1BXIA

Crystal structure of the escherichia coli colicin e9 dnase domain with its cognate immunity protein im9
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
LKASISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVQQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (COLICIN E9 IMMUNITY PROTEIN)
publication title Crystal Structure of the E.Coli Colicin E9 DNase Domain With its Cognate Immunity Protein Im9
pubmed rcsb
source organism Escherichia coli
molecule tags Immune system
total genus 28
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 1998-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1bxiA00
2ERHA 2K5XA 2GZJA 2K0DX 2VLPA 2GZIA 5EW5E 1GXHA 4QKOA 2GZGA 1E0HA 3U43A 1FR2A 2JB0A 2GYKA 1AYIA 2JBGA 2VLOA 2VLQA 3GKLC 2GZEA 1IMQA 7CEIA 2JAZA 2VLNA 1EMVA 1GXGA 1BXIA 1CEIA 4F37A 1ZNVA 4UHPB 2GZFA 1UNKA 3GJNA 1MZ8A 2WPTA 1UJZA 2NO8A 1IMPA
chains in the Genus database with same CATH superfamily
2JU1A 2CNRA 2PNGA 1VHNA 1EOQA 2DGYA 2GZIA 1M74A 2CGQA 1AUMA 2N50A 1EMVA 3NTEA 2MR8A 2QNWA 1K9MQ 5DCKA 3Q20A 2N98A 3G0VA 1QRJA 3RG2A 2FAEA 1M6EX 4M0IA 3DS3A 1A43A 2KGDA 2MY5A 2JQ4A 3CCEP 3G71P 3EJDA 2LKIA 2OTJP 2K2QA 2PEKA 1IMPA 2K5XA 3B5IA 1AF8A 2K92A 2N5IA 1JJ2O 3G26A 3DS5A 1NJIQ 2L22A 2GZGA 1K30A 2XZ0D 4XFXA 3DS4A 2QEXP 4U0BA 1E6JP 3CCQP 1ZNVA 1Q82Q 1MZ8A 2MD9A 3G1GA 2KR5A 2JO0A 3CCMP 5CZDB 1NQ4A 2CG5B 1YJWP 1BAJA 2AF8A 2Z46A 1X3OA 2MR7A 2VLQA 5HGOA 5KP6B 4GR2A 2K0DX 3OW2O 2DNWA 1VQ8P 2K0XA 5EW5E 2N6ZA 4COCA 2KOOA 1W2BO 4DG9A 1VQPP 1S72P 2FVEA 1YJNP 2JAZA 3LRYA 4U0FA 2PENA 3MGEA 3G21A 1UNKA 2E1MA 3CXCO 2M8NA 2KGCA 2N5HA 2PEOA 2LOLA 4PH0A 1OR5A 5EJDA 2GYKA 2L6EA 2VLOA 3GKLC 4QNBA 1YHQP 3CCRP 1A8OA 1VQMP 2PEQA 1BXIA 1CEIA 2KOQA 2JGPA 1VQ7P 1Z6MA 1L0HA 4U0EA 2M8LA 3EJBA 1KQSO 2VLPA 2XV6A 1Q7YQ 4QKOA 1E0HA 2JB0A 3G4SP 3NY7B 2M5RA 5I4TG 4H2YC 1VQ5P 1L0IA 4BPFA 1GXGA 2KGEA 4CA3A 2KG9A 2K0YA 1DV5A 3HZQA 2LMLA 5JPAA 1RNIA 2NO8A 2PEJA 2GDYA 2K93A 3G6EP 2FQ1A 2AVAA 1Q81Q 3DPHA 2BUOA 1DNYA 1T8KA 3RG6C 3I56P 2XXMA 2JYLA 2KWLA 1FR2A 3H4EA 2JBGA 3WBHA 4IZ6A 1IMQA 2AFDA 1YJ9P 3H0DA 4R0MA 1GPJA 2EFJA 1EIAA 2EHSA 1HY8A 2FHSC 3EJEA 1VQOP 3DTJA 1N8RQ 3CMEP 2MVVA 2KG8A 2KODA 1YITP 5HVCA 2EG5A 2KGAA 4U0AA 1IUQA 5HGNA 5HGMA 1D1DA 3CCUP 4GR6A 1RO0A 5BS1A 4HKGA 2KW2A 1KLPA 1VQKP 1VKUA 2LPKA 3GJNA 4PH1A 4MRTC 2GZJA 5BS2A 3P05A 1QVGO 3CCVP 2MF4A 2Z44A 2PY8A 4U0DA 2KG6A 4PXHB 7CEIA 2VLNA 3CCSP 4IPYA 4H2XC 4XFZA 3VRLC 2QA4P 1ACPA 3I55P 3M1MA 2CQ8A 3CD6P 2MVUA 1KC8Q 2ERHA 4WYMA 4BPHA 2K94A 1M1KQ 3DS0A 2VSQA 1KD1Q 3DS2A 1VQ4P 3CC7P 3B4QA 1VQ9P 3G29A 3CMAP 