3DPHA

Hiv-1 capsid c-terminal domain mutant (l211s)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
78
structure length
78
Chain Sequence
PTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATSEEMMTACQGVGGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 CAPSID PROTEIN
publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 29
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3dphA00
3DS2A 3NTEA 3P05A 4WYMA 5HGNA 3G21A 2XV6A 3G1GA 2M8LA 4IPYA 2JYLA 3G1IA 4XFYA 2L6EA 1E6JP 3LRYA 2KODA 2JYGA 2M8NA 3G28A 5HGOA 1EOQA 4U0BA 2XXMA 2JO0A 1QRJA 3DS1A 4COCA 4XRQA 3VRLC 3MGEA 1EIAA 3G0VA 4PH1A 4XFXA 4XROA 3DS5A 3H4EA 4M0IA 1A8OA 2EIAA 5I4TG 1D1DA 1BAJA 4U0EA 4U0FA 1AUMA 3DS3A 3H47A 4XFZA 5HGMA 5HGLA 2BUOA 5JPAA 3DTJA 1A43A 3DS0A 3DS4A 4U0AA 5DCKA 3G26A 3DPHA 4U0CA 4COPA 2XT1A 4U0DA 4PH0A 4QNBA 2ONTA 3G29A 2LF4A 2M8PA
chains in the Genus database with same CATH superfamily
3P05A 4WYMA 4F37A 3CD6P 3G4SP 2KODA 1BXIA 2CGQA 1VQ6P 3DS1A 4XRQA 2PEJA 1VKUA 4GR6A 2N6YA 4CA3A 2L22A 3CCRP 2KGCA 1VQ5P 1X3OA 1GXHA 1VQPP 2KGDA 5HV8A 3CCJP 3CCVP 2JYGA 1Q81Q 2K2QA 1L0HA 1OR5A 1KLPA 3CCSP 1RO0A 2Z46A 2MD9A 2WPTA 3CCMP 3GKLC 1BAJA 4U0FA 3G71P 1W2BO 3CCEP 1Q82Q 4MRTC 2FVAA 4PH0A 2ONTA 2PEQA 1F80D 3HZQA 1IUQA 2GDWA 2L6EA 2N5HA 2LPKA 2FQ1A 3WBHA 2FAEA 2PEMA 3RG2A 2KWLA 2K94A 1L0IA 4U0CA 1K30A 2QA4P 5KP8B 3NTEA 1VQMP 1JJ2O 3CCUP 1ACPA 2EHTA 1NJIQ 1QVGO 3Q20A 1EOQA 4U0BA 2LIUA 3CCLP 2LL8A 2KOOA 3B4QA 2MF4A 3LMOA 2AFDA 1K8AQ 1M6NA 2N98A 2JYLA 1VQKP 2XXMA 1M6EX 4XFXA 2GZIA 2JU2A 3M1MA 1GPJA 1A8OA 2VLNA 3EJDA 5HGMA 5KP7B 3DS4A 4U0AA 2GZFA 1RO2A 2DGYA 1QVFO 2Z44A 2KGEA 4IPYA 2EG5A 2DNWA 2MR8A 2ERHA 2JGPA 2AFEA 4R0MA 2N50A 1Z6MA 4NEOA 2K0YA 1AF8A 3DPHA 2KOQA 4U0DA 1IMQA 2PEOA 4PWVB 1S72P 2L4BA 2VLPA 2JO0A 2KW2A 2QNWA 3NY7B 3G0VA 3CC4P 1DV5A 5I4TG 1EMVA 3CPWO 1AYIA 7CEIA 2BUOA 4PXHB 1A43A 4COPA 2L9FA 3GJNA 4H2XC 1VQ8P 1NQ4A 3G1GA 1E6JP 3CC2P 2KOPA 2GZJA 2KORA 1QRJA 5BS2A 3I55P 2FACA 1MZ8A 1M90Q 5HGLA 5JPAA 2FQ0A 3CMAP 1KQSO 4GR2A 2CQ8A 1HY8A 2X2BA 