3DPHA

Hiv-1 capsid c-terminal domain mutant (l211s)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
78
structure length
78
Chain Sequence
PTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATSEEMMTACQGVGGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 CAPSID PROTEIN
publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 29
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3dphA00
2EIAA 2JYLA 2XXMA 3G28A 4XRQA 5HGOA 2L6EA 3G1IA 3LRYA 4XROA 2ONTA 3DS0A 5HGMA 2M8LA 4IPYA 4U0FA 2XT1A 3NTEA 3DTJA 3DS3A 4QNBA 3DPHA 3H4EA 3G29A 5I4TG 5JPAA 4U0DA 4U0EA 3VRLC 1D1DA 3G21A 1E6JP 1BAJA 1A8OA 2KODA 1AUMA 4U0BA 2LF4A 2M8NA 3P05A 2XV6A 4PH1A 4COCA 3G1GA 3H47A 5DCKA 4WYMA 1QRJA 3G0VA 4U0CA 4XFXA 5HGNA 3MGEA 2JYGA 4M0IA 4XFYA 1EIAA 5HGLA 3DS2A 4PH0A 2BUOA 2JO0A 1A43A 4XFZA 4U0AA 2M8PA 3DS5A 3DS1A 1EOQA 3DS4A 3G26A 4COPA
chains in the Genus database with same CATH superfamily
2JYLA 4BPHA 2K92A 2JBGA 1KQSO 3NTEA 2M5RA 4R0MA 2ROQA 2QNWA 1YITP 2AFEA 4BPFA 1VQ7P 1QRJA 2GZGA 2JYGA 2MY5A 2WPTA 5HGLA 1VQPP 2CGQA 2JO0A 1M6NA 4XRQA 3G28A 2N5HA 2E1MA 4QNBA 1VQNP 4DG9A 3NY7B 3CMEP 2Z44A 1M1KQ 3OW2O 2MVUA 4PH1A 2KG8A 5F2KA 2KG6A 2LPKA 2K94A 4XFYA 2DGYA 2JU2A 2L0QA 1DV5A 2OTLP 2XZ0D 2FQ2A 2Z46A 4XROA 1N8RQ 4PWVB 2EG5A 1K30A 2FAEA 4U0BA 2CG5B 1E0HA 2FACA 2GYKA 2KGEA 3I56P 3CC2P 1A43A 2EFJA 2KORA 3CC7P 2CQ8A 2BHVA 2VSQA 5HGOA 2L6EA 4UHPB 1RNIA 3U43A 2PEQA 4IPYA 2XT1A 3LMOA 2KGCA 3CCLP 2KR5A 5DCKA 3WBHA 2L4BA 2Z45A 1Q82Q 1VQ6P 1M74A 2EHTA 2GDWA 3B5IA 2ONTA 2KOPA 5JPAA 1ZNVA 1D1DA 2X2BA 4H2WC 1VQ9P 1GXGA 2KW2A 2GZJA 1DNYA 1FR2A 3G1GA 2K93A 1RO0A 1HY8A 2K2QA 3M1MA 2LL8A 4XFZA 1K73Q 2DNWA 2XXMA 2AVAA 7CEIA 5F2OA 2JB0A 3H4EA 2LOLA 5CZDB 1EMVA 3CCQP 1VQKP 3G0VA 2MD9A 2FVFA 3GKLC 3G21A 2PNGA 3DPHA 2EHSA 2GZFA 1KC8Q 4COCA 3CCEP 3GZMA 1YJNP 1QVFO 1BXIA 5BS2A 1VQ8P 2GDYA 2K0DX 5HVCA 1AYIA 2VLPA 4COPA 3GZLA 1X3OA 2M8LA 3DTJA 2FQ0A 3VRLC 3CC4P 1L0IA 2OTJP 1NQ4A 2LIWA 4PXHB 1T8KA 3G4SP 2M8NA 2PEMA 3G71P 1S72P 4M0IA 2QEXP 2PY8A 3EJDA 2EIAA 3CPWO 5BS1A 