3G1IA

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: intermediate ph
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
76
structure length
76
Chain Sequence
GPWADIMQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 27
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g1iA00
4U0BA 1D1DA 4U0AA 1E6JP 3H47A 3G1GA 4PH1A 5HGNA 4XFYA 4M0IA 3G1IA 4U0EA 5HGLA 3G21A 2XV6A 4XRQA 2M8PA 3MGEA 3VRLC 3DS1A 3DS2A 1A43A 2JO0A 1EIAA 2KODA 1AUMA 2EIAA 3DS3A 4QNBA 4COPA 2LF4A 4U0FA 2M8NA 3DS0A 5HGMA 4IPYA 3G26A 3G28A 3NTEA 3DS5A 3DS4A 3P05A 1EOQA 2JYGA 4XFZA 2M8LA 4U0DA 4PH0A 3DPHA 5HGOA 2XT1A 4COCA 5DCKA 3DTJA 4XFXA 5I4TG 4U0CA 3H4EA 3G29A 4XROA 5JPAA 3G0VA 2BUOA 2ONTA 4WYMA 2XXMA 3LRYA 2JYLA 1BAJA 2L6EA 1A8OA 1QRJA
chains in the Genus database with same CATH superfamily
2KOPA 1YJWP 5HGNA 4XFYA 1K8AQ 3CC4P 4R0MA 4U0EA 2GDWA 2KG9A 2XV6A 3DS2A 4UHPB 2PEIA 4GR6A 1KC8Q 2L9FA 7CEIA 2EHSA 4CA3A 3LRYA 2CQ8A 1AF8A 3G1GA 2VLNA 2FVAA 4M0IA 3CD6P 2FADA 4MRTC 1ZMBA 2MR8A 2JO0A 3G6EP 3Q20A 4BPGA 1M6EX 2CGQA 3DS4A 1HQBA 2LPKA 5DCKA 2LMLA 1BXIA 2ERHA 1KLPA 2LL8A 5KP7B 1QRJA 2ROQA 4GR2A 3H47A 1OR5A 1NQ4A 2FVFA 1VQ8P 2VLQA 1VQ7P 1S72P 2PEMA 2LF4A 2FAEA 3CE7A 4U0DA 3CMEP 3CCJP 5BS1A 2GYKA 2BUOA 5JPAA 2N6YA 5HV8A 3G4SP 2AF8A 2JB0A 2PEOA 3RG6C 2FVEA 1IMQA 4H2XC 4QNBA 5CZDB 2GZIA 3M1MA 2K93A 3CMAP 1YIJP 3U43A 5KP8B 1VQ5P 1IUQA 3HZQA 5EW5E 1VQKP 2KWLA 1DNYA 2EG5A 2FQ2A 2JQ4A 3CCLP 4F37A 2EFJA 3G21A 2M8PA 2LTEA 1QVGO 2K0DX 3B4QA 2P9XA 4H2YC 4XFZA 1Q7YQ 3G28A 3DS5A 1EOQA 1VQPP 1UJZA 2MF4A 3DTJA 5I4TG 1IMPA 4IZ6A 1K73Q 2EIAA 1A8OA 5HVCA 1E6JP 3CC7P 1AYIA 2JGPA 3GJNA 1W2BO 5F2NA 1K30A 2LIUA 2X2BA 1EIAA 2XZ1C 2VLPA 4WYMA 4IPYA 2KW2A 2AFDA 1VQOP 1ZNVA 3EJDA 3CCUP 3DS3A 2MR7A 3B5IA 3CC2P 1KD1Q 2QEXP 4BPHA 4DG9A 1GPJA 1D1DA 2AVAA 4XRQA 1YJ9P 3GKLC 2K94A 2EHTA 2N50A 3NY7B 4PXHB 1YITP 2AFEA 1VQ6P 2KG8A 2K92A 2DGYA 1RNIA 1YI2P 1JJ2O 2M5RA 1M1KQ 2FACA 1AUMA 2BHVA 2MY5A 2L0QA 2GZEA 4BPFA 2Z45A 3G29A 