1BXIA

Crystal structure of the escherichia coli colicin e9 dnase domain with its cognate immunity protein im9
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
LKASISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVQQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN (COLICIN E9 IMMUNITY PROTEIN)
publication title Crystal Structure of the E.Coli Colicin E9 DNase Domain With its Cognate Immunity Protein Im9
pubmed rcsb
source organism Escherichia coli
total genus 28
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 1998-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1bxiA00
3U43A 2GYKA 1GXGA 2NO8A 1E0HA 1UJZA 2GZIA 1MZ8A 3GKLC 4UHPB 2GZJA 2VLQA 1FR2A 1BXIA 2JB0A 2GZEA 2K0DX 2ERHA 1EMVA 1ZNVA 2K5XA 7CEIA 3GJNA 2JBGA 4QKOA 2WPTA 1AYIA 2JAZA 1CEIA 2VLOA 5EW5E 1IMQA 2VLNA 1IMPA 4F37A 1UNKA 2VLPA 1GXHA 2GZFA 2GZGA
chains in the Genus database with same CATH superfamily
4H2XC 5BS2A 1E0HA 1BAJA 4COCA 2XT1A 2FHSC 1M6EX 1YITP 1AUMA 1QVGO 1YI2P 3HZQA 2AFDA 5HVCA 5BS1A 2PEQA 2XV6A 3CC4P 2GYKA 1QRJA 3WBHA 3GKLC 4BPGA 1EOQA 1E6JP 2GZJA 2VLQA 2LIWA 4U0EA 2FVAA 4U0AA 5HGMA 2EHSA 2JU1A 2MR8A 3CD6P 2N98A 2AF8A 1KD1Q 3G28A 2NO8A 1X3OA 1K8AQ 2E1MA 2K0DX 4MRTC 3CCSP 1HY8A 2K5XA 1OR5A 5CZDB 3CCUP 1D1DA 3CXCO 3G4SP 2QNWA 3CC2P 1YIJP 2FADA 3MGEA 3DS4A 2K92A 2ONTA 2PENA 2VSQA 2KODA 1KC8Q 2KWLA 1N8RQ 1VQKP 2KOSA 2LF4A 1VQPP 2KG6A 3DS0A 5F2KA 4COPA 2VLOA 1W2BO 3DS1A 4U0CA 2OARA 5KP8B 2CG5B 4H2YC 4XFYA 5I4TG 1BXIA 4BPHA 1EMVA 2L4BA 1ZNVA 2N5HA 3G29A 2JO0A 2WPTA 2P9XA 1UNKA 3H4EA 3CPWO 3GZLA 2PEMA 1IUQA 4UHPB 2DNWA 2FACA 2KR5A 2OTJP 2KG8A 3P05A 3G21A 1Q86Q 2JBGA 4R0MA 3NTEA 4H2WC 4QKOA 3VRLC 2JYGA 3G6EP 1IMQA 2DGYA 4U0FA 1M6NA 1RNIA 2AFEA 1K30A 2FVFA 1JJ2O 2N50A 1M90Q 3B4QA 3DPHA 3I56P 2L6EA 2MD9A 1IMPA 2X2BA 3CCJP 2K0YA 3EJDA 3CCVP 3EJBA 4BPFA 2KOOA 2LKIA 2LMLA 2KOQA 2PNGA 4IZ6A 2ERHA 2L0QA 2LOLA 1M74A 4PH0A 2ROQA 3M1MA 2LIUA 2FAEA 3H47A 2FQ2A 2VLNA 2OTLP 2KGDA 4U0BA 1YJWP 1GXGA 2K0XA 3CMAP 3CE7A 2MVUA 4M0IA 2Z46A 3GJNA 2EFJA 4XRQA 2VLPA 2GZGA 3HYBA 1A8OA 2MY5A 2M8LA 2JU2A 2K2QA 5HGNA 5DCKA 5F2OA 1YJNP 3CCMP 2QA4P 2LL8A 2CNRA 1Z6MA 2KW2A 3CCLP 3NY7B 2KGEA 1KQSO 3GZMA 5EJDA 2M5RA 4GR6A 2GZFA 1VQ5P 2BHVA 1VQNP 4DG9A 2LTEA 2KG9A 3RG2A 4U0DA 2JYLA 2JB0A 3LMOA 2CWOA 3G1GA 3RG6C 2GZEA 4WYMA 4CA3A 2FQ1A 1L0HA 2JGPA 2GDWA 3CCRP 1S72P 7CEIA 5HGLA 4NEOA 2CQ8A 1AYIA 2JAZA 1RO2A 1T8KA 1AF8A 3EJEA 3U43A 2PEJA 1KLPA 1NQ4A 3CMEP 1GPJA 4XFXA 2L22A 4HKGA 3B5IA 4XROA 1YHQP 1VQ8P 2KGAA 2CGQA 1MZ8A 2GDXA 5KP6B 1Q82Q 1ACPA 2BUOA 2PEKA 3CC7P 3CCQP 1QVFO 