1RNIA 2KOSA 1UNKA 2LKIA 3VRLC 3MGEA 3H0DA 2XZ1C 4M0IA 2XZ0D 3DS0A 2MR7A 2K5XA 3G29A 2AF8A 1VQLP 5HGNA 2FQ2A 5HVCA 3G1IA 1FR2A 4HKGA 3I56P 4H2WC 2KR5A 2MVUA 2K92A 2AVAA 1VQ4P 2GDYA 3EJEA 2FVEA 4QNBA 3CXCO 4PH1A 2M8PA 2KG6A 2VLOA 1N8RQ 1KD1Q 3U43A 2MY5A 5KP6B 2JQ4A 1CEIA 4BPGA 1T8KA 4XROA 2KGAA 1YI2P 1HQBA 3DS5A 2GZEA 1VQ9P 2FADA 1Q86Q 5BS1A 2PEKA 2CNRA 2P9XA 5F2NA 1K9MQ 3OW2O 2GYKA 3EJBA 2PENA 3G28A 2CWOA 2KG8A 2JB0A 5F2OA 1GXGA 2MVVA 2GDXA 1ZMBA 4UHPB 2OARA 2LOLA 5F2KA 2K93A 2L0QA 3CCQP 2OTLP 1VHNA 1D1DA 3DS2A 1ZNVA 2XV6A 2VSQA 2PEIA 1VQOP 2KG9A 1KC8Q 2K0DX 2VLQA 1M1KQ 1YHQP 5EW5E 2E1MA 3HYBA 2M5RA 4DG9A 4U0EA 3DS3A 3CMEP 1YJNP 1YJ9P 5DCKA 2LIWA 4IZ6A 2LF4A 2Z45A 3E2DA 1K73Q 2K0XA 3G21A 3B5IA 2M8LA 2N5IA 5HGOA 1Q7YQ 3GZLA 4COCA 5EJDA 2EHSA 1UJZA 2EIAA 1YJWP 1AUMA 2QEXP 2OTJP 3G26A 2LTEA 2JAZA 1DNYA 2PY8A 2JBGA 1YITP 1VQNP 1VQ7P 4XFYA 3LRYA 2FHSC 4BPHA 1IMPA 1EIAA 1E0HA 3G6EP 3GZMA 3H47A 2LMLA 2NO8A 2EFJA 2FVFA 3RG6C 2JU1A 3CC7P 1M74A 4QKOA 3CE7A 2BHVA 2M8NA 2PNGA 2CG5B 1YIJP 2GZGA 3H4EA 4H2YC 2N6ZA 4BPFA 2ROQA 4XFZA 3DTJA 2XT1A 5CZDB
chains in the Genus database with same CATH topology
3DS2A 3P05A 4WYMA 1RNIA 2XV6A 1M6NA 2JYLA 1VQKP 2PEIA 3CD6P 1VQOP 3G4SP 2KODA 1KC8Q 2XXMA 1M6EX 1YHQP 1M1KQ 1VQ6P 3DS1A 2E1MA 4XRQA 3VRLC 3MGEA 3HYBA 4XFXA 2PEJA 3M1MA 3H0DA 4M0IA 1A8OA 4U0EA 3DS3A 4GR6A 3CMEP 5HGMA 1YJNP 1YJ9P 3DS0A 3DS4A 4U0AA 5DCKA 3CCRP 1RO2A 1VQ5P 2DGYA 3G29A 2LF4A 1VQPP 1VQLP 3E2DA 2Z45A 1K73Q 1QVFO 5HGNA 2Z44A 3G21A 3B5IA 2M8LA 4IPYA 3G1IA 3CCJP 2EG5A 3CCVP 2OTLP 3I56P 2JYGA 1Q81Q 5HGOA 1Q7YQ 3CCSP 4COCA 1RO0A 2Z46A 1VQ4P 2EIAA 3CCMP 1BAJA 4U0FA 1YJWP 1AUMA 3G71P 1W2BO 2QEXP 3CCEP 2OTJP 3G26A 3DPHA 1Q82Q 4U0DA 4PH0A 4QNBA 2ONTA 3CXCO 4PH1A 2M8PA 2PEQA 2PEOA 2PY8A 1N8RQ 3HZQA 1YITP 1VQNP 1VQ7P 1KD1Q 1IUQA 4XFYA 2L6EA 3LRYA 1S72P 2JO0A 3WBHA 1EIAA 3G0VA 4XROA 1YI2P 3CC4P 3G6EP 3DS5A 2PEMA 5I4TG 1VQ9P 3CPWO 3H47A 1Q86Q 2BUOA 1A43A 5BS1A 4U0CA 2EFJA 3RG6C 2PEKA 4COPA 1K30A 2P9XA 2QA4P 5F2NA 1VQ8P 3NTEA 1VQMP 1K9MQ 1JJ2O 3CCUP 3CC7P 