4BPGA

Crystal structure of bacillus subtilis dltc
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
79
Chain Sequence
MDFKQEVLDVLAEVCQDDIVKENPDIEIFEEGLLDFGTVELLLAIENRFDILVPITEFDRDVWNTPNNIVNQLSELKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords D-ALANINE--POLY(PHOSPHORIBITOL) LIGASE SUBUNIT 2
publication title High-Resolution Structures of the D-Alanyl Carrier Protein (Dcp) Dltc from Bacillus Subtilis Reveal Equivalent Conformations of Apo- and Holo-Forms
pubmed doi rcsb
source organism Bacillus subtilis
total genus 24
structure length 79
sequence length 80
chains with identical sequence B
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2013-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4bpgA00
5EJDA 2JU2A 2X2BA 2KGEA 3NY7B 2LMLA 2K2QA 2KGDA 2JU1A 2FVFA 3EJDA 2M5RA 2KW2A 1DNYA 2CQ8A 2AFDA 2LIWA 2PNGA 1KLPA 2K0XA 2MY5A 2MR8A 2DNWA 3EJEA 2XZ0D 1HY8A 1AF8A 2GDYA 4BPFA 4R0MA 4H2YC 1L0HA 3GZMA 1ACPA 2CG5B 2ROQA 4BPHA 1OR5A 2N5HA 2FADA 2QNWA 3LMOA 1F80D 2L22A 2MR7A 2MVUA 5HV8A 2K93A 2FQ0A 2GDXA 2JGPA 2N5IA 2KGCA 2MF4A 2FVEA 1NQ4A 3CE7A 2KOOA 2FQ2A 4DG9A 5KP6B 3GZLA 1DV5A 2LL8A 2KOPA 2K0YA 2KWLA 2N98A 3EJBA 2KORA 1T8KA 2KG6A 2AVAA 2EHTA 2LKIA 2XZ1C 2LPKA 2FQ1A 2MVVA 2FHSC 2KOQA 2L0QA 4BPGA 5CZDB 2N6YA 2GDWA 2N6ZA 5KP7B 2KR5A 2MD9A 2KG8A 1L0IA 5HVCA 2AF8A 2LOLA 2FVAA 4IZ6A 4MRTC 1HQBA 2VSQA 2L9FA 2K94A 2JQ4A 3RG2A 4H2WC 4HKGA 4PXHB 2AFEA 2K92A 5KP8B 2CGQA 2KGAA 4CA3A 2KG9A 2FAEA 2N50A 2CNRA 2FACA 2LIUA 2KOSA 4H2XC 1VKUA 4PWVB 2L4BA 4NEOA 1X3OA 2LTEA 2EHSA
chains in the Genus database with same CATH superfamily
4U0AA 3DS5A 1KD1Q 2KGEA 3NY7B 2K2QA 4PH0A 1M90Q 2VLOA 2KW2A 4COCA 2EIAA 2Z45A 1KLPA 3CC7P 2MY5A 4XROA 3CCMP 1YJ9P 3DTJA 3NTEA 2XZ0D 3CMEP 4F37A 3CD6P 1VQKP 1L0HA 1ACPA 4COPA 3GKLC 3DS2A 2PY8A 2N5HA 4QKOA 3CCVP 1YIJP 1F80D 2L22A 1S72P 1D1DA 2MVUA 5HV8A 1A43A 1BAJA 2EFJA 2FVEA 5HGOA 1IMQA 3CMAP 5KP6B 4XRQA 1VQOP 2KWLA 2M8LA 2KORA 3CCSP 3H47A 1T8KA 2KG6A 2LKIA 1ZMBA 1AYIA 2FHSC 1UJZA 2KOQA 4BPGA 3DPHA 2GDWA 1M6EX 2KG8A 5HVCA 2LOLA 2FVAA 4IZ6A 1KC8Q 1HQBA 2VSQA 2LF4A 1QVGO 2KODA 2NO8A 