3DPHA

Hiv-1 capsid c-terminal domain mutant (l211s)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
78
structure length
78
Chain Sequence
PTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATSEEMMTACQGVGGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords HIV-1 CAPSID PROTEIN
publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 29
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3dphA00
3H4EA 3DS3A 2LF4A 4XRQA 5HGMA 5HGNA 1EIAA 2L6EA 2JYLA 4XFXA 3NTEA 3G1IA 2JO0A 4M0IA 2ONTA 2XT1A 3DS5A 3DS2A 3G21A 1E6JP 3G28A 5I4TG 3G26A 1D1DA 2BUOA 3DS4A 4XFYA 4U0AA 3DS1A 2KODA 3G0VA 3MGEA 4U0EA 1BAJA 2XXMA 1EOQA 3H47A 4U0DA 2M8LA 5HGOA 4COCA 2JYGA 4PH0A 2EIAA 4IPYA 4XROA 3VRLC 3DS0A 4QNBA 3DPHA 3DTJA 3LRYA 4U0FA 4U0CA 2M8NA 2M8PA 1A8OA 4PH1A 4XFZA 3G29A 5HGLA 4U0BA 4WYMA 4COPA 5JPAA 1A43A 3P05A 1AUMA 2XV6A 5DCKA 3G1GA 1QRJA
chains in the Genus database with same CATH superfamily
2KG6A 2K2QA 2PENA 2FVFA 2CWOA 3I56P 2KOQA 5EW5E 1Q81Q 4UHPB 2MVUA 3EJDA 2QA4P 4MRTC 3HYBA 2GZFA 1VQPP 2N98A 3DS3A 4XRQA 2ERHA 2L9FA 2PEMA 3DS1A 1BAJA 1EOQA 4R0MA 2CGQA 2N6ZA 2KGDA 4QNBA 3DTJA 3G29A 4U0BA 1VHNA 1GXHA 2CQ8A 3G1GA 1IMQA 2KG8A 1N8RQ 5KP8B 3CC7P 2LOLA 2L0QA 1VQ4P 2GDYA 1IUQA 1HY8A 4U0EA 2M8LA 1VQMP 1E0HA 3LRYA 2FQ1A 2PY8A 2PEOA 1K73Q 2GZIA 3GJNA 4BPGA 2VLPA 2PNGA 4PXHB 4H2YC 5HGOA 4COCA 3LMOA 2PEJA 1CEIA 7CEIA 1DV5A 2M5RA 2KOSA 4H2XC 1NQ4A 4COPA 5JPAA 2PEIA 3CD6P 1QRJA 3H0DA 2FADA 2KOOA 3G4SP 2ONTA 3DS5A 4XFYA 3MGEA 1M6EX 2LTEA 1VQ9P 3DS0A 2KW2A 4CA3A 1UJZA 1Q86Q 2PEQA 1L0HA 2AF8A 2E1MA 1OR5A 3GZLA 2FACA 2JB0A 2GYKA 1Q82Q 4BPHA 2KG9A 2KORA 2JAZA 1S72P 2XZ1C 1YI2P 2AFDA 2K5XA 2Z45A 2FVEA 4PWVB 3I55P 2MD9A 2N5IA 3EJEA 3CXCO 5KP7B 2L6EA 1FR2A 1M90Q 3G26A 2BUOA 2KODA 4BPFA 1Z6MA 1ZNVA 2K94A 2N50A 4U0CA 1RO0A 2OARA 5F2OA 4WYMA 1A43A 1NJIQ 3CE7A 2LKIA 1AYIA 2XT1A 2LIWA 2FVAA 4U0DA 4HKGA 2X2BA 1VQNP 3G6EP 3CCVP 3U43A 2KWLA 2Z46A 2JGPA 2PEKA 5DCKA 2QNWA 1EMVA 1YJ9P 5HGMA 2MY5A 3G1IA 3G71P 2OTLP 3G28A 2CNRA 1M6NA 2LIUA 1RNIA 3H47A 1L0IA 3CCEP 