3OW2O 3G1GA 1M74A 1E6JP 2PENA 1NJIQ 2BHVA 1QVGO 3Q20A 2M8NA 3CC2P 3G28A 2CWOA 1EOQA 4U0BA 5F2OA 1QRJA 3CCLP 5BS2A 3I55P 1YIJP 1ZMBA 3H4EA 2OARA 1D1DA 4XFZA 1M90Q 5HGLA 5F2KA 5JPAA 3DTJA 3CMAP 1KQSO 4GR2A 2XT1A 1K8AQ 3CCQP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS2 A;  3NTE A;  3P05 A;  4WYM A;  5HGN A;  3G21 A;  2XV6 A;  3G1G A;  2M8L A;  4IPY A;  2JYL A;  3G1I A;  4XFY A;  2L6E A;  1E6J P;  3LRY A;  2KOD A;  2JYG A;  2M8N A;  3G28 A;  5HGO A;  1EOQ A;  4U0B A;  2XXM A;  2JO0 A;  1QRJ A;  3DS1 A;  4COC A;  4XRQ A;  3VRL C;  3MGE A;  1EIA A;  3G0V A;  4PH1 A;  4XFX A;  4XRO A;  3DS5 A;  3H4E A;  4M0I A;  1A8O A;  2EIA A;  5I4T G;  1D1D A;  1BAJ A;  4U0E A;  4U0F A;  1AUM A;  3DS3 A;  3H47 A;  4XFZ A;  5HGM A;  5HGL A;  2BUO A;  5JPA A;  3DTJ A;  1A43 A;  3DS0 A;  3DS4 A;  4U0A A;  5DCK A;  3G26 A;  3DPH A;  4U0C A;  4COP A;  2XT1 A;  4U0D A;  4PH0 A;  4QNB A;  2ONT A;  3G29 A;  2LF4 A;  2M8P A; 
#chains in the Genus database with same CATH topology
 3P05 A;  4WYM A;  4F37 A;  3CD6 P;  3G4S P;  2KOD A;  1BXI A;  2CGQ A;  1VQ6 P;  3DS1 A;  4XRQ A;  2PEJ A;  1VKU A;  4GR6 A;  2N6Y A;  4CA3 A;  2L22 A;  3CCR P;  2KGC A;  1VQ5 P;  1X3O A;  1GXH A;  1VQP P;  2KGD A;  5HV8 A;  3CCJ P;  3CCV P;  2JYG A;  1Q81 Q;  2K2Q A;  1L0H A;  1OR5 A;  1KLP A;  3CCS P;  1RO0 A;  2Z46 A;  2MD9 A;  2WPT A;  3CCM P;  3GKL C;  1BAJ A;  4U0F A;  3G71 P;  1W2B O;  3CCE P;  1Q82 Q;  4MRT C;  2FVA A;  4PH0 A;  2ONT A;  2PEQ A;  1F80 D;  3HZQ A;  1IUQ A;  2GDW A;  2L6E A;  2N5H A;  2LPK A;  2FQ1 A;  3WBH A;  2FAE A;  2PEM A;  3RG2 A;  2KWL A;  2K94 A;  1L0I A;  4U0C A;  1K30 A;  2QA4 P;  5KP8 B;  3NTE A;  1VQM P;  1JJ2 O;  3CCU P;  1ACP A;  2EHT A;  1NJI Q;  1QVG O;  3Q20 A;  1EOQ A;  4U0B A;  2LIU A;  3CCL P;  2LL8 A;  2KOO A;  3B4Q A;  2MF4 A;  3LMO A;  2AFD A;  1K8A Q;  1M6N A;  2N98 A;  2JYL A;  1VQK P;  2XXM A;  1M6E X;  4XFX A;  2GZI A;  2JU2 A;  3M1M A;  1GPJ A;  1A8O A;  2VLN A;  3EJD A;  5HGM A;  5KP7 B;  3DS4 A;  4U0A A;  2GZF A;  1RO2 