4H2WC 2AFEA 5KP8B 1YJNP 3B4QA 2OTJP 1E6JP 4U0FA 2FACA 2JYLA 1GPJA 3U43A 1NJIQ 2PEKA 5F2KA 2EHSA 3CCRP 2JU2A 3DS3A 2M8NA 2QEXP 2EG5A 2JU1A 2FVFA 3EJDA 1Q86Q 1VQ5P 3G4SP 5I4TG 2MR8A 5HGLA 1VQ9P 2OTLP 1HY8A 1M6NA 1QRJA 4UHPB 1BXIA 2L6EA 3H4EA 4M0IA 2BUOA 1EMVA 4BPHA 1VQLP 4U0CA 3GJNA 2OARA 3G1IA 2JGPA 1K9MQ 3B5IA 3G71P 2GYKA 1DV5A 2LL8A 2XV6A 1RO2A 2N98A 1Q7YQ 4PH1A 3EJBA 4U0DA 5DCKA 3CCJP 3CCEP 3DS0A 2XZ1C 2FQ1A 2MVVA 2WPTA 1VQMP 1QVFO 2L0QA 1VQNP 1VQ4P 1K73Q 1AUMA 2N6ZA 5KP7B 2ERHA 2JQ4A 1UNKA 3RG2A 5BS1A 3CC4P 4CA3A 2KG9A 1VHNA 2PEOA 2KOSA 4H2XC 1YHQP 4XFYA 4XFZA 1IMPA 1X3OA 5F2NA 2LTEA 5EJDA 2VLQA 2X2BA 2LMLA 2KGDA 3M1MA 2P9XA 1FR2A 2K5XA 1DNYA 2CQ8A 2GZIA 3VRLC 3P05A 2LIWA 1N8RQ 1Q82Q 1YI2P 1EIAA 2K0XA 2M8PA 2PENA 3I55P 3CCQP 1M74A 2JBGA 3CCUP 2DGYA 2GDYA 4QNBA 5HGMA 4BPFA 4R0MA 4H2YC 1JJ2O 3GZMA 3RG6C 3CCLP 1K8AQ 2Z44A 2ROQA 1Z6MA 3LMOA 2K93A 1W2BO 2GDXA 2MF4A 2ONTA 1NQ4A 2FQ2A 4DG9A 1GXGA 1YITP 3HZQA 3GZLA 2E1MA 2VLPA 2PEIA 2K0YA 4GR2A 2GZEA 2QA4P 2EHTA 1KQSO 1MZ8A 2PEMA 3DS4A 2JO0A 2KR5A 1L0IA 1CEIA 3DS1A 1M1KQ 2JB0A 4MRTC 2GZGA 2K94A 2JYGA 5BS2A 2KGAA 3WBHA 2Z46A 1RO0A 2N50A 3I56P 3G1GA 2LIUA 4PWVB 3G21A 7CEIA 1VQ6P 2L4BA 4NEOA 3H0DA 2XXMA 3CC2P 2M5RA 4U0EA 2BHVA 2AFDA 3G28A 2PNGA 3HYBA 1Q81Q 1K30A 2DNWA 3EJEA 1AF8A 1YJWP 2JAZA 4XFXA 2XT1A 2CG5B 1OR5A 2FADA 2QNWA 2PEQA 2CWOA 2MR7A 1EOQA 2FQ0A 2N5IA 2KGCA 3Q20A 3CPWO 3CE7A 2KOOA 3E2DA 5JPAA 2KOPA 3LRYA 1ZNVA 1IUQA 4IPYA 2AVAA 5HGNA 3MGEA 2LPKA 1VQ7P 5CZDB 2N6YA 3OW2O 2MD9A 5F2OA 2VLNA 2AF8A 4U0BA 3G6EP 2L9FA 1GXHA 3G29A 3G0VA 4HKGA 3G26A 2K0DX 4PXHB 1VQ8P 2K92A 2CGQA 1RNIA 5EW5E 2PEJA 2GZJA 2FAEA 1A8OA 2CNRA 2GZFA 1E0HA 1VKUA 4WYMA 1VQPP 3CXCO 4GR6A
chains in the Genus database with same CATH topology
5EJDA 2JU2A 2X2BA 2KGEA 3NY7B 2LMLA 2K2QA 2KGDA 2JU1A 2FVFA 3EJDA 2M5RA 2KW2A 1DNYA 2CQ8A 2AFDA 2LIWA 2PNGA 1KLPA 2K0XA 2MY5A 2MR8A 2DNWA 3EJEA 2XZ0D 1HY8A 1AF8A 2GDYA 4BPFA 4R0MA 4H2YC 1L0HA 3GZMA 1ACPA 2CG5B 2ROQA 4BPHA 1OR5A 2N5HA 2FADA 2QNWA 3LMOA 1F80D 2L22A 2MR7A 2MVUA 5HV8A 2K93A 2FQ0A 2GDXA 2JGPA 2N5IA 2KGCA 2MF4A 2FVEA 1NQ4A 3CE7A 2KOOA 