3DPHA

Hiv-1 capsid c-terminal domain mutant (l211s)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
78
structure length
78
Chain Sequence
PTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATSEEMMTACQGVGGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords HIV-1 CAPSID PROTEIN
total genus 29
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3dphA00
4XFYA 2JO0A 3G29A 5I4TG 3MGEA 5JPAA 5DCKA 4WYMA 2M8LA 4XRQA 3G1IA 1A8OA 4XFXA 4U0FA 3G0VA 4COCA 4QNBA 4U0AA 2ONTA 3LRYA 4COPA 1QRJA 4U0CA 4IPYA 3DS0A 2L6EA 3G26A 4PH0A 2KODA 4PH1A 5HGOA 2XXMA 3G21A 4XROA 1A43A 3DS1A 2JYLA 1EIAA 4M0IA 2XV6A 1EOQA 2BUOA 2EIAA 3H47A 4U0EA 3DS2A 2JYGA 3DPHA 3P05A 4U0DA 4XFZA 5HGMA 2LF4A 1AUMA 2M8PA 3NTEA 3DS4A 3VRLC 3DS5A 3DTJA 3H4EA 1E6JP 4U0BA 2M8NA 5HGNA 1BAJA 3G1GA 1D1DA 3G28A 5HGLA 2XT1A 3DS3A
chains in the Genus database with same CATH superfamily
2BHVA 2CG5B 2Z44A 2GDXA 2M5RA 3M1MA 4XROA 2Z45A 2DGYA 2K5XA 2FAEA 3CMAP 1FR2A 3I56P 1K30A 3P05A 2KW2A 1KQSO 2MF4A 3NY7B 3EJBA 1VQKP 3EJEA 2PEOA 2VSQA 1N8RQ 3G0VA 3OW2O 3CCLP 4IZ6A 2LIWA 2K94A 2GZFA 2FQ0A 2BUOA 3CE7A 5CZDB 3CCUP 2LMLA 3CCSP 2MD9A 1IMQA 2M8PA 4H2YC 3GZLA 1VQNP 3MGEA 2KGDA 2JB0A 3G1IA 1M6EX 3CCJP 5BS2A 1VQ5P 4M0IA 3GZMA 1VQLP 1M1KQ 5F2NA 4U0DA 5HGMA 4QKOA 1AUMA 3VRLC 4PWVB 2VLOA 1D1DA 2JU1A 2Z46A 1EMVA 2JO0A 1VQOP 1VQMP 2PY8A 4WYMA 2M8LA 2PEMA 2JBGA 4U0CA 1VHNA 3CD6P 7CEIA 3EJDA 1UNKA 2EHSA 1IMPA 5HGNA 3CCRP 1BAJA 3U43A 3DS3A 3LMOA 5I4TG 2K92A 2N50A 1A8OA 4COCA 4R0MA 2FADA 1GXGA 3GJNA 5EW5E 3G26A 2KORA 2MY5A 1A43A 2MVVA 1M6NA 2PNGA 2L22A 4BPGA 2K93A 3NTEA 3DS4A 1VQPP 2XT1A 1VKUA 3CCQP 3CXCO 4XRQA 5KP7B 2JU2A 1VQ7P 1VQ8P 2K2QA 3H0DA 1VQ6P 3CCVP 1GXHA 2M8NA 4CA3A 2L0QA 5HGLA 1M74A 2PEIA 2FVEA 3GKLC 2MR7A 2FVAA 2N6YA 2QNWA 2WPTA 3CC4P 2XZ1C 1QVGO 1GPJA 2LKIA 4BPHA 1KLPA 1M90Q 1ZNVA 2FQ2A 3HYBA 4COPA 1K8AQ 2L6EA 1YJWP 1EIAA 3I55P 1DNYA 4U0EA 1OR5A 3G4SP 1ZMBA 2JAZA 2DNWA 5KP6B 3DS5A 1BXIA 2FHSC 4HKGA 4F37A 4U0AA 2JQ4A 4H2WC 2FACA 3RG6C 5F2KA 5HVCA 3CC7P 1EOQA 3DS2A 1JJ2O 