1BXIA

Crystal structure of the escherichia coli colicin e9 dnase domain with its cognate immunity protein im9
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
LKASISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVQQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the E.Coli Colicin E9 DNase Domain With its Cognate Immunity Protein Im9
pubmed rcsb
source organism Escherichia coli
molecule tags Immune system
molecule keywords PROTEIN (COLICIN E9 IMMUNITY PROTEIN)
total genus 28
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 1998-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1bxiA00
2NO8A 1UJZA 2VLOA 2WPTA 2GZFA 4QKOA 2ERHA 2K0DX 3GJNA 1UNKA 1IMQA 2VLQA 7CEIA 1EMVA 1GXHA 2VLNA 5EW5E 2JB0A 4UHPB 4F37A 1MZ8A 1ZNVA 3GKLC 2K5XA 2GZGA 2JAZA 1AYIA 2JBGA 2VLPA 1E0HA 1CEIA 2GYKA 3U43A 1BXIA 2GZIA 2GZEA 1IMPA 1FR2A 2GZJA 1GXGA
chains in the Genus database with same CATH superfamily
4PXHB 1VQ6P 2P9XA 4CA3A 1KQSO 2FVEA 2DNWA 2N6YA 1EIAA 1D1DA 2KW2A 4UHPB 2QEXP 3GKLC 1M1KQ 2LL8A 4BPHA 1M74A 3CCJP 3B4QA 3CCQP 5DCKA 1UJZA 2KG8A 2N5IA 3DS0A 1K73Q 4XFZA 5EW5E 2JU1A 5F2NA 2MVVA 4U0AA 4U0CA 3G21A 2EHSA 3LRYA 5I4TG 2QNWA 2FQ2A 2VLOA 2K93A 1GXHA 1F80D 3I55P 2DGYA 2LF4A 2KODA 1BAJA 3I56P 1RO0A 1QVFO 3HYBA 2K0XA 2GYKA 3G26A 4XRQA 5BS1A 4COPA 2K0DX 4HKGA 2PEIA 1YI2P 1NQ4A 1EMVA 2PNGA 4QNBA 1VQMP 4BPFA 4XFYA 3CC4P 2MR7A 2L22A 2JQ4A 3U43A 2KOPA 3GZLA 1KLPA 1FR2A 4H2XC 3CCVP 5HGLA 2K2QA 2KGAA 4M0IA 2MD9A 5HVCA 2KGEA 3CCUP 3CD6P 3VRLC 2L0QA 2PEQA 1RO2A 2K5XA 4PWVB 2JGPA 1KC8Q 2AVAA 1CEIA 2AFEA 2N6ZA 4IPYA 4GR2A 2KG9A 2KR5A 1NJIQ 1GXGA 1DV5A 2N98A 2FQ1A 3DS1A 3EJBA 2X2BA 1K8AQ 4XFXA 4COCA 1VQ4P 2KGDA 3DTJA 2Z44A 2Z46A 4H2YC 1A43A 1E0HA 1L0HA 1AUMA 1BXIA 1M6NA 1E6JP 1IMPA 3LMOA 3B5IA 2LMLA 2AFDA 2OTLP 1VQ5P 3G6EP 1M6EX 3NY7B 2M8LA 5HGNA 3G1GA 5CZDB 1OR5A 2L6EA 2LIUA 5HGOA 2VSQA 2GDWA 3CE7A 2GZGA 2MR8A 2EHTA 2BUOA 3CPWO 2EFJA 2XT1A 2GZFA 2MVUA 3CCRP 1K9MQ 2PEJA 3G29A 2KGCA 2JB0A 1VHNA 1M90Q 3H4EA 1VQ9P 1AYIA 2PEMA 2FHSC 5EJDA 1VQ7P 2LOLA 3CCEP 2GZEA 5KP6B 2FAEA 3CCLP 2XXMA 2JYGA 2NO8A 2JU2A 2N50A 4GR6A 3RG2A 1YJ9P 5F2KA 3MGEA 5KP7B 1AF8A 1IMQA 7CEIA 2E1MA 2KOSA 2KOOA 2EG5A 2FACA 2KORA 3CCMP 5BS2A 3NTEA 2K92A 2MY5A 2PY8A 2Z45A 3CC7P 4PH0A 2JO0A 4U0FA 2KG6A 1L0IA 2OARA 4XROA 4U0EA 2KOQA 1JJ2O 2M8NA 3DS4A 3H47A 1ACPA 5F2OA 3CMAP 5KP8B 3H0DA 3EJDA 1HY8A 1YJNP 2GZIA 2ERHA 1YJWP 2LTEA 1Z6MA 1S72P 2K94A 1MZ8A 2EIAA 3CCSP 1VQOP 3G71P 2CNRA 1K30A 3HZQA 1VQLP 2L4BA 4MRTC 1VQNP 2LPKA 1N8RQ 3GZMA 5HGMA 2PEKA 3E2DA 1Q7YQ 2VLNA 3RG6C 1QVGO 2CQ8A 3DS2A 