3DPHA

Hiv-1 capsid c-terminal domain mutant (l211s)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
78
structure length
78
Chain Sequence
b'PTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATSEEMMTACQGVGGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 CAPSID PROTEIN
publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 29
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3dphA00
4QNBA 4COPA 1D1DA 2M8PA 3P05A 2EIAA 4PH1A 2M8LA 4PH0A 1AUMA 3MGEA 3NTEA 4U0CA 5HGOA 1QRJA 3G26A 3DPHA 2JYLA 5HGNA 3DS0A 4WYMA 4U0FA 5JPAA 4XROA 2JO0A 3G1GA 3G29A 4U0DA 4XFYA 3DS2A 2M8NA 1A8OA 4U0EA 5DCKA 3VRLC 4COCA 2LF4A 2L6EA 3DS4A 3DTJA 1A43A 3G21A 3LRYA 5HGLA 4XRQA 1EOQA 2XXMA 1E6JP 4XFXA 2JYGA 4U0BA 4U0AA 1BAJA 3G28A 2KODA 3DS5A 4XFZA 2XT1A 3G0VA 2ONTA 2XV6A 4IPYA 3DS3A 3H47A 5HGMA 4M0IA 5I4TG 1EIAA 3H4EA 2BUOA 3DS1A 3G1IA
chains in the Genus database with same CATH superfamily
2GDWA 2MY5A 2GZIA 2N98A 3HYBA 1Z6MA 1IMQA 2QA4P 2PEQA 2GZJA 4DG9A 1L0IA 2GZEA 2EG5A 2M5RA 3Q20A 1VQOP 2LKIA 5F2NA 3DS1A 4PH0A 3OW2O 2KG8A 2BHVA 2LMLA 1GPJA 2K93A 1EMVA 2MVUA 1IUQA 3DS0A 3G29A 4PXHB 4XFYA 3CMAP 2KOSA 3CXCO 2L6EA 1RO2A 4R0MA 3CCLP 1YJWP 2FAEA 2EHSA 2K0DX 2LIUA 2Z46A 3M1MA 1VQPP 1KC8Q 3CCMP 3G26A 2AVAA 2JBGA 3GKLC 2FQ1A 5KP8B 2LF4A 3WBHA 4IZ6A 4XRQA 4BPFA 2GDXA 5KP6B 3CCUP 4IPYA 1M74A 2KGDA 1YJNP 2FVEA 2CQ8A 2FVFA 2MR8A 3G71P 2JB0A 3I55P 1ZNVA 2JAZA 3RG2A 2N6ZA 1VQ4P 2N5IA 2N50A 3G1GA 2PEIA 5CZDB 1AF8A 2JU1A 4U0BA 3B4QA 1BAJA 1K73Q 1VQMP 1Q7YQ 4PH1A 3GJNA 1KQSO 2PEJA 2K0YA 2PEMA 4U0EA 3U43A 3G21A 1NQ4A 1MZ8A 3G0VA 1VQLP 3DS3A 3H4EA 2M8PA 1K30A 3DPHA 2KG6A 4XROA 3CC4P 5BS2A 1M6EX 2EHTA 5F2KA 1DNYA 2KW2A 7CEIA 2K94A 4BPHA 2KR5A 3G6EP 2PENA 2PNGA 3RG6C 1D1DA 3G4SP 2GYKA 1ACPA 1F80D 5HGNA 1VQ6P 1T8KA 1VQNP 2VLQA 2VLPA 2L4BA 1VHNA 3CCVP 4XFZA 1YJ9P 2N5HA 2X2BA 2L0QA 5HGMA 2FADA 2XZ1C 2CWOA 2MD9A 3CC7P 3CC2P 5HV8A 4H2WC 2M8LA 1AUMA 3LMOA 3CPWO 2VLNA 1QVFO 2GZGA 4U0DA 2DGYA 3VRLC 4COCA 1CEIA 2AF8A 3LRYA 1M90Q 1DV5A 4U0AA 3G28A 2KG9A 3DS5A 3GZLA 