A;  2DGY A;  1QVF O;  2Z44 A;  2KGE A;  4IPY A;  2EG5 A;  2DNW A;  2MR8 A;  2ERH A;  2JGP A;  2AFE A;  4R0M A;  2N50 A;  1Z6M A;  4NEO A;  2K0Y A;  1AF8 A;  3DPH A;  2KOQ A;  4U0D A;  1IMQ A;  2PEO A;  4PWV B;  1S72 P;  2L4B A;  2VLP A;  2JO0 A;  2KW2 A;  2QNW A;  3NY7 B;  3G0V A;  3CC4 P;  1DV5 A;  5I4T G;  1EMV A;  3CPW O;  1AYI A;  7CEI A;  2BUO A;  4PXH B;  1A43 A;  4COP A;  2L9F A;  3GJN A;  4H2X C;  1VQ8 P;  1NQ4 A;  3G1G A;  1E6J P;  3CC2 P;  2KOP A;  2GZJ A;  2KOR A;  1QRJ A;  5BS2 A;  3I55 P;  2FAC A;  1MZ8 A;  1M90 Q;  5HGL A;  5JPA A;  2FQ0 A;  3CMA P;  1KQS O;  4GR2 A;  2CQ8 A;  1HY8 A;  2X2B A;  1RNI A;  2KOS A;  1UNK A;  2LKI A;  3VRL C;  3MGE A;  3H0D A;  2XZ1 C;  4M0I A;  2XZ0 D;  3DS0 A;  2MR7 A;  2K5X A;  3G29 A;  2AF8 A;  1VQL P;  5HGN A;  2FQ2 A;  5HVC A;  3G1I A;  1FR2 A;  4HKG A;  3I56 P;  4H2W C;  2KR5 A;  2MVU A;  2K92 A;  2AVA A;  1VQ4 P;  2GDY A;  3EJE A;  2FVE A;  4QNB A;  3CXC O;  4PH1 A;  2M8P A;  2KG6 A;  2VLO A;  1N8R Q;  1KD1 Q;  3U43 A;  2MY5 A;  5KP6 B;  2JQ4 A;  1CEI A;  4BPG A;  1T8K A;  4XRO A;  2KGA A;  1YI2 P;  1HQB A;  3DS5 A;  2GZE A;  1VQ9 P;  2FAD A;  1Q86 Q;  5BS1 A;  2PEK A;  2CNR A;  2P9X A;  5F2N A;  1K9M Q;  3OW2 O;  2GYK A;  3EJB A;  2PEN A;  3G28 A;  2CWO A;  2KG8 A;  2JB0 A;  5F2O A;  1GXG A;  2MVV A;  2GDX A;  1ZMB A;  4UHP B;  2OAR A;  2LOL A;  5F2K A;  2K93 A;  2L0Q A;  3CCQ P;  2OTL P;  1VHN A;  1D1D A;  3DS2 A;  1ZNV A;  2XV6 A;  2VSQ A;  2PEI A;  1VQO P;  2KG9 A;  1KC8 Q;  2K0D X;  2VLQ A;  1M1K Q;  1YHQ P;  5EW5 E;  2E1M A;  3HYB A;  2M5R A;  4DG9 A;  4U0E A;  3DS3 A;  3CME P;  1YJN P;  1YJ9 P;  5DCK A;  2LIW A;  4IZ6 A;  2LF4 A;  2Z45 A;  3E2D A;  1K73 Q;  2K0X A;  3G21 A;  3B5I A;  2M8L A;  2N5I A;  5HGO A;  1Q7Y Q;  3GZL A;  4COC A;  5EJD A;  2EHS A;  1UJZ A;  2EIA A;  1YJW P;  1AUM A;  2QEX P;  2OTJ P;  3G26 A;  2LTE A;  2JAZ A;  1DNY A;  2PY8 A;  2JBG A;  1YIT P;  1VQN P;  1VQ7 P;  4XFY A;  3LRY A;  2FHS C;  4BPH A;  1IMP A;  1EIA A;  1E0H A;  3G6E P;  3GZM A;  3H47 A;  2LML A;  2NO8 A;  2EFJ A;  2FVF A;  3RG6 C;  2JU1 A;  3CC7 P;  1M74 A;  4QKO A;  3CE7 A;  2BHV A;  2M8N A;  2PNG A;  2CG5 B;  1YIJ P;  2GZG A;  3H4E A;  4H2Y C;  2N6Z A;  4BPF A;  2ROQ A;  4XFZ A;  3DTJ A;  2XT1 A;  5CZD B; 