1K9MQ 3G71P 1M1KQ 3G1IA 1GXHA 2K94A 1YJ9P 2Z44A 2XXMA 3OW2O 2GZIA 3DTJA 1Q81Q 5JPAA 2M8NA 2PEOA 1VQMP 2N6YA 1NJIQ 1RO0A 3H0DA 1ZMBA 3LRYA 5HGOA 1VQ4P 5F2NA 2EG5A 2KOPA 2QEXP 1EIAA 1VQLP 5HV8A 2KGCA 2XZ0D 1A43A 2MVVA 4PWVB 2K93A 1HQBA 2EIAA 2MR7A 3DS3A 1VQ6P 1UJZA 2KORA 3Q20A 4QNBA 4PH1A 2GDYA 1VQ7P 2M8PA 1Q7YQ 1DNYA 3G0VA 2N6ZA 4IPYA 2PEIA 1F80D 3DS5A 3G26A 3DS2A 2MF4A 2FQ0A 5EW5E 2FVEA 1L0IA 4F37A 2JQ4A 3CCEP 2PY8A 1DV5A 2EHTA 1VQOP 5KP7B 3I55P 4PXHB 2LPKA 2Z45A 1FR2A 1VQ9P 1VKUA 2L9FA 3E2DA 1VHNA 4XFZA 1CEIA 2AVAA 2XZ1C 1K73Q 2N5IA 4GR2A
chains in the Genus database with same CATH topology
3U43A 2GYKA 1GXGA 2NO8A 1E0HA 1UJZA 2GZIA 1MZ8A 3GKLC 4UHPB 2GZJA 2VLQA 1FR2A 1BXIA 2JB0A 2GZEA 2K0DX 2ERHA 1EMVA 1ZNVA 2K5XA 7CEIA 3GJNA 2JBGA 4QKOA 2WPTA 1AYIA 2JAZA 1CEIA 2VLOA 5EW5E 1IMQA 2VLNA 1IMPA 4F37A 1UNKA 2VLPA 1GXHA 2GZFA 2GZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U43 A;  2GYK A;  1GXG A;  2NO8 A;  1E0H A;  1UJZ A;  2GZI A;  1MZ8 A;  3GKL C;  4UHP B;  2GZJ A;  2VLQ A;  1FR2 A;  1BXI A;  2JB0 A;  2GZE A;  2K0D X;  2ERH A;  1EMV A;  1ZNV A;  2K5X A;  7CEI A;  3GJN A;  2JBG A;  4QKO A;  2WPT A;  1AYI A;  2JAZ A;  1CEI A;  2VLO A;  5EW5 E;  1IMQ A;  2VLN A;  1IMP A;  4F37 A;  1UNK A;  2VLP A;  1GXH A;  2GZF A;  2GZG A; 
#chains in the Genus database with same CATH topology
 4H2X C;  5BS2 A;  1E0H A;  1BAJ A;  4COC A;  2XT1 A;  2FHS C;  1M6E X;  1YIT P;  1AUM A;  1QVG O;  1YI2 P;  3HZQ A;  2AFD A;  5HVC A;  5BS1 A;  2PEQ A;  2XV6 A;  3CC4 P;  2GYK A;  1QRJ A;  3WBH A;  3GKL C;  4BPG A;  1EOQ A;  1E6J P;  2GZJ A;  2VLQ A;  2LIW A;  4U0E A;  2FVA A;  4U0A A;  5HGM A;  2EHS A;  2JU1 A;  2MR8 A;  3CD6 P;  2N98 A;  2AF8 A;  1KD1 Q;  3G28 A;  2NO8 A;  1X3O A;  1K8A Q;  2E1M A;  2K0D X;  4MRT C;  3CCS P;  1HY8 A;  2K5X A;  1OR5 A;  5CZD B;  3CCU P;  1D1D A;  3CXC O;  3G4S P;  2QNW A;  3CC2 P;  1YIJ P;  2FAD A;  3MGE A;  3DS4 A;  2K92 A;  2ONT A;  2PEN A;  2VSQ A;  2KOD A;  1KC8 Q;  2KWL A;  1N8R Q;  1VQK P;  2KOS A;  2LF4 A;  1VQP P;  2KG6 A;  3DS0 A;  5F2K A;  4COP A;  2VLO A;  1W2B O;  3DS1 A;  4U0C A;  2OAR A;  5KP8 B;  2CG5 B;  4H2Y C;  4XFY A;  5I4T G;  1BXI A;  4BPH A;  1EMV A;  2L4B A;  1ZNV A;  2N5H A;  3G29 A;  2JO0 A;  2WPT A;  2P9X A;  1UNK A;  3H4E A;  3CPW O;  3GZL A;  2PEM A;  1IUQ A;  4UHP B;  2DNW A;  2FAC A;  2KR5 A;  2OTJ P;  2KG8 A;  3P05 A;  3G21 A;  1Q86 Q;  2JBG A;  4R0M A;  3NTE A;  4H2W C;  4QKO A;  3VRL C;  2JYG A;  3G6E P;  1IMQ A;  2DGY A;  4U0F A;  1M6N A;  1RNI A;  2AFE A;  1K30 A;  2FVF A;  1JJ2 O;  