3CCEP 2CGQA 2GYKA 3DPHA 2LOLA 2ROQA 1Q7YQ 3G71P 2GZGA 1L0HA 3G29A 1HY8A 4XFXA 3Q20A 2KWLA 2LIUA 4IPYA 2P9XA 4PH1A 1NJIQ 2QA4P 1Q86Q 2XV6A 2KGAA 2VLPA 1K9MQ 5HV8A 3HZQA 3G6EP 2LL8A 3E2DA 2FQ1A 4U0BA 4BPFA 2VLNA 3CPWO 2X2BA 3CC2P 1RO2A 4U0FA 3CMEP 3CCMP 4PH0A 2XZ0D 2GZIA 1YJ9P 1YHQP 2KOOA 1Z6MA 2LF4A 2GDWA 2ERHA 2CWOA 3H47A 4H2XC 4XFYA 5JPAA 2GZEA 1AF8A 2N6ZA 2EG5A 2CNRA 2K0DX 2PEJA 1K73Q 1F80D 2KODA 4PXHB 2KOSA 5EJDA 2JYLA 1VQ4P 1RNIA 3B4QA 2EIAA 1S72P 3B5IA 2AFEA 2L4BA 2L9FA 2KG8A 1CEIA 5KP8B 2PENA 5DCKA 3RG2A 2MR8A 3LRYA 1Q81Q 3DS0A 2JGPA 1UJZA 2XXMA 2LPKA 2KOQA 1YIJP 2OTLP 3H4EA 2KGEA 2FVFA 4NEOA 5F2OA 2OTJP 2N5HA 2KOPA 1ACPA 1YJNP 2QEXP 4DG9A 3WBHA 5HGOA 2E1MA 1AYIA 4XFZA 2AF8A 1NQ4A 2K0XA 3DTJA 1IUQA 3G1GA 1X3OA 4GR2A 2PEQA 1QVFO 2LTEA 1L0IA 1YITP 2ONTA 1QRJA 2EHTA 2MVUA 2VLQA 2N5IA 5BS1A 1HQBA 3G21A 3DS1A 1YI2P 4GR6A 2AFDA 2GZJA 4MRTC 1E0HA 2KG9A 2KR5A 1DV5A 1E6JP 1KC8Q 1Q82Q 2PEKA 2EFJA 2KGCA 2AVAA 1W2BO 4QNBA 2CQ8A 4UHPB 1MZ8A 2GDYA 2N98A 2OARA 1T8KA 1VQ9P 2K0YA 2JYGA 1KD1Q 1RO0A 2KG6A 3G28A 2NO8A
chains in the Genus database with same CATH topology
2BHVA 5I4TG 2PENA 5DCKA 2Z44A 1A8OA 4COCA 4U0AA 3M1MA 3LRYA 1Q81Q 3DS0A 3G26A 2XXMA 4XROA 1A43A 3RG6C 2Z45A 2DGYA 5F2KA 3CC7P 1M6NA 3CMAP 1EOQA 3I56P 1K30A 3DS2A 1JJ2O 3CCEP 3DPHA 3P05A 1KQSO 1YIJP 3NTEA 3DS4A 1Q7YQ 2OTLP 3H4EA 1VQPP 3G71P 1VQKP 2XT1A 2PEOA 5F2OA 2OTJP 3G29A 3CCQP 3CXCO 1N8RQ 4XRQA 4XFXA 3Q20A 3G0VA 3OW2O 1YJNP 2QEXP 3CCLP 1VQ7P 4IPYA 3WBHA 2P9XA 4PH1A 5HGOA 1VQ8P 2E1MA 1NJIQ 2QA4P 1Q86Q 2XV6A 3H0DA 1VQ6P 2BUOA 3CCVP 1K9MQ 3CCUP 3CCSP 3HZQA 4XFZA 3G6EP 3E2DA 2M8PA 3DTJA 1IUQA 2M8NA 4U0BA 3G1GA 4GR2A 2PEQA 5HGLA 1QVFO 1VQNP 3CPWO 3MGEA 1M74A 2PEIA 3CC2P 1RO2A 3G1IA 1M6EX 4U0FA 3CCJP 1YITP 2ONTA 5BS2A 3CMEP 1QRJA 1VQ5P 3CCMP 4PH0A 5BS1A 3G21A 3DS1A 3CC4P 4M0IA 1YJ9P 1VQLP 1YI2P 1YHQP 4GR6A 1M1KQ 5F2NA 1QVGO 4U0DA 5HGMA 2LF4A 1AUMA 3VRLC 1E6JP 1M90Q 1KC8Q 1D1DA 1Q82Q 2PEKA 3H47A 2EFJA 2CWOA 2Z46A 4XFYA 2JO0A 5JPAA 1VQOP 1VQMP 2PY8A 2EG5A 4WYMA 2M8LA 2PEMA 