4UHPB 2M8PA 4U0CA 4XFYA 1K73Q 2GZFA 3HYBA 1F80D 1M90Q 5F2OA 2BHVA 1AYIA 2LIUA 2GDXA 1VQLP 4XROA 2EHTA 2FQ0A 2XZ1C 1HQBA 2EIAA 2JYGA 2AFEA 2L9FA 2PEIA 2ONTA 3CCLP 3GZMA 3LMOA 3E2DA 1YIJP 1YI2P 1ZMBA 2KOPA 2P9XA 4XRQA 1UJZA 2ROQA 3DS1A 3CC2P 3U43A 2FQ2A 4H2WC 2GZEA 5HGLA 3CCJP 2N6YA 2GDWA 4F37A 4NEOA 3CE7A 3H47A 3CC4P 2OARA 2FVAA 4PWVB 2XT1A 4BPGA 1VQNP 1GXHA 3G1IA 5KP7B 2LL8A 2FVFA 5F2NA 1Q86Q 2CWOA 1RO2A 2L0QA 2JU2A 2OTLP 1K8AQ 4COPA 2LTEA 5HV8A 2FADA 3G28A 2FACA 5F2KA 3GZLA 2LF4A 2KOSA 5KP8B 1M6NA 2Z45A 2KORA 3CPWO 2L4BA 2X2BA 2LIWA 2PEMA 2WPTA 1QVFO 1VQ6P
chains in the Genus database with same CATH topology
2ERHA 2K5XA 2GZJA 2K0DX 2VLPA 2GZIA 5EW5E 1GXHA 4QKOA 2GZGA 1E0HA 3U43A 1FR2A 2JB0A 2GYKA 1AYIA 2JBGA 2VLOA 2VLQA 3GKLC 2GZEA 1IMQA 7CEIA 2JAZA 2VLNA 1EMVA 1GXGA 1BXIA 1CEIA 4F37A 1ZNVA 4UHPB 2GZFA 1UNKA 3GJNA 1MZ8A 2WPTA 1UJZA 2NO8A 1IMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERH A;  2K5X A;  2GZJ A;  2K0D X;  2VLP A;  2GZI A;  5EW5 E;  1GXH A;  4QKO A;  2GZG A;  1E0H A;  3U43 A;  1FR2 A;  2JB0 A;  2GYK A;  1AYI A;  2JBG A;  2VLO A;  2VLQ A;  3GKL C;  2GZE A;  1IMQ A;  7CEI A;  2JAZ A;  2VLN A;  1EMV A;  1GXG A;  1BXI A;  1CEI A;  4F37 A;  1ZNV A;  4UHP B;  2GZF A;  1UNK A;  3GJN A;  1MZ8 A;  2WPT A;  1UJZ A;  2NO8 A;  1IMP A; 
#chains in the Genus database with same CATH topology
 2JU1 A;  2CNR A;  2PNG A;  1VHN A;  1EOQ A;  2DGY A;  2GZI A;  1M74 A;  2CGQ A;  1AUM A;  2N50 A;  1EMV A;  3NTE A;  2MR8 A;  2QNW A;  1K9M Q;  5DCK A;  3Q20 A;  2N98 A;  3G0V A;  1QRJ A;  3RG2 A;  2FAE A;  1M6E X;  4M0I A;  3DS3 A;  1A43 A;  2KGD A;  2MY5 A;  2JQ4 A;  3CCE P;  3G71 P;  3EJD A;  2LKI A;  2OTJ P;  2K2Q A;  2PEK A;  1IMP A;  2K5X A;  3B5I A;  1AF8 A;  2K92 A;  2N5I A;  1JJ2 O;  3G26 A;  3DS5 A;  1NJI Q;  2L22 A;  2GZG A;  1K30 A;  2XZ0 D;  4XFX A;  3DS4 A;  2QEX P;  4U0B A;  1E6J P;  3CCQ P;  1ZNV A;  1Q82 Q;  1MZ8 A;  2MD9 A;  3G1G A;  2KR5 A;  2JO0 A;  3CCM P;  5CZD B;  1NQ4 A;  2CG5 B;  1YJW P;  1BAJ A;  2AF8 A;  2Z46 A;  1X3O A;  2MR7 A;  2VLQ A;  5HGO A;  5KP6 B;  4GR2 A;  2K0D X;  3OW2 O;  2DNW A;  1VQ8 P;  2K0X A;  5EW5 E;  2N6Z A;  4COC A;  2KOO A;  1W2B O;  4DG9 A;  1VQP P;  1S72 P;  2FVE A;  1YJN P;  2JAZ A;  3LRY A;  4U0F A;  2PEN A;  3MGE A;  3G21 A;  1UNK A;  2E1M A;  3CXC O;  2M8N A;  2KGC A;  2N5H A;  2PEO A;  2LOL A;  4PH0 A;  1OR5 A;  5EJD A;  2GYK A;  2L6E A;  2VLO A;  3GKL C;  4QNB A;  1YHQ P;  3CCR P;  1A8O A;  1VQM P;  2PEQ A;  1BXI A;  1CEI A;  2KOQ A;  2JGP A;  1VQ7 P;  1Z6M A;  1L0H A;  4U0E A;  2M8L A;  