1KQSO 1Q82Q 2KOOA 3DS0A 2PEKA 1YJNP 2NO8A 1Z6MA 2KOQA 1VQMP 2N5HA 2K2QA 2LIWA 1L0HA 1DV5A 2VSQA 2LOLA 1N8RQ 3NTEA 2N98A 3E2DA 2Z46A 1T8KA 2N6ZA 2KGEA 2JAZA 1M6NA 3I56P 2MD9A 3G0VA 2JYLA 2L6EA 1MZ8A 2QNWA 2FQ0A 3WBHA 1VQ4P 5KP6B 2OTLP 2KR5A 1A43A 2GZGA 1ACPA 2MVVA 2CWOA 1HY8A 2PEQA 2OTJP 1L0IA 1NJIQ 1M90Q 5HGOA 2CG5B 2PENA 1VQNP 3CCVP 3G1IA 1K9MQ 5HGLA 2WPTA 3LMOA 5F2KA 3DS1A 3G71P 1X3OA 1QVFO 2M8LA 3GZMA 1RO2A 4PH0A 2FHSC 3H4EA 4PH1A 2E1MA 3EJEA 2PEJA 2K0YA 2LKIA 1UNKA 3I55P 3HYBA 3MGEA 1VQ9P 2K0XA 2CNRA 2L22A 2K5XA 2KG6A 4COPA 5HGMA 3G26A 2GDXA 2XT1A 2KORA 1Q86Q 2GZJA 2PNGA 1YHQP 5F2OA 1FR2A 1RO0A 2ONTA 4NEOA 2XXMA 2Z44A 2KGCA 2QA4P 1Q81Q 2GDYA 2JU1A 2N5IA 1EMVA 4QKOA 4U0FA 2M8NA 3P05A 1VKUA 1GXGA 3CCSP 1F80D 1M74A 4COCA 4XFXA 1E0HA 4U0CA 3CCMP 2PY8A 2JBGA 4XROA 3CCQP 2OARA 4PWVB 2KGAA 3CPWO 2JU2A 3EJBA 3CCEP 2KGDA 2KODA 2KOSA 2JYGA 3GZLA 1BAJA 2MVUA 4U0BA 4U0AA 3CXCO 3OW2O 1VHNA 1VQLP 3RG2A 2FQ1A 3H0DA 2DNWA 4H2WC 3VRLC 5EJDA 2VLOA 2L4BA 1CEIA 2GZFA 3DPHA 5BS2A 1GXHA 2XZ0D 4HKGA 3CCRP
chains in the Genus database with same CATH topology
2EG5A 2PEJA 2DGYA 1RNIA 1YJWP 3CCLP 5HGNA 4XFYA 1YI2P 1K8AQ 3CC4P 2EFJA 4U0EA 1JJ2O 3G21A 2XV6A 3I55P 3HYBA 2M8PA 3MGEA 1VQ9P 1M1KQ 3DS2A 1QVGO 1AUMA 4COPA 2BHVA 2P9XA 5HGMA 4XFZA 2PEIA 3G28A 3G26A 3DS5A 1Q7YQ 1EOQA 4GR6A 1VQPP 1KC8Q 2XT1A 2Z45A 3DTJA 5I4TG 1Q86Q 3G29A 1YHQP 5F2OA 1K73Q 1RO0A 2ONTA 1Q82Q 2XXMA 3LRYA 3DS0A 2EIAA 1KQSO 1A8OA 2PEKA 1YJNP 2Z44A 1E6JP 3CC7P 3G1GA 4M0IA 3CD6P 1W2BO 2QA4P 5F2NA 1Q81Q 1VQMP 1K30A 1ZMBA 1EIAA 2JO0A 3G6EP 4U0FA 3Q20A 2M8NA 1M6EX 1N8RQ 3NTEA 3P05A 3DS4A 3E2DA 3CCSP 2Z46A 1M74A 4COCA 5DCKA 4XFXA 1M6NA 4U0CA 3I56P 3CCMP 2PY8A 4XROA 3G0VA 4WYMA 3CCQP 2JYLA 2L6EA 4IPYA 1QRJA 2OARA 4GR2A 3H47A 3CPWO 3WBHA 1VQ4P 1VQOP 1VQ8P 3CCEP 2OTLP 3CCUP 1VQ7P 1A43A 2KODA 3DS3A 1S72P 2PEMA 2LF4A 2JYGA 4U0DA 3CMEP 3B5IA 3CC2P 1KD1Q 3CCJP 2CWOA 2QEXP 5BS1A 2PEQA 2OTJP 1NJIQ 1M90Q 2BUOA 5JPAA 1BAJA 5HGOA 4U0BA 