1W2BO 4QNBA 3HYBA 4COPA 4U0CA 2PEJA 1K8AQ 1K73Q 2L6EA 1YJWP 2KODA 3CD6P 2OARA 2JYLA 1EIAA 3I55P 1VQ9P 1VQ4P 1RNIA 4U0EA 2EIAA 3G4SP 1ZMBA 2JYGA 1S72P 1KD1Q 3B5IA 3DS5A 5HGNA 1RO0A 1BAJA 3CCRP 3G28A 3DS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XFY A;  2JO0 A;  3G29 A;  5I4T G;  3MGE A;  5JPA A;  5DCK A;  4WYM A;  2M8L A;  4XRQ A;  3G1I A;  1A8O A;  4XFX A;  4U0F A;  3G0V A;  4COC A;  4QNB A;  4U0A A;  2ONT A;  3LRY A;  4COP A;  1QRJ A;  4U0C A;  4IPY A;  3DS0 A;  2L6E A;  3G26 A;  4PH0 A;  2KOD A;  4PH1 A;  5HGO A;  2XXM A;  3G21 A;  4XRO A;  1A43 A;  3DS1 A;  2JYL A;  1EIA A;  4M0I A;  2XV6 A;  1EOQ A;  2BUO A;  2EIA A;  3H47 A;  4U0E A;  3DS2 A;  2JYG A;  3DPH A;  3P05 A;  4U0D A;  4XFZ A;  5HGM A;  2LF4 A;  1AUM A;  2M8P A;  3NTE A;  3DS4 A;  3VRL C;  3DS5 A;  3DTJ A;  3H4E A;  1E6J P;  4U0B A;  2M8N A;  5HGN A;  1BAJ A;  3G1G A;  1D1D A;  3G28 A;  5HGL A;  2XT1 A;  3DS3 A; 
#chains in the Genus database with same CATH topology
 2BHV A;  2CG5 B;  2Z44 A;  2GDX A;  2M5R A;  3M1M A;  4XRO A;  2Z45 A;  2DGY A;  2K5X A;  2FAE A;  3CMA P;  1FR2 A;  3I56 P;  1K30 A;  3P05 A;  2KW2 A;  1KQS O;  2MF4 A;  3NY7 B;  3EJB A;  1VQK P;  3EJE A;  2PEO A;  2VSQ A;  1N8R Q;  3G0V A;  3OW2 O;  3CCL P;  4IZ6 A;  2LIW A;  2K94 A;  2GZF A;  2FQ0 A;  2BUO A;  3CE7 A;  5CZD B;  3CCU P;  2LML A;  3CCS P;  2MD9 A;  1IMQ A;  2M8P A;  4H2Y C;  3GZL A;  1VQN P;  3MGE A;  2KGD A;  2JB0 A;  3G1I A;  1M6E X;  3CCJ P;  5BS2 A;  1VQ5 P;  4M0I A;  3GZM A;  1VQL P;  1M1K Q;  5F2N A;  4U0D A;  5HGM A;  4QKO A;  1AUM A;  3VRL C;  4PWV B;  2VLO A;  1D1D A;  2JU1 A;  2Z46 A;  1EMV A;  2JO0 A;  1VQO P;  1VQM P;  2PY8 A;  4WYM A;  2M8L A;  2PEM A;  2JBG A;  4U0C A;  1VHN A;  3CD6 P;  7CEI A;  3EJD A;  1UNK A;  2EHS A;  1IMP A;  5HGN A;  3CCR P;  1BAJ A;  3U43 A;  3DS3 A;  3LMO A;  5I4T G;  2K92 A;  2N50 A;  1A8O A;  4COC A;  4R0M A;  2FAD A;  1GXG A;  3GJN A;  5EW5 E;  3G26 A;  2KOR A;  2MY5 A;  1A43 A;  2MVV A;  1M6N A;  2PNG A;  2L22 A;  4BPG A;  