1BXIA

Crystal structure of the escherichia coli colicin e9 dnase domain with its cognate immunity protein im9
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
LKASISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVQQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (COLICIN E9 IMMUNITY PROTEIN)
publication title Crystal Structure of the E.Coli Colicin E9 DNase Domain With its Cognate Immunity Protein Im9
pubmed rcsb
source organism Escherichia coli
molecule tags Immune system
total genus 28
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 1998-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1bxiA00
2GZJA 1UJZA 1UNKA 2JBGA 2VLPA 2JB0A 2ERHA 2GZGA 2K0DX 1E0HA 7CEIA 1IMPA 1GXGA 2GZEA 2WPTA 3GJNA 1MZ8A 5EW5E 2VLOA 3U43A 1ZNVA 4F37A 1FR2A 1IMQA 2GZIA 2VLQA 1AYIA 1GXHA 1EMVA 4QKOA 2K5XA 2JAZA 2NO8A 1CEIA 1BXIA 3GKLC 2VLNA 2GYKA 4UHPB 2GZFA
chains in the Genus database with same CATH superfamily
4PH1A 4U0DA 1QVGO 3EJBA 3DS1A 3DS3A 3H0DA 1GPJA 5CZDB 2KG9A 3VRLC 2K92A 2PEIA 4H2WC 1Z6MA 4R0MA 3G28A 2L9FA 2FVAA 1VQPP 1BAJA 3WBHA 3U43A 2K2QA 3CCLP 1M6EX 2K0YA 3CXCO 1GXHA 4U0CA 4CA3A 1CEIA 1M6NA 2FQ2A 3EJDA 1KLPA 2PY8A 7CEIA 2FVFA 3LMOA 2QA4P 4U0BA 3CC7P 1KD1Q 1NJIQ 2EHTA 1YITP 2FHSC 2N5HA 5I4TG 5JPAA 1VQOP 2VLQA 3MGEA 3G4SP 2EHSA 1YJ9P 2CWOA 3CCUP 1YIJP 4MRTC 1QRJA 3G26A 2XZ0D 2PEJA 2ERHA 1YHQP 2GDYA 2MVVA 1JJ2O 3G0VA 1X3OA 4QNBA 2M8PA 1A43A 4XRQA 4BPGA 1QVFO 2KODA 3G71P 3Q20A 2VLNA 2KW2A 2XZ1C 3G29A 3CCQP 2JGPA 3CMAP 1VHNA 2JBGA 1EOQA 2N6ZA 2EFJA 4COPA 3G1GA 3E2DA 3H47A 2N98A 5F2KA 2JO0A 2BHVA 2X2BA 3CCSP 2BUOA 3CCVP 1Q82Q 2GYKA 4BPFA 1HQBA 1YJWP 2FADA 3DPHA 3G21A 3CCEP 1Q86Q 3RG2A 5HGLA 2AFEA 1DV5A 4M0IA 2FQ1A 2KR5A 2P9XA 2EIAA 2N6YA 3DS0A 2FQ0A 2N50A 2XXMA 2M5RA 4IZ6A 4BPHA 1M90Q 4H2YC 2CG5B 2AF8A 1YJNP 3I56P 2L4BA 2GZEA 5EW5E 2MF4A 1F80D 2M8LA 2JU1A 4XFZA 3NY7B 2GZIA 4NEOA 2N5IA 3DS4A 1YI2P 4PH0A 2PENA 1KQSO 2OARA 2XT1A 2PNGA 2JB0A 3M1MA 3DS2A 1GXGA 1VQKP 1K30A 1Q81Q 2L22A 2M8NA 4XROA 2KGEA 4U0AA 2MR8A 4XFXA 2CNRA 2K5XA 2LIWA 2L6EA 1VQNP 4COCA 2DNWA 5BS2A 2GZFA 2ROQA 3G6EP 5F2OA 1VQ8P 1VQ6P 4GR2A 2LL8A 2K93A 2XV6A 1VQ4P 3I55P 2WPTA 1MZ8A 5KP8B 2OTJP 5KP6B 3RG6C 5HV8A 2MVUA 2MR7A 1L0IA 3B5IA 2FVEA 1BXIA 2MY5A 2QEXP 2KORA 2K0XA 2PEOA 1E6JP 3CCMP 5HGOA 1IMPA 3HZQA 2ONTA 2VLOA 5HGNA 5EJDA 2KWLA 3CCRP 2EG5A 1UJZA 2KGCA 1VKUA 2K0DX 1E0HA 4WYMA 2LPKA 2LOLA 4PXHB 3CMEP 4F37A 5F2NA 4XFYA 1HY8A 3P05A 1NQ4A 1DNYA 5BS1A 3G1IA 2L0QA 2GZJA 2CQ8A 2VSQA 2LTEA 2MD9A 3CC4P 2FACA 3GZMA 3B4QA 4H2XC 3LRYA 1W2BO 1VQMP 1EMVA 1D1DA 1K8AQ 3CPWO 