1UJZA 2ONTA 1RNIA 1JJ2O 4QNBA 1ZMBA 3EJEA 3NTEA 2LOLA 2PY8A 2LIWA 1VQ5P 2JYLA 1X3OA 2L22A 2AFEA 3CE7A 2DNWA 2WPTA 2Z45A 3DTJA 1QVGO 2LL8A 1GXHA 2GDYA 4M0IA 1M6NA 4UHPB 1K8AQ 2MF4A 3EJDA 4WYMA 1EOQA 2EFJA 5BS1A 1E6JP 2CG5B 4XFXA 2JYGA 2L9FA 2PEOA 2VSQA 2JU2A 4GR6A 2BUOA 3E2DA 3B5IA 2CGQA 2XZ0D 4U0CA 5HGOA 2LTEA 1K9MQ 1Q82Q 5KP7B 2ERHA 1E0HA 2LPKA 5HGLA 4H2YC 2FQ2A 2P9XA 4PWVB 2KOPA 1FR2A 4GR2A 3I56P 1NJIQ 1KLPA 1QRJA 1YI2P 4U0FA 2JO0A 2M8NA 4QKOA 2OTJP 2FVAA 1AYIA 1Q86Q 1M1KQ 2JQ4A 1W2BO 1Q81Q 2FQ0A 2KGEA 3H0DA 1N8RQ 3G1IA 3NY7B 1HY8A 2MVVA 4HKGA 3CCEP 4CA3A 2K5XA 4MRTC 2XXMA 2FACA 2KODA 1YHQP 2VLOA 2AFDA 3H47A 2N6YA 5I4TG 4F37A 1S72P 4COPA 2OARA 3MGEA 2KGCA 1YIJP 3HZQA 2OTLP 5JPAA 2KGAA 4BPGA 2KOOA 1A8OA 3DS4A 1VQKP 2PEKA 2MR7A 2QNWA 2KOQA 1L0HA 1EIAA 2Z44A 3CMEP 2KORA 3P05A 4H2XC 3CCJP 5EJDA 1VKUA 3CCRP 2E1MA 1YITP 3DS2A 1VQ9P 1KD1Q 1BXIA 2K2QA 4NEOA 1UNKA 1IMPA 2GZFA 3CCSP 1GXGA 2ROQA 3EJBA 2EIAA 3CCQP 2K92A 1VQ8P 2NO8A 2FHSC 5DCKA 3GZMA 2K0XA 1A43A 2QEXP 2CNRA 5EW5E 5HVCA 2JGPA 1HQBA 1RO0A 3CD6P 5F2OA 2XT1A 2XV6A 1OR5A 2KWLA 1VQ7P
chains in the Genus database with same CATH topology
4QNBA 1Q7YQ 1ZMBA 4PH1A 3NTEA 2PY8A 3CCEP 1VQ5P 1KQSO 2JYLA 2PEJA 3HYBA 2PEMA 4U0EA 2QA4P 3G21A 3DTJA 2Z45A 2PEQA 2XXMA 1QVGO 2KODA 3G0VA 1VQLP 1YHQP 3DS3A 3H47A 2EG5A 4M0IA 5I4TG 3Q20A 3H4EA 1VQOP 1M6NA 5F2NA 3DS1A 1S72P 4COPA 2M8PA 1K30A 4PH0A 3OW2O 1K8AQ 2OARA 3MGEA 2BHVA 1YIJP 3HZQA 2OTLP 5JPAA 3DPHA 1IUQA 3DS0A 4WYMA 4XROA 3CC4P 5BS2A 3G29A 4XFYA 3CMAP 1M6EX 1A8OA 5F2KA 3CXCO 3DS4A 2L6EA 1VQKP 1RO2A 2PEKA 1EOQA 2EFJA 5BS1A 1E6JP 4XFXA 2JYGA 3CCLP 1YJWP 2PEOA 4GR6A 2Z46A 3G6EP 1EIAA 2PENA 2Z44A 2BUOA 3E2DA 3CMEP 3B5IA 3M1MA 3RG6C 1D1DA 1VQPP 3P05A 3G4SP 1KC8Q 3CCJP 4U0CA 3CCMP 5HGOA 3G26A 5HGNA 1VQ6P 3CCRP 1VQNP 1K9MQ 2E1MA 1Q82Q 1YITP 3DS2A 1VQ9P 1KD1Q 2LF4A 5HGLA 3CCVP 3WBHA 4XRQA 2P9XA 4XFZA 3CCSP 3CCUP 1YJ9P 4IPYA 1M74A 1YJNP 5HGMA 2CWOA 3CC7P 3G71P 4GR2A 3CC2P 2EIAA 2M8LA 3I56P 3I55P 1NJIQ 1AUMA 3CCQP 3CPWO 1QRJA 1VQ4P 1VQ8P 1YI2P 4U0FA 