2FQ2A 4DG9A 5KP6B 3GZLA 1DV5A 2LL8A 2KOPA 2K0YA 2KWLA 2N98A 3EJBA 2KORA 1T8KA 2KG6A 2AVAA 2EHTA 2LKIA 2XZ1C 2LPKA 2FQ1A 2MVVA 2FHSC 2KOQA 2L0QA 4BPGA 5CZDB 2N6YA 2GDWA 2N6ZA 5KP7B 2KR5A 2MD9A 2KG8A 1L0IA 5HVCA 2AF8A 2LOLA 2FVAA 4IZ6A 4MRTC 1HQBA 2VSQA 2L9FA 2K94A 2JQ4A 3RG2A 4H2WC 4HKGA 4PXHB 2AFEA 2K92A 5KP8B 2CGQA 2KGAA 4CA3A 2KG9A 2FAEA 2N50A 2CNRA 2FACA 2LIUA 2KOSA 4H2XC 1VKUA 4PWVB 2L4BA 4NEOA 1X3OA 2LTEA 2EHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EJD A;  2JU2 A;  2X2B A;  2KGE A;  3NY7 B;  2LML A;  2K2Q A;  2KGD A;  2JU1 A;  2FVF A;  3EJD A;  2M5R A;  2KW2 A;  1DNY A;  2CQ8 A;  2AFD A;  2LIW A;  2PNG A;  1KLP A;  2K0X A;  2MY5 A;  2MR8 A;  2DNW A;  3EJE A;  2XZ0 D;  1HY8 A;  1AF8 A;  2GDY A;  4BPF A;  4R0M A;  4H2Y C;  1L0H A;  3GZM A;  1ACP A;  2CG5 B;  2ROQ A;  4BPH A;  1OR5 A;  2N5H A;  2FAD A;  2QNW A;  3LMO A;  1F80 D;  2L22 A;  2MR7 A;  2MVU A;  5HV8 A;  2K93 A;  2FQ0 A;  2GDX A;  2JGP A;  2N5I A;  2KGC A;  2MF4 A;  2FVE A;  1NQ4 A;  3CE7 A;  2KOO A;  2FQ2 A;  4DG9 A;  5KP6 B;  3GZL A;  1DV5 A;  2LL8 A;  2KOP A;  2K0Y A;  2KWL A;  2N98 A;  3EJB A;  2KOR A;  1T8K A;  2KG6 A;  2AVA A;  2EHT A;  2LKI A;  2XZ1 C;  2LPK A;  2FQ1 A;  2MVV A;  2FHS C;  2KOQ A;  2L0Q A;  4BPG A;  5CZD B;  2N6Y A;  2GDW A;  2N6Z A;  5KP7 B;  2KR5 A;  2MD9 A;  2KG8 A;  1L0I A;  5HVC A;  2AF8 A;  2LOL A;  2FVA A;  4IZ6 A;  4MRT C;  1HQB A;  2VSQ A;  2L9F A;  2K94 A;  2JQ4 A;  3RG2 A;  4H2W C;  4HKG A;  4PXH B;  2AFE A;  2K92 A;  5KP8 B;  2CGQ A;  2KGA A;  4CA3 A;  2KG9 A;  2FAE A;  2N50 A;  2CNR A;  2FAC A;  2LIU A;  2KOS A;  4H2X C;  1VKU A;  4PWV B;  2L4B A;  4NEO A;  1X3O A;  2LTE A;  2EHS A; 
#chains in the Genus database with same CATH topology
 4U0A A;  3DS5 A;  1KD1 Q;  2KGE A;  3NY7 B;  2K2Q A;  4PH0 A;  1M90 Q;  2VLO A;  2KW2 A;  4COC A;  2EIA A;  2Z45 A;  1KLP A;  3CC7 P;  2MY5 A;  4XRO A;  3CCM P;  1YJ9 P;  3DTJ A;  3NTE A;  2XZ0 D;  3CME P;  4F37 A;  3CD6 P;  1VQK P;  1L0H A;  1ACP A;  4COP A;  3GKL C;  3DS2 A;  2PY8 A;  2N5H A;  4QKO A;  3CCV P;  1YIJ P;  1F80 D;  2L22 A;  1S72 P;  1D1D A;  