3EJB A;  1KQS O;  2VLP A;  2XV6 A;  1Q7Y Q;  4QKO A;  1E0H A;  2JB0 A;  3G4S P;  3NY7 B;  2M5R A;  5I4T G;  4H2Y C;  1VQ5 P;  1L0I A;  4BPF A;  1GXG A;  2KGE A;  4CA3 A;  2KG9 A;  2K0Y A;  1DV5 A;  3HZQ A;  2LML A;  5JPA A;  1RNI A;  2NO8 A;  2PEJ A;  2GDY A;  2K93 A;  3G6E P;  2FQ1 A;  2AVA A;  1Q81 Q;  3DPH A;  2BUO A;  1DNY A;  1T8K A;  3RG6 C;  3I56 P;  2XXM A;  2JYL A;  2KWL A;  1FR2 A;  3H4E A;  2JBG A;  3WBH A;  4IZ6 A;  1IMQ A;  2AFD A;  1YJ9 P;  3H0D A;  4R0M A;  1GPJ A;  2EFJ A;  1EIA A;  2EHS A;  1HY8 A;  2FHS C;  3EJE A;  1VQO P;  3DTJ A;  1N8R Q;  3CME P;  2MVV A;  2KG8 A;  2KOD A;  1YIT P;  5HVC A;  2EG5 A;  2KGA A;  4U0A A;  1IUQ A;  5HGN A;  5HGM A;  1D1D A;  3CCU P;  4GR6 A;  1RO0 A;  5BS1 A;  4HKG A;  2KW2 A;  1KLP A;  1VQK P;  1VKU A;  2LPK A;  3GJN A;  4PH1 A;  4MRT C;  2GZJ A;  5BS2 A;  3P05 A;  1QVG O;  3CCV P;  2MF4 A;  2Z44 A;  2PY8 A;  4U0D A;  2KG6 A;  4PXH B;  7CEI A;  2VLN A;  3CCS P;  4IPY A;  4H2X C;  4XFZ A;  3VRL C;  2QA4 P;  1ACP A;  3I55 P;  3M1M A;  2CQ8 A;  3CD6 P;  2MVU A;  1KC8 Q;  2ERH A;  4WYM A;  4BPH A;  2K94 A;  1M1K Q;  3DS0 A;  2VSQ A;  1KD1 Q;  3DS2 A;  1VQ4 P;  3CC7 P;  3B4Q A;  1VQ9 P;  3G29 A;  3CMA P;  4UHP B;  2M8P A;  4U0C A;  4XFY A;  1K73 Q;  2GZF A;  3HYB A;  1F80 D;  1M90 Q;  5F2O A;  2BHV A;  1AYI A;  2LIU A;  2GDX A;  1VQL P;  4XRO A;  2EHT A;  2FQ0 A;  2XZ1 C;  1HQB A;  2EIA A;  2JYG A;  2AFE A;  2L9F A;  2PEI A;  2ONT A;  3CCL P;  3GZM A;  3LMO A;  3E2D A;  1YIJ P;  1YI2 P;  1ZMB A;  2KOP A;  2P9X A;  4XRQ A;  1UJZ A;  2ROQ A;  3DS1 A;  3CC2 P;  3U43 A;  2FQ2 A;  4H2W C;  2GZE A;  5HGL A;  3CCJ P;  2N6Y A;  2GDW A;  4F37 A;  4NEO A;  3CE7 A;  3H47 A;  3CC4 P;  2OAR A;  2FVA A;  4PWV B;  2XT1 A;  4BPG A;  1VQN P;  1GXH A;  3G1I A;  5KP7 B;  2LL8 A;  2FVF A;  5F2N A;  1Q86 Q;  2CWO A;  1RO2 A;  2L0Q A;  2JU2 A;  2OTL P;  1K8A Q;  4COP A;  2LTE A;  5HV8 A;  2FAD A;  3G28 A;  2FAC A;  5F2K A;  3GZL A;  2LF4 A;  2KOS A;  5KP8 B;  1M6N A;  2Z45 A;  2KOR A;  3CPW O;  2L4B A;  2X2B A;  2LIW A;  2PEM A;  2WPT A;  1QVF O;  1VQ6 P; 
#chains in the Genus database with same CATH homology
 2ERH A;  2K5X A;  2GZJ A;  2K0D X;  2VLP A;  2GZI A;  5EW5 E;  1GXH A;  4QKO A;  2GZG A;  1E0H A;  3U43 A;  1FR2 A;  2JB0 A;  2GYK A;  1AYI A;  2JBG A;  2VLO A;  2VLQ A;  3GKL C;  2GZE A;  1IMQ A;  7CEI A;  2JAZ A;  2VLN A;  1EMV A;  1GXG A;  1BXI A;  1CEI A;  4F37 A;  1ZNV A;  4UHP B;  2GZF A;  1UNK A;  3GJN A;  1MZ8 A;  2WPT A;  1UJZ A;  2NO8 A;  1IMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...