2VLOA 2FHSC 2OARA 3DS3A 2LKIA 5I4TG 2LMLA 3CCVP 3CCJP 2N50A 2JU1A 4F37A 3GJNA 4PH0A 2JAZA 2ERHA 2CWOA 2KWLA 2AF8A 1UJZA 3LRYA 4H2XC 5F2NA 3CCSP 2L9FA 2LIUA 1VQ4P 1VQLP 4CA3A 2L22A 1MZ8A 2NO8A 2VLNA 2GDXA 2QA4P 2KOOA 1QVGO 2GZIA 2XV6A 1JJ2O 1VQOP 4QKOA 4NEOA 3MGEA 2LTEA 4IZ6A 3I55P 2M8PA 3P05A 2MF4A 1YIJP 2P9XA 2N6ZA 1GPJA 4U0EA 3EJBA 3Q20A 1VHNA 1ACPA 2K0XA 2KGAA 2LF4A 1Q86Q 1ZMBA 2FQ1A 3HYBA 1CEIA 5HGNA 1EIAA 3DS2A 4U0AA 3DS1A 3G26A 1YI2P 2PENA 1IMQA 2N98A 1VKUA 1IMPA 2PEKA 3DS0A 1W2BO 2FVAA 4GR6A 2AFDA 1KD1Q 3G6EP 2KOSA 2JGPA 3CD6P 2VLQA 1HQBA 1VQMP 2K5XA 1AF8A 3CCUP 2KGDA 1YJ9P 2MR7A 5KP6B 3G1IA 1YHQP 3G29A 1L0HA 2JQ4A 1E6JP 2FADA 5HV8A 1BAJA 1RO2A 2KODA 1KLPA 1VQ5P 2MVVA 1NJIQ 3H47A 3CMAP 1Q81Q 3RG2A 1K8AQ 2PEJA 3DS4A 3CCMP 3E2DA 1YJWP 3CE7A 4MRTC 2K0YA 2XZ1C 1F80D 2KG9A 2FVEA 2KOQA 2PEOA 2CNRA 3H0DA 4WYMA 4U0CA 3DS5A 4BPGA 1EOQA 2MR8A 3EJEA 5EJDA 5EW5E 3RG6C 4U0FA 4HKGA 2PEIA 1M6EX 1A8OA 4H2YC 5KP8B 4XFXA 1IUQA 2N6YA 1K9MQ 3CCRP 3HZQA 5HGMA 1UNKA 4GR2A 4U0DA 5KP7B 1AUMA 3B4QA 2N5IA 1GXHA 1Z6MA 3CXCO 1M90Q 2BUOA 2GZEA 1OR5A 1Q7YQ
chains in the Genus database with same CATH topology
2EIAA 2JYLA 3CPWO 3B5IA 3G1IA 1YHQP 2ONTA 5BS1A 1KQSO 2OARA 3NTEA 3DS3A 3G29A 5I4TG 5JPAA 1D1DA 1E6JP 1VQ9P 3CCVP 1YITP 1BAJA 1RO2A 2KODA 1VQ7P 1VQ5P 3G1GA 3H47A 1NJIQ 3CMAP 1RO0A 1QRJA 3CCJP 1Q81Q 2JYGA 5HGLA 1VQPP 4PH0A 1K8AQ 3M1MA 2JO0A 4XFZA 2CWOA 2PEJA 1K73Q 1M6NA 3DS4A 3CCMP 3E2DA 4XRQA 2XXMA 3G28A 1YJWP 3LRYA 5F2NA 5F2OA 3CCSP 1VQ4P 2E1MA 1VQLP 4QNBA 1VQNP 3H4EA 2PEOA 3CCQP 2QA4P 3H0DA 3CMEP 1QVGO 2Z44A 1VQKP 1M1KQ 3OW2O 4PH1A 2XV6A 5F2KA 1JJ2O 1VQOP 4WYMA 3G0VA 4U0CA 3MGEA 4XFYA 2DGYA 3I55P 2M8PA 3DS5A 3G21A 3P05A 1EOQA 1YIJP 2OTLP 2Z46A 4XROA 1N8RQ 3RG6C 4U0FA 2P9XA 3DPHA 2EG5A 4U0EA 3Q20A 2PEIA 1M6EX 1K30A 1KC8Q 1A8OA 4U0BA 4COCA 2LF4A 1Q86Q 3CCEP 1ZMBA 3I56P 1YJNP 3HYBA 4XFXA 5HGNA 1QVFO 1EIAA 5BS2A 1IUQA 3DS2A 3CC2P 1VQ8P 1A43A 2EFJA 4U0AA 3DS1A 1K9MQ 3G26A 1YI2P 2PENA 3HZQA 4COPA 3CCRP 3CC7P 2BHVA 5HGOA 2L6EA 1RNIA 2PEKA 3DS0A 5HGMA 2PEQA 