2MVU A;  5HV8 A;  1A43 A;  1BAJ A;  2EFJ A;  2FVE A;  5HGO A;  1IMQ A;  3CMA P;  5KP6 B;  4XRQ A;  1VQO P;  2KWL A;  2M8L A;  2KOR A;  3CCS P;  3H47 A;  1T8K A;  2KG6 A;  2LKI A;  1ZMB A;  1AYI A;  2FHS C;  1UJZ A;  2KOQ A;  4BPG A;  3DPH A;  2GDW A;  1M6E X;  2KG8 A;  5HVC A;  2LOL A;  2FVA A;  4IZ6 A;  1KC8 Q;  1HQB A;  2VSQ A;  2LF4 A;  1QVG O;  2KOD A;  2NO8 A;  4H2W C;  2AFE A;  5KP8 B;  1YJN P;  3B4Q A;  2OTJ P;  1E6J P;  4U0F A;  2FAC A;  2JYL A;  1GPJ A;  3U43 A;  1NJI Q;  2PEK A;  5F2K A;  2EHS A;  3CCR P;  2JU2 A;  3DS3 A;  2M8N A;  2QEX P;  2EG5 A;  2JU1 A;  2FVF A;  3EJD A;  1Q86 Q;  1VQ5 P;  3G4S P;  5I4T G;  2MR8 A;  5HGL A;  1VQ9 P;  2OTL P;  1HY8 A;  1M6N A;  1QRJ A;  4UHP B;  1BXI A;  2L6E A;  3H4E A;  4M0I A;  2BUO A;  1EMV A;  4BPH A;  1VQL P;  4U0C A;  3GJN A;  2OAR A;  3G1I A;  2JGP A;  1K9M Q;  3B5I A;  3G71 P;  2GYK A;  1DV5 A;  2LL8 A;  2XV6 A;  1RO2 A;  2N98 A;  1Q7Y Q;  4PH1 A;  3EJB A;  4U0D A;  5DCK A;  3CCJ P;  3CCE P;  3DS0 A;  2XZ1 C;  2FQ1 A;  2MVV A;  2WPT A;  1VQM P;  1QVF O;  2L0Q A;  1VQN P;  1VQ4 P;  1K73 Q;  1AUM A;  2N6Z A;  5KP7 B;  2ERH A;  2JQ4 A;  1UNK A;  3RG2 A;  5BS1 A;  3CC4 P;  4CA3 A;  2KG9 A;  1VHN A;  2PEO A;  2KOS A;  4H2X C;  1YHQ P;  4XFY A;  4XFZ A;  1IMP A;  1X3O A;  5F2N A;  2LTE A;  5EJD A;  2VLQ A;  2X2B A;  2LML A;  2KGD A;  3M1M A;  2P9X A;  1FR2 A;  2K5X A;  1DNY A;  2CQ8 A;  2GZI A;  3VRL C;  3P05 A;  2LIW A;  1N8R Q;  1Q82 Q;  1YI2 P;  1EIA A;  2K0X A;  2M8P A;  2PEN A;  3I55 P;  3CCQ P;  1M74 A;  2JBG A;  3CCU P;  2DGY A;  2GDY A;  4QNB A;  5HGM A;  4BPF A;  4R0M A;  4H2Y C;  1JJ2 O;  3GZM A;  3RG6 C;  3CCL P;  1K8A Q;  2Z44 A;  2ROQ A;  1Z6M A;  3LMO A;  2K93 A;  1W2B O;  2GDX A;  2MF4 A;  2ONT A;  1NQ4 A;  2FQ2 A;  4DG9 A;  1GXG A;  1YIT P;  3HZQ A;  3GZL A;  2E1M A;  2VLP A;  2PEI A;  2K0Y A;  4GR2 A;  2GZE A;  2QA4 P;  2EHT A;  1KQS O;  1MZ8 A;  2PEM A;  3DS4 A;  2JO0 A;  2KR5 A;  1L0I A;  1CEI A;  3DS1 A;  1M1K Q;  2JB0 A;  4MRT C;  2GZG A;  2K94 A;  2JYG A;  5BS2 A;  2KGA A;  3WBH A;  2Z46 A;  1RO0 A;  2N50 A;  3I56 P;  3G1G A;  2LIU