1QVFO 2JO0A 3G1GA 2PEIA 4U0DA 2M8NA 2OTJP 5DCKA 2DGYA 3VRLC 4COCA 1A43A 3LRYA 1M90Q 1Q86Q 2QEXP 1M1KQ 4U0BA 4U0AA 1BAJA 1RO0A 3G28A 3DS5A 5F2OA 1W2BO 1Q81Q 2XT1A 3CD6P 1K73Q 2ONTA 2XV6A 3H0DA 1RNIA 1VQ7P 1JJ2O 1VQMP 1N8RQ 3G1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QNB A;  4COP A;  1D1D A;  2M8P A;  3P05 A;  2EIA A;  4PH1 A;  2M8L A;  4PH0 A;  1AUM A;  3MGE A;  3NTE A;  4U0C A;  5HGO A;  1QRJ A;  3G26 A;  3DPH A;  2JYL A;  5HGN A;  3DS0 A;  4WYM A;  4U0F A;  5JPA A;  4XRO A;  2JO0 A;  3G1G A;  3G29 A;  4U0D A;  4XFY A;  3DS2 A;  2M8N A;  1A8O A;  4U0E A;  5DCK A;  3VRL C;  4COC A;  2LF4 A;  2L6E A;  3DS4 A;  3DTJ A;  1A43 A;  3G21 A;  3LRY A;  5HGL A;  4XRQ A;  1EOQ A;  2XXM A;  1E6J P;  4XFX A;  2JYG A;  4U0B A;  4U0A A;  1BAJ A;  3G28 A;  2KOD A;  3DS5 A;  4XFZ A;  2XT1 A;  3G0V A;  2ONT A;  2XV6 A;  4IPY A;  3DS3 A;  3H47 A;  5HGM A;  4M0I A;  5I4T G;  1EIA A;  3H4E A;  2BUO A;  3DS1 A;  3G1I A; 
#chains in the Genus database with same CATH topology
 2GDW A;  2MY5 A;  2GZI A;  2N98 A;  3HYB A;  1Z6M A;  1IMQ A;  2QA4 P;  2PEQ A;  2GZJ A;  4DG9 A;  1L0I A;  2GZE A;  2EG5 A;  2M5R A;  3Q20 A;  1VQO P;  2LKI A;  5F2N A;  3DS1 A;  4PH0 A;  3OW2 O;  2KG8 A;  2BHV A;  2LML A;  1GPJ A;  2K93 A;  1EMV A;  2MVU A;  1IUQ A;  3DS0 A;  3G29 A;  4PXH B;  4XFY A;  3CMA P;  2KOS A;  3CXC O;  2L6E A;  1RO2 A;  4R0M A;  3CCL P;  1YJW P;  2FAE A;  2EHS A;  2K0D X;  2LIU A;  2Z46 A;  3M1M A;  1VQP P;  1KC8 Q;  3CCM P;  3G26 A;  2AVA A;  2JBG A;  3GKL C;  2FQ1 A;  5KP8 B;  2LF4 A;  3WBH A;  4IZ6 A;  4XRQ A;  4BPF A;  2GDX A;  5KP6 B;  3CCU P;  4IPY A;  1M74 A;  2KGD A;  1YJN P;  2FVE A;  2CQ8 A;  2FVF A;  2MR8 A;  3G71 P;  2JB0 A;  3I55 P;  1ZNV A;  2JAZ A;  3RG2 A;  2N6Z A;  1VQ4 P;  2N5I A;  2N50 A;  3G1G A;  2PEI A;  5CZD B;  1AF8 A;  2JU1 A;  4U0B A;  3B4Q A;  1BAJ A;  1K73 Q;  1VQM P;  1Q7Y Q;  4PH1 A;  3GJN A;  1KQS O;  2PEJ A;  2K0Y A;  2PEM A;  4U0E A;  3U43 A;  3G21 A;  1NQ4 A;  1MZ8 A;  3G0V A;  1VQL P;  3DS3 A;  3H4E A;  2M8P