2N50 A;  1M90 Q;  3B4Q A;  3DPH A;  3I56 P;  2L6E A;  2MD9 A;  1IMP A;  2X2B A;  3CCJ P;  2K0Y A;  3EJD A;  3CCV P;  3EJB A;  4BPF A;  2KOO A;  2LKI A;  2LML A;  2KOQ A;  2PNG A;  4IZ6 A;  2ERH A;  2L0Q A;  2LOL A;  1M74 A;  4PH0 A;  2ROQ A;  3M1M A;  2LIU A;  2FAE A;  3H47 A;  2FQ2 A;  2VLN A;  2OTL P;  2KGD A;  4U0B A;  1YJW P;  1GXG A;  2K0X A;  3CMA P;  3CE7 A;  2MVU A;  4M0I A;  2Z46 A;  3GJN A;  2EFJ A;  4XRQ A;  2VLP A;  2GZG A;  3HYB A;  1A8O A;  2MY5 A;  2M8L A;  2JU2 A;  2K2Q A;  5HGN A;  5DCK A;  5F2O A;  1YJN P;  3CCM P;  2QA4 P;  2LL8 A;  2CNR A;  1Z6M A;  2KW2 A;  3CCL P;  3NY7 B;  2KGE A;  1KQS O;  3GZM A;  5EJD A;  2M5R A;  4GR6 A;  2GZF A;  1VQ5 P;  2BHV A;  1VQN P;  4DG9 A;  2LTE A;  2KG9 A;  3RG2 A;  4U0D A;  2JYL A;  2JB0 A;  3LMO A;  2CWO A;  3G1G A;  3RG6 C;  2GZE A;  4WYM A;  4CA3 A;  2FQ1 A;  1L0H A;  2JGP A;  2GDW A;  3CCR P;  1S72 P;  7CEI A;  5HGL A;  4NEO A;  2CQ8 A;  1AYI A;  2JAZ A;  1RO2 A;  1T8K A;  1AF8 A;  3EJE A;  3U43 A;  2PEJ A;  1KLP A;  1NQ4 A;  3CME P;  1GPJ A;  4XFX A;  2L22 A;  4HKG A;  3B5I A;  4XRO A;  1YHQ P;  1VQ8 P;  2KGA A;  2CGQ A;  1MZ8 A;  2GDX A;  5KP6 B;  1Q82 Q;  1ACP A;  2BUO A;  2PEK A;  3CC7 P;  3CCQ P;  1QVF O;  1K9M Q;  3G71 P;  1M1K Q;  3G1I A;  1GXH A;  2K94 A;  1YJ9 P;  2Z44 A;  2XXM A;  3OW2 O;  2GZI A;  3DTJ A;  1Q81 Q;  5JPA A;  2M8N A;  2PEO A;  1VQM P;  2N6Y A;  1NJI Q;  1RO0 A;  3H0D A;  1ZMB A;  3LRY A;  5HGO A;  1VQ4 P;  5F2N A;  2EG5 A;  2KOP A;  2QEX P;  1EIA A;  1VQL P;  5HV8 A;  2KGC A;  2XZ0 D;  1A43 A;  2MVV A;  4PWV B;  2K93 A;  1HQB A;  2EIA A;  2MR7 A;  3DS3 A;  1VQ6 P;  1UJZ A;  2KOR A;  3Q20 A;  4QNB A;  4PH1 A;  2GDY A;  1VQ7 P;  2M8P A;  1Q7Y Q;  1DNY A;  3G0V A;  2N6Z A;  4IPY A;  2PEI A;  1F80 D;  3DS5 A;  3G26 A;  3DS2 A;  2MF4 A;  2FQ0 A;  5EW5 E;  2FVE A;  1L0I A;  4F37 A;  2JQ4 A;  3CCE P;  2PY8 A;  1DV5 A;  2EHT A;  1VQO P;  5KP7 B;  3I55 P;  4PXH B;  2LPK A;  2Z45 A;  1FR2 A;  1VQ9 P;  1VKU A;  2L9F A;  3E2D A;  1VHN A;  4XFZ A;  1CEI A;  2AVA A;  2XZ1 C;  1K73 Q;  2N5I A;  4GR2 A; 
#chains in the Genus database with same CATH homology
 3U43 A;  2GYK A;  1GXG A;  2NO8 A;  1E0H A;  1UJZ A;  2GZI A;  1MZ8 A;  3GKL C;  4UHP B;  2GZJ A;  2VLQ A;  1FR2 A;  1BXI A;  2JB0 A;  2GZE A;  2K0D X;  2ERH A;  1EMV A;  1ZNV A;  2K5X A;  7CEI A;  3GJN A;  2JBG A;  4QKO A;  2WPT A;  1AYI A;  2JAZ A;  1CEI A;  2VLO A;  5EW5 E;  1IMQ A;  2VLN A;  1IMP A;  4F37 A;  1UNK A;  2VLP A;  1GXH A;  2GZF A;  2GZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...