A;  4PWV B;  3G21 A;  7CEI A;  1VQ6 P;  2L4B A;  4NEO A;  3H0D A;  2XXM A;  3CC2 P;  2M5R A;  4U0E A;  2BHV A;  2AFD A;  3G28 A;  2PNG A;  3HYB A;  1Q81 Q;  1K30 A;  2DNW A;  3EJE A;  1AF8 A;  1YJW P;  2JAZ A;  4XFX A;  2XT1 A;  2CG5 B;  1OR5 A;  2FAD A;  2QNW A;  2PEQ A;  2CWO A;  2MR7 A;  1EOQ A;  2FQ0 A;  2N5I A;  2KGC A;  3Q20 A;  3CPW O;  3CE7 A;  2KOO A;  3E2D A;  5JPA A;  2KOP A;  3LRY A;  1ZNV A;  1IUQ A;  4IPY A;  2AVA A;  5HGN A;  3MGE A;  2LPK A;  1VQ7 P;  5CZD B;  2N6Y A;  3OW2 O;  2MD9 A;  5F2O A;  2VLN A;  2AF8 A;  4U0B A;  3G6E P;  2L9F A;  1GXH A;  3G29 A;  3G0V A;  4HKG A;  3G26 A;  2K0D X;  4PXH B;  1VQ8 P;  2K92 A;  2CGQ A;  1RNI A;  5EW5 E;  2PEJ A;  2GZJ A;  2FAE A;  1A8O A;  2CNR A;  2GZF A;  1E0H A;  1VKU A;  4WYM A;  1VQP P;  3CXC O;  4GR6 A; 
#chains in the Genus database with same CATH homology
 5EJD A;  2JU2 A;  2X2B A;  2KGE A;  3NY7 B;  2LML A;  2K2Q A;  2KGD A;  2JU1 A;  2FVF A;  3EJD A;  2M5R A;  2KW2 A;  1DNY A;  2CQ8 A;  2AFD A;  2LIW A;  2PNG A;  1KLP A;  2K0X A;  2MY5 A;  2MR8 A;  2DNW A;  3EJE A;  2XZ0 D;  1HY8 A;  1AF8 A;  2GDY A;  4BPF A;  4R0M A;  4H2Y C;  1L0H A;  3GZM A;  1ACP A;  2CG5 B;  2ROQ A;  4BPH A;  1OR5 A;  2N5H A;  2FAD A;  2QNW A;  3LMO A;  1F80 D;  2L22 A;  2MR7 A;  2MVU A;  5HV8 A;  2K93 A;  2FQ0 A;  2GDX A;  2JGP A;  2N5I A;  2KGC A;  2MF4 A;  2FVE A;  1NQ4 A;  3CE7 A;  2KOO A;  2FQ2 A;  4DG9 A;  5KP6 B;  3GZL A;  1DV5 A;  2LL8 A;  2KOP A;  2K0Y A;  2KWL A;  2N98 A;  3EJB A;  2KOR A;  1T8K A;  2KG6 A;  2AVA A;  2EHT A;  2LKI A;  2XZ1 C;  2LPK A;  2FQ1 A;  2MVV A;  2FHS C;  2KOQ A;  2L0Q A;  4BPG A;  5CZD B;  2N6Y A;  2GDW A;  2N6Z A;  5KP7 B;  2KR5 A;  2MD9 A;  2KG8 A;  1L0I A;  5HVC A;  2AF8 A;  2LOL A;  2FVA A;  4IZ6 A;  4MRT C;  1HQB A;  2VSQ A;  2L9F A;  2K94 A;  2JQ4 A;  3RG2 A;  4H2W C;  4HKG A;  4PXH B;  2AFE A;  2K92 A;  5KP8 B;  2CGQ A;  2KGA A;  4CA3 A;  2KG9 A;  2FAE A;  2N50 A;  2CNR A;  2FAC A;  2LIU A;  2KOS A;  4H2X C;  1VKU A;  4PWV B;  2L4B A;  4NEO A;  1X3O A;  2LTE A;  2EHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...