1D1DA 4U0AA 2PENA 3CXCO 1VQNP 3CCVP 3G1IA 3OW2O 1K9MQ 1VQLP 5HGLA 3G4SP 3H0DA 2PEOA 3RG6C 4XRQA 5F2KA 3VRLC 3DS1A 3G71P 1YJ9P 4QNBA 1QVFO 2M8LA 3M1MA 3CMAP 1YIJP 1RO2A 3DPHA 4PH0A 1VQ5P 1IUQA 5BS2A 3H4EA 1YITP 3HZQA 1VQ6P 1VQKP 4PH1A 2E1MA 3CCRP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0B A;  1D1D A;  4U0A A;  1E6J P;  3H47 A;  3G1G A;  4PH1 A;  5HGN A;  4XFY A;  4M0I A;  3G1I A;  4U0E A;  5HGL A;  3G21 A;  2XV6 A;  4XRQ A;  2M8P A;  3MGE A;  3VRL C;  3DS1 A;  3DS2 A;  1A43 A;  2JO0 A;  1EIA A;  2KOD A;  1AUM A;  2EIA A;  3DS3 A;  4QNB A;  4COP A;  2LF4 A;  4U0F A;  2M8N A;  3DS0 A;  5HGM A;  4IPY A;  3G26 A;  3G28 A;  3NTE A;  3DS5 A;  3DS4 A;  3P05 A;  1EOQ A;  2JYG A;  4XFZ A;  2M8L A;  4U0D A;  4PH0 A;  3DPH A;  5HGO A;  2XT1 A;  4COC A;  5DCK A;  3DTJ A;  4XFX A;  5I4T G;  4U0C A;  3H4E A;  3G29 A;  4XRO A;  5JPA A;  3G0V A;  2BUO A;  2ONT A;  4WYM A;  2XXM A;  3LRY A;  2JYL A;  1BAJ A;  2L6E A;  1A8O A;  1QRJ A; 
#chains in the Genus database with same CATH topology
 2KOP A;  1YJW P;  5HGN A;  4XFY A;  1K8A Q;  3CC4 P;  4R0M A;  4U0E A;  2GDW A;  2KG9 A;  2XV6 A;  3DS2 A;  4UHP B;  2PEI A;  4GR6 A;  1KC8 Q;  2L9F A;  7CEI A;  2EHS A;  4CA3 A;  3LRY A;  2CQ8 A;  1AF8 A;  3G1G A;  2VLN A;  2FVA A;  4M0I A;  3CD6 P;  2FAD A;  4MRT C;  1ZMB A;  2MR8 A;  2JO0 A;  3G6E P;  3Q20 A;  4BPG A;  1M6E X;  2CGQ A;  3DS4 A;  1HQB A;  2LPK A;  5DCK A;  2LML A;  1BXI A;  2ERH A;  1KLP A;  2LL8 A;  5KP7 B;  1QRJ A;  2ROQ A;  4GR2 A;  3H47 A;  1OR5 A;  1NQ4 A;  2FVF A;  1VQ8 P;  2VLQ A;  1VQ7 P;  1S72 P;  2PEM A;  2LF4 A;  2FAE A;  3CE7 A;  4U0D A;  3CME P;  3CCJ P;  5BS1 A;  2GYK A;  2BUO A;  5JPA A;  2N6Y A;  5HV8 A;  3G4S P;  2AF8 A;  2JB0 A;  2PEO A;  3RG6 C;  2FVE A;  1IMQ A;  4H2X C;  4QNB A;  5CZD B;  2GZI A;  3M1M A;  2K93 A;  3CMA P;  1YIJ P;  3U43 A;  5KP8 B;  1VQ5 P;  1IUQ A;  3HZQ A;  5EW5 E;  1VQK P;  2KWL A;  1DNY A;  2EG5 A;  2FQ2 A;  2JQ4 A;  3CCL