4DG9A 4H2WC 2N5HA 3G28A 2BHVA 4WYMA 3EJEA 1VQKP 2FVAA 2GZJA 2PEOA 2ONTA 3GJNA 2MF4A 1VKUA 2ROQA 3CXCO 2VLQA 4PH1A 1VQ8P 5HV8A 4F37A 3CC2P 3DS3A 3OW2O 1YITP 2JBGA 1Q81Q 2XZ1C 2M8PA 3DS5A 2M5RA 2GDXA 2KWLA 2CG5B 3DPHA 1UNKA 2XZ0D 1DNYA 2GDYA 1GPJA 2CWOA 2QA4P 3WBHA 1W2BO 3G0VA 2AF8A 1X3OA 4U0BA 4NEOA 3G1IA 2FVFA 2WPTA 2K0YA 1HQBA 2LKIA 2L9FA 1RNIA 4QKOA 4IZ6A 1IUQA 4U0DA 2PENA 2FQ0A 2XV6A 3P05A 2JAZA 3Q20A 2VLPA 5JPAA 4BPGA 1A8OA 1VQPP 1KD1Q 2OTJP 2JYLA 3M1MA 1EOQA 1Q82Q 3G4SP 1T8KA 2LIWA 1QRJA 1YHQP 2CGQA 4R0MA 1ZNVA 3CMEP 1YIJP 2FADA 1ZMBA 1Q86Q
chains in the Genus database with same CATH topology
2NO8A 1UJZA 2VLOA 2WPTA 2GZFA 4QKOA 2ERHA 2K0DX 3GJNA 1UNKA 1IMQA 2VLQA 7CEIA 1EMVA 1GXHA 2VLNA 5EW5E 2JB0A 4UHPB 4F37A 1MZ8A 1ZNVA 3GKLC 2K5XA 2GZGA 2JAZA 1AYIA 2JBGA 2VLPA 1E0HA 1CEIA 2GYKA 3U43A 1BXIA 2GZIA 2GZEA 1IMPA 1FR2A 2GZJA 1GXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NO8 A;  1UJZ A;  2VLO A;  2WPT A;  2GZF A;  4QKO A;  2ERH A;  2K0D X;  3GJN A;  1UNK A;  1IMQ A;  2VLQ A;  7CEI A;  1EMV A;  1GXH A;  2VLN A;  5EW5 E;  2JB0 A;  4UHP B;  4F37 A;  1MZ8 A;  1ZNV A;  3GKL C;  2K5X A;  2GZG A;  2JAZ A;  1AYI A;  2JBG A;  2VLP A;  1E0H A;  1CEI A;  2GYK A;  3U43 A;  1BXI A;  2GZI A;  2GZE A;  1IMP A;  1FR2 A;  2GZJ A;  1GXG A; 
#chains in the Genus database with same CATH topology
 4PXH B;  1VQ6 P;  2P9X A;  4CA3 A;  1KQS O;  2FVE A;  2DNW A;  2N6Y A;  1EIA A;  1D1D A;  2KW2 A;  4UHP B;  2QEX P;  3GKL C;  1M1K Q;  2LL8 A;  4BPH A;  1M74 A;  3CCJ P;  3B4Q A;  3CCQ P;  5DCK A;  1UJZ A;  2KG8 A;  2N5I A;  3DS0 A;  1K73 Q;  4XFZ A;  5EW5 E;  2JU1 A;  5F2N A;  2MVV A;  4U0A A;  4U0C A;  3G21 A;  2EHS A;  3LRY A;  5I4T G;  2QNW A;  2FQ2 A;  2VLO A;  2K93 A;  1GXH A;  1F80 D;  3I55 P;  2DGY A;  2LF4 A;  2KOD A;  1BAJ A;  3I56 P;  1RO0 A;  1QVF O;  3HYB A;  2K0X A;  2GYK A;  3G26 A;  4XRQ A;  5BS1 A;  4COP A;  2K0D X;  4HKG A;  2PEI A;  1YI2 P;  1NQ4 A;  1EMV A;  2PNG A;  4QNB A;  1VQM P;  4BPF A;  4XFY A;  3CC4 P;  2MR7 A;  2L22 A;  2JQ4 A;  3U43 A;  2KOP A;  3GZL A;  1KLP A;  1FR2 A;  4H2X C;  3CCV P;  5HGL A;  2K2Q A;  2KGA A;  4M0I A;  2MD9 A;  5HVC A;  2KGE A;  3CCU P;  3CD6 P;  3VRL C;  2L0Q A;  2PEQ A;  1RO2 A;  2K5X A;  4PWV B;  2JGP A;  1KC8 Q;  2AVA A;  1CEI A;  2AFE A;  2N6Z A;  4IPY A;  4GR2 A;  2KG9 A;  2KR5 A;  1NJI Q;  1GXG A;  1DV5 A;  2N98 A;  2FQ1 A;  3DS1 A;  3EJB A;  2X2B A;  1K8A Q;  4XFX A;  4COC A;  1VQ4 P;  2KGD A;  3DTJ A;  2Z44 A;  2Z46 A;  4H2Y C;  1A43 A;  1E0H A;  1L0H A;  1AUM A;  1BXI A;  1M6N A;  1E6J