2M8LA 4IPYA 1W2BO 2XT1A 4GR6A 3DTJA 4GR2A 4U0DA 3VRLC 1KD1Q 3CC4P 3G6EP 2OTJP 3CD6P 3G4SP 1AUMA 2M8NA 3CCLP 5DCKA 2PEMA 3G71P 1VQMP 1S72P 4M0IA 3WBHA 2QEXP 3CCUP 3CXCO 1M90Q 1YJ9P 2BUOA 2Z45A 1Q82Q 2PY8A 1VQ6P 1M74A 1Q7YQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIA A;  2JYL A;  2XXM A;  3G28 A;  4XRQ A;  5HGO A;  2L6E A;  3G1I A;  3LRY A;  4XRO A;  2ONT A;  3DS0 A;  5HGM A;  2M8L A;  4IPY A;  4U0F A;  2XT1 A;  3NTE A;  3DTJ A;  3DS3 A;  4QNB A;  3DPH A;  3H4E A;  3G29 A;  5I4T G;  5JPA A;  4U0D A;  4U0E A;  3VRL C;  1D1D A;  3G21 A;  1E6J P;  1BAJ A;  1A8O A;  2KOD A;  1AUM A;  4U0B A;  2LF4 A;  2M8N A;  3P05 A;  2XV6 A;  4PH1 A;  4COC A;  3G1G A;  3H47 A;  5DCK A;  4WYM A;  1QRJ A;  3G0V A;  4U0C A;  4XFX A;  5HGN A;  3MGE A;  2JYG A;  4M0I A;  4XFY A;  1EIA A;  5HGL A;  3DS2 A;  4PH0 A;  2BUO A;  2JO0 A;  1A43 A;  4XFZ A;  4U0A A;  2M8P A;  3DS5 A;  3DS1 A;  1EOQ A;  3DS4 A;  3G26 A;  4COP A; 
#chains in the Genus database with same CATH topology
 2JYL A;  4BPH A;  2K92 A;  2JBG A;  1KQS O;  3NTE A;  2M5R A;  4R0M A;  2ROQ A;  2QNW A;  1YIT P;  2AFE A;  4BPF A;  1VQ7 P;  1QRJ A;  2GZG A;  2JYG A;  2MY5 A;  2WPT A;  5HGL A;  1VQP P;  2CGQ A;  2JO0 A;  1M6N A;  4XRQ A;  3G28 A;  2N5H A;  2E1M A;  4QNB A;  1VQN P;  4DG9 A;  3NY7 B;  3CME P;  2Z44 A;  1M1K Q;  3OW2 O;  2MVU A;  4PH1 A;  2KG8 A;  5F2K A;  2KG6 A;  2LPK A;  2K94 A;  4XFY A;  2DGY A;  2JU2 A;  2L0Q A;  1DV5 A;  2OTL P;  2XZ0 D;  2FQ2 A;  2Z46 A;  4XRO A;  1N8R Q;  4PWV B;  2EG5 A;  1K30 A;  2FAE A;  4U0B A;  2CG5 B;  1E0H A;  2FAC A;  2GYK A;  2KGE A;  3I56 P;  3CC2 P;  1A43 A;  2EFJ A;  2KOR A;  3CC7 P;  2CQ8 A;  2BHV A;  2VSQ A;  5HGO A;  2L6E A;  4UHP B;  1RNI A;  3U43 A;  2PEQ A;  4IPY A;  2XT1 A;  3LMO A;  2KGC A;  3CCL P;  2KR5 A;  5DCK A;  3WBH A;  2L4B A;  2Z45 A;  1Q82 Q;  1VQ6 P;  1M74 A;  2EHT A;  2GDW A;  3B5I A;  2ONT A;  2KOP A;  5JPA A;  1ZNV A;  1D1D A;  2X2B A;  4H2W C;  1VQ9 P;  1GXG A;  2KW2 A;  2GZJ A;  1DNY A;  1FR2 A;  3G1G A;  2K93 