1VQKP 2K0YA 2L22A 2KOPA 1GPJA 2M8NA 2LPKA 2M8PA 1JJ2O 1AUMA 2XV6A 1VQ5P 2GZJA 1M74A 5HV8A 4XFXA 1W2BO 3Q20A 4M0IA 2K0XA 1RO2A 1BXIA 2DGYA 4QKOA 3CCMP 1M1KQ 2FHSC 2BHVA 1YITP 1UNKA 3CPWO 1X3OA 4U0FA 1A8OA 4NEOA 2FQ2A 1VQ7P 4GR2A 2Z44A 1YIJP 2GDXA 4IZ6A 3G21A 5F2KA 2KR5A 3B4QA 2CG5B 1VQOP 2XXMA 3WBHA 3B5IA 2VLQA 4F37A 3RG6C 5HGLA 3P05A 2NO8A 1YJNP 5HVCA 1HQBA 3DS2A 2MR8A 3EJBA 2K0DX 4U0AA 2EHTA 2FQ0A 1GXGA 1K30A 2JYGA 2JU1A 2EHSA 3GKLC 3GZMA 2DNWA 4DG9A 2FAEA 5BS1A 2VLNA 3H4EA 1DNYA 2JBGA 1QVFO 1KC8Q 3E2DA 1ZMBA 2L4BA 3DS4A 1YHQP 4XROA 2QEXP 1VQLP 4XFZA 2N5HA 2N6YA 1QVGO 3CCLP 2LMLA 5HGNA 2AFEA 3NTEA 1VQ8P 2JO0A 2ROQA 2VSQA 1D1DA 1IMPA 4GR6A 2K93A 2AVAA 2EIAA 4IPYA 2LL8A 1K9MQ 2EG5A 3RG2A 3M1MA 3NY7B 2KGEA 2MVVA 3CMEP 5F2NA 2MR7A 2GZEA 2EFJA 2LF4A 1T8KA 1EIAA 2WPTA 1KQSO 5I4TG 1KLPA 3OW2O 2GZGA 1K8AQ 1AF8A 3HZQA 1F80D 4H2WC 4PH0A 3VRLC 3CC4P 3DPHA 3CCQP 1KD1Q 2OTJP 4PH1A 1VQ6P 3CCSP 2GDWA 2VLOA 5BS2A 1ACPA 2KGAA 2JYLA 1MZ8A 2JQ4A 1YJWP 3CCUP 2KGCA 1E6JP 5EJDA 3G0VA 1Q7YQ 2MF4A 3CC2P 1VKUA 2P9XA 2JU2A 5CZDB 3CCJP 2K92A 2XZ0D 3CCRP 3CMAP 5KP6B
chains in the Genus database with same CATH topology
3H4EA 1YJ9P 5HGMA 1QVFO 3G4SP 2PENA 1KC8Q 3G1IA 3G71P 2ONTA 3DS5A 2OTLP 3E2DA 2CWOA 3G28A 3I56P 1ZMBA 1M6NA 1RNIA 3DS4A 4XFYA 1Q81Q 3MGEA 3H47A 2QA4P 3CCEP 1M6EX 1YHQP 1VQKP 4XROA 1VQ9P 3DS0A 2QEXP 1VQLP 3HYBA 4XFZA 2M8NA 2M8PA 1VQPP 1JJ2O 1Q86Q 2PEQA 1AUMA 2XV6A 1VQ5P 2E1MA 1QVGO 3CCLP 1M74A 3DS3A 4XRQA 5HGNA 4XFXA 1W2BO 3NTEA 3Q20A 1VQ8P 2JO0A 4M0IA 2PEMA 1RO2A 1Q82Q 1D1DA 2DGYA 3CCMP 1M1KQ 4GR6A 3DS1A 2BHVA 1S72P 1BAJA 1EOQA 1YI2P 2EIAA 4IPYA 1YITP 3CPWO 4QNBA 2Z45A 1K9MQ 2EG5A 3DTJA 4U0FA 1A8OA 3G29A 3M1MA 4U0BA 3I55P 3G1GA 3CMEP 5F2NA 1VQ7P 4GR2A 3CXCO 1N8RQ 2EFJA 2Z44A 2LF4A 1YIJP 1EIAA 2L6EA 1KQSO 3CC7P 1M90Q 3G21A 5F2KA 5I4TG 3G26A 2BUOA 1VQ4P 3OW2O 1VQOP 1IUQA 2KODA 3HZQA 4U0EA 1K8AQ 2XXMA 2M8LA 4PH0A 1VQMP 3VRLC 3CC4P 3WBHA 3B5IA 3DPHA 3CCQP 1KD1Q 2OTJP 3LRYA 4U0CA 1RO0A 3RG6C 4PH1A 2OARA 5HGLA 5F2OA 4WYMA 1VQ6P 1A43A 3P05A 1NJIQ 3CCSP 