#chains in the Genus database with same CATH homology
 3DS2 A;  3P05 A;  4WYM A;  1RNI A;  2XV6 A;  1M6N A;  2JYL A;  1VQK P;  2PEI A;  3CD6 P;  1VQO P;  3G4S P;  2KOD A;  1KC8 Q;  2XXM A;  1M6E X;  1YHQ P;  1M1K Q;  1VQ6 P;  3DS1 A;  2E1M A;  4XRQ A;  3VRL C;  3MGE A;  3HYB A;  4XFX A;  2PEJ A;  3M1M A;  3H0D A;  4M0I A;  1A8O A;  4U0E A;  3DS3 A;  4GR6 A;  3CME P;  5HGM A;  1YJN P;  1YJ9 P;  3DS0 A;  3DS4 A;  4U0A A;  5DCK A;  3CCR P;  1RO2 A;  1VQ5 P;  2DGY A;  3G29 A;  2LF4 A;  1VQP P;  1VQL P;  3E2D A;  2Z45 A;  1K73 Q;  1QVF O;  5HGN A;  2Z44 A;  3G21 A;  3B5I A;  2M8L A;  4IPY A;  3G1I A;  3CCJ P;  2EG5 A;  3CCV P;  2OTL P;  3I56 P;  2JYG A;  1Q81 Q;  5HGO A;  1Q7Y Q;  3CCS P;  4COC A;  1RO0 A;  2Z46 A;  1VQ4 P;  2EIA A;  3CCM P;  1BAJ A;  4U0F A;  1YJW P;  1AUM A;  3G71 P;  1W2B O;  2QEX P;  3CCE P;  2OTJ P;  3G26 A;  3DPH A;  1Q82 Q;  4U0D A;  4PH0 A;  4QNB A;  2ONT A;  3CXC O;  4PH1 A;  2M8P A;  2PEQ A;  2PEO A;  2PY8 A;  1N8R Q;  3HZQ A;  1YIT P;  1VQN P;  1VQ7 P;  1KD1 Q;  1IUQ A;  4XFY A;  2L6E A;  3LRY A;  1S72 P;  2JO0 A;  3WBH A;  1EIA A;  3G0V A;  4XRO A;  1YI2 P;  3CC4 P;  3G6E P;  3DS5 A;  2PEM A;  5I4T G;  1VQ9 P;  3CPW O;  3H47 A;  1Q86 Q;  2BUO A;  1A43 A;  5BS1 A;  4U0C A;  2EFJ A;  3RG6 C;  2PEK A;  4COP A;  1K30 A;  2P9X A;  2QA4 P;  5F2N A;  1VQ8 P;  3NTE A;  1VQM P;  1K9M Q;  1JJ2 O;  3CCU P;  3CC7 P;  3OW2 O;  3G1G A;  1M74 A;  1E6J P;  2PEN A;  1NJI Q;  2BHV A;  1QVG O;  3Q20 A;  2M8N A;  3CC2 P;  3G28 A;  2CWO A;  1EOQ A;  4U0B A;  5F2O A;  1QRJ A;  3CCL P;  5BS2 A;  3I55 P;  1YIJ P;  1ZMB A;  3H4E A;  2OAR A;  1D1D A;  4XFZ A;  1M90 Q;  5HGL A;  5F2K A;  5JPA A;  3DTJ A;  3CMA P;  1KQS O;  4GR2 A;  2XT1 A;  1K8A Q;  3CCQ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...