A;  1RO0 A;  1HY8 A;  2K2Q A;  3M1M A;  2LL8 A;  4XFZ A;  1K73 Q;  2DNW A;  2XXM A;  2AVA A;  7CEI A;  5F2O A;  2JB0 A;  3H4E A;  2LOL A;  5CZD B;  1EMV A;  3CCQ P;  1VQK P;  3G0V A;  2MD9 A;  2FVF A;  3GKL C;  3G21 A;  2PNG A;  3DPH A;  2EHS A;  2GZF A;  1KC8 Q;  4COC A;  3CCE P;  3GZM A;  1YJN P;  1QVF O;  1BXI A;  5BS2 A;  1VQ8 P;  2GDY A;  2K0D X;  5HVC A;  1AYI A;  2VLP A;  4COP A;  3GZL A;  1X3O A;  2M8L A;  3DTJ A;  2FQ0 A;  3VRL C;  3CC4 P;  1L0I A;  2OTJ P;  1NQ4 A;  2LIW A;  4PXH B;  1T8K A;  3G4S P;  2M8N A;  2PEM A;  3G71 P;  1S72 P;  4M0I A;  2QEX P;  2PY8 A;  3EJD A;  2EIA A;  3CPW O;  5BS1 A;  2VLO A;  2FHS C;  2OAR A;  3DS3 A;  2LKI A;  5I4T G;  2LML A;  3CCV P;  3CCJ P;  2N50 A;  2JU1 A;  4F37 A;  3GJN A;  4PH0 A;  2JAZ A;  2ERH A;  2CWO A;  2KWL A;  2AF8 A;  1UJZ A;  3LRY A;  4H2X C;  5F2N A;  3CCS P;  2L9F A;  2LIU A;  1VQ4 P;  1VQL P;  4CA3 A;  2L22 A;  1MZ8 A;  2NO8 A;  2VLN A;  2GDX A;  2QA4 P;  2KOO A;  1QVG O;  2GZI A;  2XV6 A;  1JJ2 O;  1VQO P;  4QKO A;  4NEO A;  3MGE A;  2LTE A;  4IZ6 A;  3I55 P;  2M8P A;  3P05 A;  2MF4 A;  1YIJ P;  2P9X A;  2N6Z A;  1GPJ A;  4U0E A;  3EJB A;  3Q20 A;  1VHN A;  1ACP A;  2K0X A;  2KGA A;  2LF4 A;  1Q86 Q;  1ZMB A;  2FQ1 A;  3HYB A;  1CEI A;  5HGN A;  1EIA A;  3DS2 A;  4U0A A;  3DS1 A;  3G26 A;  1YI2 P;  2PEN A;  1IMQ A;  2N98 A;  1VKU A;  1IMP A;  2PEK A;  3DS0 A;  1W2B O;  2FVA A;  4GR6 A;  2AFD A;  1KD1 Q;  3G6E P;  2KOS A;  2JGP A;  3CD6 P;  2VLQ A;  1HQB A;  1VQM P;  2K5X A;  1AF8 A;  3CCU P;  2KGD A;  1YJ9 P;  2MR7 A;  5KP6 B;  3G1I A;  1YHQ P;  3G29 A;  1L0H A;  2JQ4 A;  1E6J P;  2FAD A;  5HV8 A;  1BAJ A;  1RO2 A;  2KOD A;  1KLP A;  1VQ5 P;  2MVV A;  1NJI Q;  3H47 A;  3CMA P;  1Q81 Q;  3RG2 A;  1K8A Q;  2PEJ A;  3DS4 A;  3CCM P;  3E2D A;  1YJW P;  3CE7 A;  4MRT C;  2K0Y A;  2XZ1 C;  1F80 D;  2KG9 A;  2FVE A;  2KOQ A;  2PEO A;  2CNR A;  3H0D A;  4WYM A;  4U0C A;  3DS5 A;  4BPG A;  1EOQ A;  2MR8 A;  3EJE A;  5EJD A;  5EW5 E;  3RG6 C;  4U0F A;  4HKG A;  2PEI A;  1M6E X;  1A8O A;  4H2Y C;  5KP8 B;  4XFX A;  1IUQ A;  2N6Y A;  1K9M Q;  3CCR P;  3HZQ A;  5HGM A;  1UNK A;  4GR2 A;  4U0D A;  5KP7 B;  1AUM A;  3B4Q A;  2N5I A;  1GXH A;  1Z6M A;  3CXC O;  1M90 Q;  2BUO A;  2GZE A;  1OR5 A;  1Q7Y Q; 