4GR6A 2LIUA 1OR5A 1T8KA 4UHPB 2GDWA 1K73Q 2KGDA 1ACPA 2VLPA 1KC8Q 2GZGA 1AF8A 1RNIA 3DTJA 2KOSA 3GJNA 2JYGA 1ZNVA 2Z45A 1AUMA 3H4EA 3CD6P 1L0HA 1VQ5P 5KP7B 2JAZA 2DGYA 1VQ7P 2GDXA 5HVCA 1UNKA 2KOPA 4U0FA 2JU2A 2PEKA 3CCJP 1IUQA 2KG6A 3HYBA 1RO0A 4U0EA 2E1MA 2FAEA 3OW2O 4PWVB 2NO8A 2Z44A 1N8RQ 5DCKA 2CGQA 1Q7YQ 1VQLP 1K9MQ 3EJEA 2KOOA 2JYLA 2JQ4A 2OTLP 1M1KQ 2AFDA 5HGMA 2LF4A 1A8OA 2PEMA 4HKGA 2LKIA 2PEQA 4DG9A 2K94A 3GKLC 2QNWA 2KG8A 3DS5A 3CE7A 3GZLA 1EIAA 1S72P 1M74A 4IPYA 2AVAA 1ZMBA 2Z46A 1FR2A 3NTEA 2LMLA 1VQ9P 1IMQA 1AYIA 1RO2A 3CC2P 2KOQA 4QKOA 2KGAA
chains in the Genus database with same CATH topology
2GZJA 1UJZA 1UNKA 2JBGA 2VLPA 2JB0A 2ERHA 2GZGA 2K0DX 1E0HA 7CEIA 1IMPA 1GXGA 2GZEA 2WPTA 3GJNA 1MZ8A 5EW5E 2VLOA 3U43A 1ZNVA 4F37A 1FR2A 1IMQA 2GZIA 2VLQA 1AYIA 1GXHA 1EMVA 4QKOA 2K5XA 2JAZA 2NO8A 1CEIA 1BXIA 3GKLC 2VLNA 2GYKA 4UHPB 2GZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZJ A;  1UJZ A;  1UNK A;  2JBG A;  2VLP A;  2JB0 A;  2ERH A;  2GZG A;  2K0D X;  1E0H A;  7CEI A;  1IMP A;  1GXG A;  2GZE A;  2WPT A;  3GJN A;  1MZ8 A;  5EW5 E;  2VLO A;  3U43 A;  1ZNV A;  4F37 A;  1FR2 A;  1IMQ A;  2GZI A;  2VLQ A;  1AYI A;  1GXH A;  1EMV A;  4QKO A;  2K5X A;  2JAZ A;  2NO8 A;  1CEI A;  1BXI A;  3GKL C;  2VLN A;  2GYK A;  4UHP B;  2GZF A; 
#chains in the Genus database with same CATH topology
 4PH1 A;  4U0D A;  1QVG O;  3EJB A;  3DS1 A;  3DS3 A;  3H0D A;  1GPJ A;  5CZD B;  2KG9 A;  3VRL C;  2K92 A;  2PEI A;  4H2W C;  1Z6M A;  4R0M A;  3G28 A;  2L9F A;  2FVA A;  1VQP P;  1BAJ A;  3WBH A;  3U43 A;  2K2Q A;  3CCL P;  1M6E X;  2K0Y A;  3CXC O;  1GXH A;  4U0C A;  4CA3 A;  1CEI A;  1M6N A;  2FQ2 A;  3EJD A;  1KLP A;  2PY8 A;  7CEI A;  2FVF A;  3LMO A;  2QA4 P;  4U0B A;  3CC7 P;  1KD1 Q;  1NJI Q;  2EHT A;  1YIT P;  2FHS C;  2N5H A;  5I4T G;  5JPA A;  1VQO P;  2VLQ A;  3MGE A;  3G4S P;  2EHS A;  1YJ9 P;  2CWO A;  3CCU P;  1YIJ P;  4MRT C;  1QRJ A;  3G26 A;  2XZ0 D;  2PEJ A;  2ERH A;  1YHQ P;  2GDY A;  2MVV A;  1JJ2 O;  3G0V A;  1X3O A;  4QNB A;  2M8P A;  1A43 A;  4XRQ A;  4BPG A;  1QVF O;  2KOD A;  3G71 P;  3Q20 A;  2VLN A;  2KW2 A;  2XZ1 C;  3G29 A;  3CCQ P;  2JGP A;  3CMA P;  1VHN A;  2JBG A;  1EOQ A;  2N6Z A;  2EFJ A;  4COP A;  3G1G A;  3E2D A;  3H47 A;  2N98 A;  5F2K A;  2JO0 A;  2BHV A;  2X2B A;  3CCS P;  2BUO A;  3CCV P;  1Q82 Q;  2GYK A;  4BPF A;  1HQB A;  1YJW P;  2FAD A;  3DPH A;  3G21 A;  3CCE P;  1Q86 Q;  3RG2 A;  5HGL A;  2AFE A;  1DV5 A;  4M0I A;  2FQ1 A;  2KR5 A;  2P9X A;  2EIA A;  2N6Y A;  3DS0 A;  2FQ0 A;  2N50 A;  2XXM A;  