2K93 A;  3NTE A;  3DS4 A;  1VQP P;  2XT1 A;  1VKU A;  3CCQ P;  3CXC O;  4XRQ A;  5KP7 B;  2JU2 A;  1VQ7 P;  1VQ8 P;  2K2Q A;  3H0D A;  1VQ6 P;  3CCV P;  1GXH A;  2M8N A;  4CA3 A;  2L0Q A;  5HGL A;  1M74 A;  2PEI A;  2FVE A;  3GKL C;  2MR7 A;  2FVA A;  2N6Y A;  2QNW A;  2WPT A;  3CC4 P;  2XZ1 C;  1QVG O;  1GPJ A;  2LKI A;  4BPH A;  1KLP A;  1M90 Q;  1ZNV A;  2FQ2 A;  3HYB A;  4COP A;  1K8A Q;  2L6E A;  1YJW P;  1EIA A;  3I55 P;  1DNY A;  4U0E A;  1OR5 A;  3G4S P;  1ZMB A;  2JAZ A;  2DNW A;  5KP6 B;  3DS5 A;  1BXI A;  2FHS C;  4HKG A;  4F37 A;  4U0A A;  2JQ4 A;  4H2W C;  2FAC A;  3RG6 C;  5F2K A;  5HVC A;  3CC7 P;  1EOQ A;  3DS2 A;  1JJ2 O;  3CCE P;  2CGQ A;  2GYK A;  3DPH A;  2LOL A;  2ROQ A;  1Q7Y Q;  3G71 P;  2GZG A;  1L0H A;  3G29 A;  1HY8 A;  4XFX A;  3Q20 A;  2KWL A;  2LIU A;  4IPY A;  2P9X A;  4PH1 A;  1NJI Q;  2QA4 P;  1Q86 Q;  2XV6 A;  2KGA A;  2VLP A;  1K9M Q;  5HV8 A;  3HZQ A;  3G6E P;  2LL8 A;  3E2D A;  2FQ1 A;  4U0B A;  4BPF A;  2VLN A;  3CPW O;  2X2B A;  3CC2 P;  1RO2 A;  4U0F A;  3CME P;  3CCM P;  4PH0 A;  2XZ0 D;  2GZI A;  1YJ9 P;  1YHQ P;  2KOO A;  1Z6M A;  2LF4 A;  2GDW A;  2ERH A;  2CWO A;  3H47 A;  4H2X C;  4XFY A;  5JPA A;  2GZE A;  1AF8 A;  2N6Z A;  2EG5 A;  2CNR A;  2K0D X;  2PEJ A;  1K73 Q;  1F80 D;  2KOD A;  4PXH B;  2KOS A;  5EJD A;  2JYL A;  1VQ4 P;  1RNI A;  3B4Q A;  2EIA A;  1S72 P;  3B5I A;  2AFE A;  2L4B A;  2L9F A;  2KG8 A;  1CEI A;  5KP8 B;  2PEN A;  5DCK A;  3RG2 A;  2MR8 A;  3LRY A;  1Q81 Q;  3DS0 A;  2JGP A;  1UJZ A;  2XXM A;  2LPK A;  2KOQ A;  1YIJ P;  2OTL P;  3H4E A;  2KGE A;  2FVF A;  4NEO A;  5F2O A;  2OTJ P;  2N5H A;  2KOP A;  1ACP A;  1YJN P;  2QEX P;  4DG9 A;  3WBH A;  5HGO A;  2E1M A;  1AYI A;  4XFZ A;  2AF8 A;  1NQ4 A;  2K0X A;  3DTJ A;  1IUQ A;  3G1G A;  1X3O A;  4GR2 A;  2PEQ A;  1QVF O;  2LTE A;  1L0I A;  1YIT P;  2ONT A;  1QRJ A;  2EHT A;  2MVU A;  2VLQ A;  2N5I A;  5BS1 A;  1HQB A;  3G21 A;  3DS1 A;  1YI2 P;  4GR6 A;  2AFD A;  2GZJ A;  4MRT C;  1E0H A;  2KG9 A;  2KR5 A;  1DV5 A;  1E6J P;  1KC8 Q;  1Q82 Q;  2PEK A;  2EFJ A;  2KGC A;  2AVA A;  1W2B O;  4QNB A;  2CQ8 A;  4UHP B;  1MZ8 A;  2GDY A;  2N98 A;  2OAR A;  1T8K A;  1VQ9 P;  2K0Y A;  2JYG A;  1KD1 Q;  1RO0 A;  2KG6 A;  3G28 A;  2NO8 A; 