1YJNP 5BS2A 2PY8A 2JYLA 2PEOA 1K73Q 1YJWP 2XT1A 3CCUP 3DS2A 1E6JP 4U0AA 3G0VA 1Q7YQ 5HGOA 4U0DA 3CC2P 4COCA 1K30A 2JYGA 2PEJA 1VQNP 3G6EP 2P9XA 3CCVP 2Z46A 3CCJP 4COPA 5JPAA 2PEIA 3CD6P 2PEKA 5DCKA 5BS1A 3CCRP 1QRJA 3CMAP 3H0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H4E A;  3DS3 A;  2LF4 A;  4XRQ A;  5HGM A;  5HGN A;  1EIA A;  2L6E A;  2JYL A;  4XFX A;  3NTE A;  3G1I A;  2JO0 A;  4M0I A;  2ONT A;  2XT1 A;  3DS5 A;  3DS2 A;  3G21 A;  1E6J P;  3G28 A;  5I4T G;  3G26 A;  1D1D A;  2BUO A;  3DS4 A;  4XFY A;  4U0A A;  3DS1 A;  2KOD A;  3G0V A;  3MGE A;  4U0E A;  1BAJ A;  2XXM A;  1EOQ A;  3H47 A;  4U0D A;  2M8L A;  5HGO A;  4COC A;  2JYG A;  4PH0 A;  2EIA A;  4IPY A;  4XRO A;  3VRL C;  3DS0 A;  4QNB A;  3DPH A;  3DTJ A;  3LRY A;  4U0F A;  4U0C A;  2M8N A;  2M8P A;  1A8O A;  4PH1 A;  4XFZ A;  3G29 A;  5HGL A;  4U0B A;  4WYM A;  4COP A;  5JPA A;  1A43 A;  3P05 A;  1AUM A;  2XV6 A;  5DCK A;  3G1G A;  1QRJ A; 
#chains in the Genus database with same CATH topology
 2KG6 A;  2K2Q A;  2PEN A;  2FVF A;  2CWO A;  3I56 P;  2KOQ A;  5EW5 E;  1Q81 Q;  4UHP B;  2MVU A;  3EJD A;  2QA4 P;  4MRT C;  3HYB A;  2GZF A;  1VQP P;  2N98 A;  3DS3 A;  4XRQ A;  2ERH A;  2L9F A;  2PEM A;  3DS1 A;  1BAJ A;  1EOQ A;  4R0M A;  2CGQ A;  2N6Z A;  2KGD A;  4QNB A;  3DTJ A;  3G29 A;  4U0B A;  1VHN A;  1GXH A;  2CQ8 A;  3G1G A;  1IMQ A;  2KG8 A;  1N8R Q;  5KP8 B;  3CC7 P;  2LOL A;  2L0Q A;  1VQ4 P;  2GDY A;  1IUQ A;  1HY8 A;  4U0E A;  2M8L A;  1VQM P;  1E0H A;  3LRY A;  2FQ1 A;  2PY8 A;  2PEO A;  1K73 Q;  2GZI A;  3GJN A;  4BPG A;  2VLP A;  2PNG A;  4PXH B;  4H2Y C;  5HGO A;  4COC A;  3LMO A;  2PEJ A;  1CEI A;  7CEI A;  1DV5 A;  2M5R A;  2KOS A;  4H2X C;  1NQ4 A;  4COP A;  5JPA A;  2PEI A;  3CD6 P;  1QRJ A;  3H0D A;  2FAD A;  2KOO A;  3G4S P;  2ONT A;  3DS5 A;  4XFY A;  3MGE A;  1M6E X;  2LTE A;  1VQ9 P;  3DS0 A;  2KW2 A;  4CA3 A;  1UJZ A;  1Q86 Q;  2PEQ A;  1L0H A;  2AF8 A;  2E1M A;  1OR5 A;  3GZL A;  2FAC A;  2JB0 A;  2GYK A;  1Q82 Q;  4BPH A;  2KG9 A;  