2M5R A;  4IZ6 A;  4BPH A;  1M90 Q;  4H2Y C;  2CG5 B;  2AF8 A;  1YJN P;  3I56 P;  2L4B A;  2GZE A;  5EW5 E;  2MF4 A;  1F80 D;  2M8L A;  2JU1 A;  4XFZ A;  3NY7 B;  2GZI A;  4NEO A;  2N5I A;  3DS4 A;  1YI2 P;  4PH0 A;  2PEN A;  1KQS O;  2OAR A;  2XT1 A;  2PNG A;  2JB0 A;  3M1M A;  3DS2 A;  1GXG A;  1VQK P;  1K30 A;  1Q81 Q;  2L22 A;  2M8N A;  4XRO A;  2KGE A;  4U0A A;  2MR8 A;  4XFX A;  2CNR A;  2K5X A;  2LIW A;  2L6E A;  1VQN P;  4COC A;  2DNW A;  5BS2 A;  2GZF A;  2ROQ A;  3G6E P;  5F2O A;  1VQ8 P;  1VQ6 P;  4GR2 A;  2LL8 A;  2K93 A;  2XV6 A;  1VQ4 P;  3I55 P;  2WPT A;  1MZ8 A;  5KP8 B;  2OTJ P;  5KP6 B;  3RG6 C;  5HV8 A;  2MVU A;  2MR7 A;  1L0I A;  3B5I A;  2FVE A;  1BXI A;  2MY5 A;  2QEX P;  2KOR A;  2K0X A;  2PEO A;  1E6J P;  3CCM P;  5HGO A;  1IMP A;  3HZQ A;  2ONT A;  2VLO A;  5HGN A;  5EJD A;  2KWL A;  3CCR P;  2EG5 A;  1UJZ A;  2KGC A;  1VKU A;  2K0D X;  1E0H A;  4WYM A;  2LPK A;  2LOL A;  4PXH B;  3CME P;  4F37 A;  5F2N A;  4XFY A;  1HY8 A;  3P05 A;  1NQ4 A;  1DNY A;  5BS1 A;  3G1I A;  2L0Q A;  2GZJ A;  2CQ8 A;  2VSQ A;  2LTE A;  2MD9 A;  3CC4 P;  2FAC A;  3GZM A;  3B4Q A;  4H2X C;  3LRY A;  1W2B O;  1VQM P;  1EMV A;  1D1D A;  1K8A Q;  3CPW O;  4GR6 A;  2LIU A;  1OR5 A;  1T8K A;  4UHP B;  2GDW A;  1K73 Q;  2KGD A;  1ACP A;  2VLP A;  1KC8 Q;  2GZG A;  1AF8 A;  1RNI A;  3DTJ A;  2KOS A;  3GJN A;  2JYG A;  1ZNV A;  2Z45 A;  1AUM A;  3H4E A;  3CD6 P;  1L0H A;  1VQ5 P;  5KP7 B;  2JAZ A;  2DGY A;  1VQ7 P;  2GDX A;  5HVC A;  1UNK A;  2KOP A;  4U0F A;  2JU2 A;  2PEK A;  3CCJ P;  1IUQ A;  2KG6 A;  3HYB A;  1RO0 A;  4U0E A;  2E1M A;  2FAE A;  3OW2 O;  4PWV B;  2NO8 A;  2Z44 A;  1N8R Q;  5DCK A;  2CGQ A;  1Q7Y Q;  1VQL P;  1K9M Q;  3EJE A;  2KOO A;  2JYL A;  2JQ4 A;  2OTL P;  1M1K Q;  2AFD A;  5HGM A;  2LF4 A;  1A8O A;  2PEM A;  4HKG A;  2LKI A;  2PEQ A;  4DG9 A;  2K94 A;  3GKL C;  2QNW A;  2KG8 A;  3DS5 A;  3CE7 A;  3GZL A;  1EIA A;  1S72 P;  1M74 A;  4IPY A;  2AVA A;  1ZMB A;  2Z46 A;  1FR2 A;  3NTE A;  2LML A;  1VQ9 P;  1IMQ A;  1AYI A;  1RO2 A;  3CC2 P;  2KOQ A;  4QKO A;  2KGA A; 
#chains in the Genus database with same CATH homology
 2GZJ A;  1UJZ A;  1UNK A;  2JBG A;  2VLP A;  2JB0 A;  2ERH A;  2GZG A;  2K0D X;  1E0H A;  7CEI A;  1IMP A;  1GXG A;  2GZE A;  2WPT A;  3GJN A;  1MZ8 A;  5EW5 E;  2VLO A;  3U43 A;  1ZNV A;  4F37 A;  1FR2 A;  1IMQ A;  2GZI A;  2VLQ A;  1AYI A;  1GXH A;  1EMV A;  4QKO A;  2K5X A;  2JAZ A;  2NO8 A;  1CEI A;  1BXI A;  3GKL C;  2VLN A;  2GYK A;  4UHP B;  2GZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...