2KOO A;  2QA4 P;  1IUQ A;  1Q82 Q;  1YJW P;  5CZD B;  1YJN P;  3B5I A;  3CCL P;  2GDW A;  5F2K A;  2KOR A;  3CME P;  1BXI A;  1Z6M A;  4HKG A;  1VQ5 P;  4U0E A;  2KWL A;  2JAZ A;  2PEM A;  2LF4 A;  5HGM A;  4BPH A;  2AFD A;  2LPK A;  2KOQ A;  4PXH B;  2XT1 A;  1VHN A;  2K93 A;  1KLP A;  3M1M A;  5HGN A;  1VQP P;  4U0D A;  1M6E X;  2PEO A;  4PH0 A;  3DS2 A;  2M5R A;  3CCM P;  2OTJ P;  3NTE A;  2KG8 A;  1GPJ A;  5HGO A;  1VQ8 P;  4IPY A;  2LIW A;  3G28 A;  1T8K A;  3GKL C;  2PY8 A;  2FAD A;  1OR5 A;  2MVU A;  2AFE A;  1K9M Q;  3EJE A;  3GJN A;  2GYK A;  1Q86 Q;  2N6Y A;  2CQ8 A;  2BUO A;  3I56 P;  3G0V A;  2GZF A;  3OW2 O;  1A43 A;  1NJI Q;  2XZ1 C;  2QEX P;  2QNW A;  2X2B A;  1JJ2 O;  3G26 A;  2FQ2 A;  2EG5 A;  4QKO A;  1KQS O;  1YIJ P;  2PEJ A;  2DNW A;  4U0C A;  4BPF A;  3DS4 A;  2K2Q A;  5DCK A;  2JO0 A;  4H2W C;  4PWV B;  2CWO A;  4R0M A;  2KOP A;  1VQM P;  2M8P A;  3DS1 A;  2N5H A;  3CXC O;  1QVF O;  2JQ4 A;  1YJ9 P;  1YHQ P;  2K0Y A;  2JU1 A;  1E6J P;  3VRL C;  3CCE P;  2KW2 A;  2KG6 A;  2PEI A;  5F2O A;  3CC2 P;  4XFY A;  2WPT A; 
#chains in the Genus database with same CATH homology
 5KP8 B;  2MF4 A;  2MVV A;  4DG9 A;  2KGE A;  5KP6 B;  2EHS A;  2CGQ A;  2ROQ A;  2N98 A;  2LML A;  1F80 D;  4NEO A;  2M5R A;  2LL8 A;  1L0I A;  2L9F A;  2L4B A;  2KG8 A;  1L0H A;  2PNG A;  2LIW A;  1T8K A;  2AF8 A;  2GDX A;  2LOL A;  4MRT C;  2K92 A;  2EHT A;  3GZM A;  2MR8 A;  3NY7 B;  2MD9 A;  2FAD A;  1OR5 A;  2MVU A;  2AFE A;  2XZ0 D;  3EJE A;  4H2Y C;  2K0X A;  3EJB A;  1HQB A;  2N6Y A;  2CQ8 A;  2AVA A;  2KGA A;  2N5I A;  2VSQ A;  2GDY A;  2XZ1 C;  2CG5 B;  2FQ1 A;  2L0Q A;  2QNW A;  2JGP A;  2X2B A;  2N50 A;  1DV5 A;  5HV8 A;  4BPH A;  4CA3 A;  2LKI A;  2FQ2 A;  3GZL A;  4BPG A;  1DNY A;  2K94 A;  5KP7 B;  2DNW A;  1AF8 A;  5HVC A;  2MR7 A;  2CNR A;  2KG9 A;  2KGD A;  3RG2 A;  4BPF A;  2K2Q A;  1VKU A;  2KOS A;  3CE7 A;  4IZ6 A;  3EJD A;  1ACP A;  2FAE A;  4H2W C;  4PWV B;  2KOO A;  2FQ0 A;  5CZD B;  2FHS C;  2MY5 A;  2N6Z A;  4R0M A;  2KOP A;  2GDW A;  2KOR A;  5EJD A;  2N5H A;  2FVF A;  4HKG A;  2JU2 A;  2JQ4 A;  2FAC A;  2LTE A;  2K0Y A;  2JU1 A;  2KR5 A;  2KWL A;  3LMO A;  1X3O A;  2AFD A;  2LPK A;  2KW2 A;  2KOQ A;  2KG6 A;  4H2X C;  2L22 A;  2LIU A;  4PXH B;  1NQ4 A;  2KGC A;  1HY8 A;  2FVE A;  2K93 A;  1KLP A;  2FVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...