2KOR A;  2JAZ A;  1S72 P;  2XZ1 C;  1YI2 P;  2AFD A;  2K5X A;  2Z45 A;  2FVE A;  4PWV B;  3I55 P;  2MD9 A;  2N5I A;  3EJE A;  3CXC O;  5KP7 B;  2L6E A;  1FR2 A;  1M90 Q;  3G26 A;  2BUO A;  2KOD A;  4BPF A;  1Z6M A;  1ZNV A;  2K94 A;  2N50 A;  4U0C A;  1RO0 A;  2OAR A;  5F2O A;  4WYM A;  1A43 A;  1NJI Q;  3CE7 A;  2LKI A;  1AYI A;  2XT1 A;  2LIW A;  2FVA A;  4U0D A;  4HKG A;  2X2B A;  1VQN P;  3G6E P;  3CCV P;  3U43 A;  2KWL A;  2Z46 A;  2JGP A;  2PEK A;  5DCK A;  2QNW A;  1EMV A;  1YJ9 P;  5HGM A;  2MY5 A;  3G1I A;  3G71 P;  2OTL P;  3G28 A;  2CNR A;  1M6N A;  2LIU A;  1RNI A;  3H47 A;  1L0I A;  3CCE P;  1VQK P;  2K0Y A;  2L22 A;  2KOP A;  1GPJ A;  2M8N A;  2LPK A;  2M8P A;  1JJ2 O;  1AUM A;  2XV6 A;  1VQ5 P;  2GZJ A;  1M74 A;  5HV8 A;  4XFX A;  1W2B O;  3Q20 A;  4M0I A;  2K0X A;  1RO2 A;  1BXI A;  2DGY A;  4QKO A;  3CCM P;  1M1K Q;  2FHS C;  2BHV A;  1YIT P;  1UNK A;  3CPW O;  1X3O A;  4U0F A;  1A8O A;  4NEO A;  2FQ2 A;  1VQ7 P;  4GR2 A;  2Z44 A;  1YIJ P;  2GDX A;  4IZ6 A;  3G21 A;  5F2K A;  2KR5 A;  3B4Q A;  2CG5 B;  1VQO P;  2XXM A;  3WBH A;  3B5I A;  2VLQ A;  4F37 A;  3RG6 C;  5HGL A;  3P05 A;  2NO8 A;  1YJN P;  5HVC A;  1HQB A;  3DS2 A;  2MR8 A;  3EJB A;  2K0D X;  4U0A A;  2EHT A;  2FQ0 A;  1GXG A;  1K30 A;  2JYG A;  2JU1 A;  2EHS A;  3GKL C;  3GZM A;  2DNW A;  4DG9 A;  2FAE A;  5BS1 A;  2VLN A;  3H4E A;  1DNY A;  2JBG A;  1QVF O;  1KC8 Q;  3E2D A;  1ZMB A;  2L4B A;  3DS4 A;  1YHQ P;  4XRO A;  2QEX P;  1VQL P;  4XFZ A;  2N5H A;  2N6Y A;  1QVG O;  3CCL P;  2LML A;  5HGN A;  2AFE A;  3NTE A;  1VQ8 P;  2JO0 A;  2ROQ A;  2VSQ A;  1D1D A;  1IMP A;  4GR6 A;  2K93 A;  2AVA A;  2EIA A;  4IPY A;  2LL8 A;  1K9M Q;  2EG5 A;  3RG2 A;  3M1M A;  3NY7 B;  2KGE A;  2MVV A;  3CME P;  5F2N A;  2MR7 A;  2GZE A;  2EFJ A;  2LF4 A;  1T8K A;  1EIA A;  2WPT A;  1KQS O;  5I4T G;  1KLP A;  3OW2 O;  2GZG A;  1K8A Q;  1AF8 A;  3HZQ A;  1F80 D;  4H2W C;  4PH0 A;  3VRL C;  3CC4 P;  3DPH A;  3CCQ P;  1KD1 Q;  2OTJ P;  4PH1 A;  1VQ6 P;  3CCS P;  2GDW A;  2VLO A;  5BS2 A;  1ACP A;  2KGA A;  2JYL A;  1MZ8 A;  2JQ4 A;  1YJW P;  3CCU P;  2KGC A;  1E6J P;  5EJD A;  3G0V A;  1Q7Y Q;  2MF4 A;  3CC2 P;  1VKU A;  2P9X A;  2JU2 A;  5CZD B;  3CCJ P;  2K92 A;  2XZ0 D;  3CCR P;  3CMA P;  5KP6 B; 