A;  1K30 A;  3DPH A;  2KG6 A;  4XRO A;  3CC4 P;  5BS2 A;  1M6E X;  2EHT A;  5F2K A;  1DNY A;  2KW2 A;  7CEI A;  2K94 A;  4BPH A;  2KR5 A;  3G6E P;  2PEN A;  2PNG A;  3RG6 C;  1D1D A;  3G4S P;  2GYK A;  1ACP A;  1F80 D;  5HGN A;  1VQ6 P;  1T8K A;  1VQN P;  2VLQ A;  2VLP A;  2L4B A;  1VHN A;  3CCV P;  4XFZ A;  1YJ9 P;  2N5H A;  2X2B A;  2L0Q A;  5HGM A;  2FAD A;  2XZ1 C;  2CWO A;  2MD9 A;  3CC7 P;  3CC2 P;  5HV8 A;  4H2W C;  2M8L A;  1AUM A;  3LMO A;  3CPW O;  2VLN A;  1QVF O;  2GZG A;  4U0D A;  2DGY A;  3VRL C;  4COC A;  1CEI A;  2AF8 A;  3LRY A;  1M90 Q;  1DV5 A;  4U0A A;  3G28 A;  2KG9 A;  3DS5 A;  3GZL A;  1UJZ A;  2ONT A;  1RNI A;  1JJ2 O;  4QNB A;  1ZMB A;  3EJE A;  3NTE A;  2LOL A;  2PY8 A;  2LIW A;  1VQ5 P;  2JYL A;  1X3O A;  2L22 A;  2AFE A;  3CE7 A;  2DNW A;  2WPT A;  2Z45 A;  3DTJ A;  1QVG O;  2LL8 A;  1GXH A;  2GDY A;  4M0I A;  1M6N A;  4UHP B;  1K8A Q;  2MF4 A;  3EJD A;  4WYM A;  1EOQ A;  2EFJ A;  5BS1 A;  1E6J P;  2CG5 B;  4XFX A;  2JYG A;  2L9F A;  2PEO A;  2VSQ A;  2JU2 A;  4GR6 A;  2BUO A;  3E2D A;  3B5I A;  2CGQ A;  2XZ0 D;  4U0C A;  5HGO A;  2LTE A;  1K9M Q;  1Q82 Q;  5KP7 B;  2ERH A;  1E0H A;  2LPK A;  5HGL A;  4H2Y C;  2FQ2 A;  2P9X A;  4PWV B;  2KOP A;  1FR2 A;  4GR2 A;  3I56 P;  1NJI Q;  1KLP A;  1QRJ A;  1YI2 P;  4U0F A;  2JO0 A;  2M8N A;  4QKO A;  2OTJ P;  2FVA A;  1AYI A;  1Q86 Q;  1M1K Q;  2JQ4 A;  1W2B O;  1Q81 Q;  2FQ0 A;  2KGE A;  3H0D A;  1N8R Q;  3G1I A;  3NY7 B;  1HY8 A;  2MVV A;  4HKG A;  3CCE P;  4CA3 A;  2K5X A;  4MRT C;  2XXM A;  2FAC A;  2KOD A;  1YHQ P;  2VLO A;  2AFD A;  3H47 A;  2N6Y A;  5I4T G;  4F37 A;  1S72 P;  4COP A;  2OAR A;  3MGE A;  2KGC A;  1YIJ P;  3HZQ A;  2OTL P;  5JPA A;  2KGA A;  4BPG A;  2KOO A;  1A8O A;  3DS4 A;  1VQK P;  2PEK A;  2MR7 A;  2QNW A;  2KOQ A;  1L0H A;  1EIA A;  2Z44 A;  3CME P;  2KOR A;  3P05 A;  4H2X C;  3CCJ P;  5EJD A;  1VKU A;  3CCR P;  2E1M A;  1YIT P;  3DS2 A;  1VQ9 P;  1KD1 Q;  1BXI A;  2K2Q A;  4NEO A;  1UNK A;  1IMP A;  2GZF A;  3CCS P;  1GXG A;  2ROQ A;  3EJB A;  2EIA A;  3CCQ P;  2K92 A;  1VQ8 P;  2NO8 A;  2FHS C;  5DCK A;  3GZM A;  2K0X A;  1A43 A;  2QEX P;  2CNR A;  5EW5 E;  5HVC A;  2JGP A;  1HQB A;  1RO0 A;  3CD6 P;  5F2O A;  2XT1 A;  2XV6 A;  1OR5 A;  2KWL A;  1VQ7 P; 