P;  1IMP A;  3LMO A;  3B5I A;  2LML A;  2AFD A;  2OTL P;  1VQ5 P;  3G6E P;  1M6E X;  3NY7 B;  2M8L A;  5HGN A;  3G1G A;  5CZD B;  1OR5 A;  2L6E A;  2LIU A;  5HGO A;  2VSQ A;  2GDW A;  3CE7 A;  2GZG A;  2MR8 A;  2EHT A;  2BUO A;  3CPW O;  2EFJ A;  2XT1 A;  2GZF A;  2MVU A;  3CCR P;  1K9M Q;  2PEJ A;  3G29 A;  2KGC A;  2JB0 A;  1VHN A;  1M90 Q;  3H4E A;  1VQ9 P;  1AYI A;  2PEM A;  2FHS C;  5EJD A;  1VQ7 P;  2LOL A;  3CCE P;  2GZE A;  5KP6 B;  2FAE A;  3CCL P;  2XXM A;  2JYG A;  2NO8 A;  2JU2 A;  2N50 A;  4GR6 A;  3RG2 A;  1YJ9 P;  5F2K A;  3MGE A;  5KP7 B;  1AF8 A;  1IMQ A;  7CEI A;  2E1M A;  2KOS A;  2KOO A;  2EG5 A;  2FAC A;  2KOR A;  3CCM P;  5BS2 A;  3NTE A;  2K92 A;  2MY5 A;  2PY8 A;  2Z45 A;  3CC7 P;  4PH0 A;  2JO0 A;  4U0F A;  2KG6 A;  1L0I A;  2OAR A;  4XRO A;  4U0E A;  2KOQ A;  1JJ2 O;  2M8N A;  3DS4 A;  3H47 A;  1ACP A;  5F2O A;  3CMA P;  5KP8 B;  3H0D A;  3EJD A;  1HY8 A;  1YJN P;  2GZI A;  2ERH A;  1YJW P;  2LTE A;  1Z6M A;  1S72 P;  2K94 A;  1MZ8 A;  2EIA A;  3CCS P;  1VQO P;  3G71 P;  2CNR A;  1K30 A;  3HZQ A;  1VQL P;  2L4B A;  4MRT C;  1VQN P;  2LPK A;  1N8R Q;  3GZM A;  5HGM A;  2PEK A;  3E2D A;  1Q7Y Q;  2VLN A;  3RG6 C;  1QVG O;  2CQ8 A;  3DS2 A;  4DG9 A;  4H2W C;  2N5H A;  3G28 A;  2BHV A;  4WYM A;  3EJE A;  1VQK P;  2FVA A;  2GZJ A;  2PEO A;  2ONT A;  3GJN A;  2MF4 A;  1VKU A;  2ROQ A;  3CXC O;  2VLQ A;  4PH1 A;  1VQ8 P;  5HV8 A;  4F37 A;  3CC2 P;  3DS3 A;  3OW2 O;  1YIT P;  2JBG A;  1Q81 Q;  2XZ1 C;  2M8P A;  3DS5 A;  2M5R A;  2GDX A;  2KWL A;  2CG5 B;  3DPH A;  1UNK A;  2XZ0 D;  1DNY A;  2GDY A;  1GPJ A;  2CWO A;  2QA4 P;  3WBH A;  1W2B O;  3G0V A;  2AF8 A;  1X3O A;  4U0B A;  4NEO A;  3G1I A;  2FVF A;  2WPT A;  2K0Y A;  1HQB A;  2LKI A;  2L9F A;  1RNI A;  4QKO A;  4IZ6 A;  1IUQ A;  4U0D A;  2PEN A;  2FQ0 A;  2XV6 A;  3P05 A;  2JAZ A;  3Q20 A;  2VLP A;  5JPA A;  4BPG A;  1A8O A;  1VQP P;  1KD1 Q;  2OTJ P;  2JYL A;  3M1M A;  1EOQ A;  1Q82 Q;  3G4S P;  1T8K A;  2LIW A;  1QRJ A;  1YHQ P;  2CGQ A;  4R0M A;  1ZNV A;  3CME P;  1YIJ P;  2FAD A;  1ZMB A;  1Q86 Q; 
#chains in the Genus database with same CATH homology
 2NO8 A;  1UJZ A;  2VLO A;  2WPT A;  2GZF A;  4QKO A;  2ERH A;  2K0D X;  3GJN A;  1UNK A;  1IMQ A;  2VLQ A;  7CEI A;  1EMV A;  1GXH A;  2VLN A;  5EW5 E;  2JB0 A;  4UHP B;  4F37 A;  1MZ8 A;  1ZNV A;  3GKL C;  2K5X A;  2GZG A;  2JAZ A;  1AYI A;  2JBG A;  2VLP A;  1E0H A;  1CEI A;  2GYK A;  3U43 A;  1BXI A;  2GZI A;  2GZE A;  1IMP A;  1FR2 A;  2GZJ A;  1GXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...