#chains in the Genus database with same CATH homology
 2BHV A;  5I4T G;  2PEN A;  5DCK A;  2Z44 A;  1A8O A;  4COC A;  4U0A A;  3M1M A;  3LRY A;  1Q81 Q;  3DS0 A;  3G26 A;  2XXM A;  4XRO A;  1A43 A;  3RG6 C;  2Z45 A;  2DGY A;  5F2K A;  3CC7 P;  1M6N A;  3CMA P;  1EOQ A;  3I56 P;  1K30 A;  3DS2 A;  1JJ2 O;  3CCE P;  3DPH A;  3P05 A;  1KQS O;  1YIJ P;  3NTE A;  3DS4 A;  1Q7Y Q;  2OTL P;  3H4E A;  1VQP P;  3G71 P;  1VQK P;  2XT1 A;  2PEO A;  5F2O A;  2OTJ P;  3G29 A;  3CCQ P;  3CXC O;  1N8R Q;  4XRQ A;  4XFX A;  3Q20 A;  3G0V A;  3OW2 O;  1YJN P;  2QEX P;  3CCL P;  1VQ7 P;  4IPY A;  3WBH A;  2P9X A;  4PH1 A;  5HGO A;  1VQ8 P;  2E1M A;  1NJI Q;  2QA4 P;  1Q86 Q;  2XV6 A;  3H0D A;  1VQ6 P;  2BUO A;  3CCV P;  1K9M Q;  3CCU P;  3CCS P;  3HZQ A;  4XFZ A;  3G6E P;  3E2D A;  2M8P A;  3DTJ A;  1IUQ A;  2M8N A;  4U0B A;  3G1G A;  4GR2 A;  2PEQ A;  5HGL A;  1QVF O;  1VQN P;  3CPW O;  3MGE A;  1M74 A;  2PEI A;  3CC2 P;  1RO2 A;  3G1I A;  1M6E X;  4U0F A;  3CCJ P;  1YIT P;  2ONT A;  5BS2 A;  3CME P;  1QRJ A;  1VQ5 P;  3CCM P;  4PH0 A;  5BS1 A;  3G21 A;  3DS1 A;  3CC4 P;  4M0I A;  1YJ9 P;  1VQL P;  1YI2 P;  1YHQ P;  4GR6 A;  1M1K Q;  5F2N A;  1QVG O;  4U0D A;  5HGM A;  2LF4 A;  1AUM A;  3VRL C;  1E6J P;  1M90 Q;  1KC8 Q;  1D1D A;  1Q82 Q;  2PEK A;  3H47 A;  2EFJ A;  2CWO A;  2Z46 A;  4XFY A;  2JO0 A;  5JPA A;  1VQO P;  1VQM P;  2PY8 A;  2EG5 A;  4WYM A;  2M8L A;  2PEM A;  1W2B O;  4QNB A;  3HYB A;  4COP A;  4U0C A;  2PEJ A;  1K8A Q;  1K73 Q;  2L6E A;  1YJW P;  2KOD A;  3CD6 P;  2OAR A;  2JYL A;  1EIA A;  3I55 P;  1VQ9 P;  1VQ4 P;  1RNI A;  4U0E A;  2EIA A;  3G4S P;  1ZMB A;  2JYG A;  1S72 P;  1KD1 Q;  3B5I A;  3DS5 A;  5HGN A;  1RO0 A;  1BAJ A;  3CCR P;  3G28 A;  3DS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...