#chains in the Genus database with same CATH homology
 3H4E A;  1YJ9 P;  5HGM A;  1QVF O;  3G4S P;  2PEN A;  1KC8 Q;  3G1I A;  3G71 P;  2ONT A;  3DS5 A;  2OTL P;  3E2D A;  2CWO A;  3G28 A;  3I56 P;  1ZMB A;  1M6N A;  1RNI A;  3DS4 A;  4XFY A;  1Q81 Q;  3MGE A;  3H47 A;  2QA4 P;  3CCE P;  1M6E X;  1YHQ P;  1VQK P;  4XRO A;  1VQ9 P;  3DS0 A;  2QEX P;  1VQL P;  3HYB A;  4XFZ A;  2M8N A;  2M8P A;  1VQP P;  1JJ2 O;  1Q86 Q;  2PEQ A;  1AUM A;  2XV6 A;  1VQ5 P;  2E1M A;  1QVG O;  3CCL P;  1M74 A;  3DS3 A;  4XRQ A;  5HGN A;  4XFX A;  1W2B O;  3NTE A;  3Q20 A;  1VQ8 P;  2JO0 A;  4M0I A;  2PEM A;  1RO2 A;  1Q82 Q;  1D1D A;  2DGY A;  3CCM P;  1M1K Q;  4GR6 A;  3DS1 A;  2BHV A;  1S72 P;  1BAJ A;  1EOQ A;  1YI2 P;  2EIA A;  4IPY A;  1YIT P;  3CPW O;  4QNB A;  2Z45 A;  1K9M Q;  2EG5 A;  3DTJ A;  4U0F A;  1A8O A;  3G29 A;  3M1M A;  4U0B A;  3I55 P;  3G1G A;  3CME P;  5F2N A;  1VQ7 P;  4GR2 A;  3CXC O;  1N8R Q;  2EFJ A;  2Z44 A;  2LF4 A;  1YIJ P;  1EIA A;  2L6E A;  1KQS O;  3CC7 P;  1M90 Q;  3G21 A;  5F2K A;  5I4T G;  3G26 A;  2BUO A;  1VQ4 P;  3OW2 O;  1VQO P;  1IUQ A;  2KOD A;  3HZQ A;  4U0E A;  1K8A Q;  2XXM A;  2M8L A;  4PH0 A;  1VQM P;  3VRL C;  3CC4 P;  3WBH A;  3B5I A;  3DPH A;  3CCQ P;  1KD1 Q;  2OTJ P;  3LRY A;  4U0C A;  1RO0 A;  3RG6 C;  4PH1 A;  2OAR A;  5HGL A;  5F2O A;  4WYM A;  1VQ6 P;  1A43 A;  3P05 A;  1NJI Q;  3CCS P;  1YJN P;  5BS2 A;  2PY8 A;  2JYL A;  2PEO A;  1K73 Q;  1YJW P;  2XT1 A;  3CCU P;  3DS2 A;  1E6J P;  4U0A A;  3G0V A;  1Q7Y Q;  5HGO A;  4U0D A;  3CC2 P;  4COC A;  1K30 A;  2JYG A;  2PEJ A;  1VQN P;  3G6E P;  2P9X A;  3CCV P;  2Z46 A;  3CCJ P;  4COP A;  5JPA A;  2PEI A;  3CD6 P;  2PEK A;  5DCK A;  5BS1 A;  3CCR P;  1QRJ A;  3CMA P;  3H0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...