#chains in the Genus database with same CATH homology
 2EIA A;  2JYL A;  3CPW O;  3B5I A;  3G1I A;  1YHQ P;  2ONT A;  5BS1 A;  1KQS O;  2OAR A;  3NTE A;  3DS3 A;  3G29 A;  5I4T G;  5JPA A;  1D1D A;  1E6J P;  1VQ9 P;  3CCV P;  1YIT P;  1BAJ A;  1RO2 A;  2KOD A;  1VQ7 P;  1VQ5 P;  3G1G A;  3H47 A;  1NJI Q;  3CMA P;  1RO0 A;  1QRJ A;  3CCJ P;  1Q81 Q;  2JYG A;  5HGL A;  1VQP P;  4PH0 A;  1K8A Q;  3M1M A;  2JO0 A;  4XFZ A;  2CWO A;  2PEJ A;  1K73 Q;  1M6N A;  3DS4 A;  3CCM P;  3E2D A;  4XRQ A;  2XXM A;  3G28 A;  1YJW P;  3LRY A;  5F2N A;  5F2O A;  3CCS P;  1VQ4 P;  2E1M A;  1VQL P;  4QNB A;  1VQN P;  3H4E A;  2PEO A;  3CCQ P;  2QA4 P;  3H0D A;  3CME P;  1QVG O;  2Z44 A;  1VQK P;  1M1K Q;  3OW2 O;  4PH1 A;  2XV6 A;  5F2K A;  1JJ2 O;  1VQO P;  4WYM A;  3G0V A;  4U0C A;  3MGE A;  4XFY A;  2DGY A;  3I55 P;  2M8P A;  3DS5 A;  3G21 A;  3P05 A;  1EOQ A;  1YIJ P;  2OTL P;  2Z46 A;  4XRO A;  1N8R Q;  3RG6 C;  4U0F A;  2P9X A;  3DPH A;  2EG5 A;  4U0E A;  3Q20 A;  2PEI A;  1M6E X;  1K30 A;  1KC8 Q;  1A8O A;  4U0B A;  4COC A;  2LF4 A;  1Q86 Q;  3CCE P;  1ZMB A;  3I56 P;  1YJN P;  3HYB A;  4XFX A;  5HGN A;  1QVF O;  1EIA A;  5BS2 A;  1IUQ A;  3DS2 A;  3CC2 P;  1VQ8 P;  1A43 A;  2EFJ A;  4U0A A;  3DS1 A;  1K9M Q;  3G26 A;  1YI2 P;  2PEN A;  3HZQ A;  4COP A;  3CCR P;  3CC7 P;  2BHV A;  5HGO A;  2L6E A;  1RNI A;  2PEK A;  3DS0 A;  5HGM A;  2PEQ A;  2M8L A;  4IPY A;  1W2B O;  2XT1 A;  4GR6 A;  3DTJ A;  4GR2 A;  4U0D A;  3VRL C;  1KD1 Q;  3CC4 P;  3G6E P;  2OTJ P;  3CD6 P;  3G4S P;  1AUM A;  2M8N A;  3CCL P;  5DCK A;  2PEM A;  3G71 P;  1VQM P;  1S72 P;  4M0I A;  3WBH A;  2QEX P;  3CCU P;  3CXC O;  1M90 Q;  1YJ9 P;  2BUO A;  2Z45 A;  1Q82 Q;  2PY8 A;  1VQ6 P;  1M74 A;  1Q7Y Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...