#chains in the Genus database with same CATH homology
 4QNB A;  1Q7Y Q;  1ZMB A;  4PH1 A;  3NTE A;  2PY8 A;  3CCE P;  1VQ5 P;  1KQS O;  2JYL A;  2PEJ A;  3HYB A;  2PEM A;  4U0E A;  2QA4 P;  3G21 A;  3DTJ A;  2Z45 A;  2PEQ A;  2XXM A;  1QVG O;  2KOD A;  3G0V A;  1VQL P;  1YHQ P;  3DS3 A;  3H47 A;  2EG5 A;  4M0I A;  5I4T G;  3Q20 A;  3H4E A;  1VQO P;  1M6N A;  5F2N A;  3DS1 A;  1S72 P;  4COP A;  2M8P A;  1K30 A;  4PH0 A;  3OW2 O;  1K8A Q;  2OAR A;  3MGE A;  2BHV A;  1YIJ P;  3HZQ A;  2OTL P;  5JPA A;  3DPH A;  1IUQ A;  3DS0 A;  4WYM A;  4XRO A;  3CC4 P;  5BS2 A;  3G29 A;  4XFY A;  3CMA P;  1M6E X;  1A8O A;  5F2K A;  3CXC O;  3DS4 A;  2L6E A;  1VQK P;  1RO2 A;  2PEK A;  1EOQ A;  2EFJ A;  5BS1 A;  1E6J P;  4XFX A;  2JYG A;  3CCL P;  1YJW P;  2PEO A;  4GR6 A;  2Z46 A;  3G6E P;  1EIA A;  2PEN A;  2Z44 A;  2BUO A;  3E2D A;  3CME P;  3B5I A;  3M1M A;  3RG6 C;  1D1D A;  1VQP P;  3P05 A;  3G4S P;  1KC8 Q;  3CCJ P;  4U0C A;  3CCM P;  5HGO A;  3G26 A;  5HGN A;  1VQ6 P;  3CCR P;  1VQN P;  1K9M Q;  2E1M A;  1Q82 Q;  1YIT P;  3DS2 A;  1VQ9 P;  1KD1 Q;  2LF4 A;  5HGL A;  3CCV P;  3WBH A;  4XRQ A;  2P9X A;  4XFZ A;  3CCS P;  3CCU P;  1YJ9 P;  4IPY A;  1M74 A;  1YJN P;  5HGM A;  2CWO A;  3CC7 P;  3G71 P;  4GR2 A;  3CC2 P;  2EIA A;  2M8L A;  3I56 P;  3I55 P;  1NJI Q;  1AUM A;  3CCQ P;  3CPW O;  1QRJ A;  1VQ4 P;  1VQ8 P;  1YI2 P;  4U0F A;  1QVF O;  2JO0 A;  3G1G A;  2PEI A;  4U0D A;  2M8N A;  2OTJ P;  5DCK A;  2DGY A;  3VRL C;  4COC A;  1A43 A;  3LRY A;  1M90 Q;  1Q86 Q;  2QEX P;  1M1K Q;  4U0B A;  4U0A A;  1BAJ A;  1RO0 A;  3G28 A;  3DS5 A;  5F2O A;  1W2B O;  1Q81 Q;  2XT1 A;  3CD6 P;  1K73 Q;  2ONT A;  2XV6 A;  3H0D A;  1RNI A;  1VQ7 P;  1JJ2 O;  1VQM P;  1N8R Q;  3G1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...