P;  4F37 A;  2EFJ A;  3G21 A;  2M8P A;  2LTE A;  1QVG O;  2K0D X;  3B4Q A;  2P9X A;  4H2Y C;  4XFZ A;  1Q7Y Q;  3G28 A;  3DS5 A;  1EOQ A;  1VQP P;  1UJZ A;  2MF4 A;  3DTJ A;  5I4T G;  1IMP A;  4IZ6 A;  1K73 Q;  2EIA A;  1A8O A;  5HVC A;  1E6J P;  3CC7 P;  1AYI A;  2JGP A;  3GJN A;  1W2B O;  5F2N A;  1K30 A;  2LIU A;  2X2B A;  1EIA A;  2XZ1 C;  2VLP A;  4WYM A;  4IPY A;  2KW2 A;  2AFD A;  1VQO P;  1ZNV A;  3EJD A;  3CCU P;  3DS3 A;  2MR7 A;  3B5I A;  3CC2 P;  1KD1 Q;  2QEX P;  4BPH A;  4DG9 A;  1GPJ A;  1D1D A;  2AVA A;  4XRQ A;  1YJ9 P;  3GKL C;  2K94 A;  2EHT A;  2N50 A;  3NY7 B;  4PXH B;  1YIT P;  2AFE A;  1VQ6 P;  2KG8 A;  2K92 A;  2DGY A;  1RNI A;  1YI2 P;  1JJ2 O;  2M5R A;  1M1K Q;  2FAC A;  1AUM A;  2BHV A;  2MY5 A;  2L0Q A;  2GZE A;  4BPF A;  2Z45 A;  3G29 A;  1KQS O;  1Q82 Q;  2KOO A;  3DS0 A;  2PEK A;  1YJN P;  2NO8 A;  1Z6M A;  2KOQ A;  1VQM P;  2N5H A;  2K2Q A;  2LIW A;  1L0H A;  1DV5 A;  2VSQ A;  2LOL A;  1N8R Q;  3NTE A;  2N98 A;  3E2D A;  2Z46 A;  1T8K A;  2N6Z A;  2KGE A;  2JAZ A;  1M6N A;  3I56 P;  2MD9 A;  3G0V A;  2JYL A;  2L6E A;  1MZ8 A;  2QNW A;  2FQ0 A;  3WBH A;  1VQ4 P;  5KP6 B;  2OTL P;  2KR5 A;  1A43 A;  2GZG A;  1ACP A;  2MVV A;  2CWO A;  1HY8 A;  2PEQ A;  2OTJ P;  1L0I A;  1NJI Q;  1M90 Q;  5HGO A;  2CG5 B;  2PEN A;  1VQN P;  3CCV P;  3G1I A;  1K9M Q;  5HGL A;  2WPT A;  3LMO A;  5F2K A;  3DS1 A;  3G71 P;  1X3O A;  1QVF O;  2M8L A;  3GZM A;  1RO2 A;  4PH0 A;  2FHS C;  3H4E A;  4PH1 A;  2E1M A;  3EJE A;  2PEJ A;  2K0Y A;  2LKI A;  1UNK A;  3I55 P;  3HYB A;  3MGE A;  1VQ9 P;  2K0X A;  2CNR A;  2L22 A;  2K5X A;  2KG6 A;  4COP A;  5HGM A;  3G26 A;  2GDX A;  2XT1 A;  2KOR A;  1Q86 Q;  2GZJ A;  2PNG A;  1YHQ P;  5F2O A;  1FR2 A;  1RO0 A;  2ONT A;  4NEO A;  2XXM A;  2Z44 A;  2KGC A;  2QA4 P;  1Q81 Q;  2GDY A;  2JU1 A;  2N5I A;  1EMV A;  4QKO A;  4U0F A;  2M8N A;  3P05 A;  1VKU A;  1GXG A;  3CCS P;  1F80 D;  1M74 A;  4COC A;  4XFX A;  1E0H A;  4U0C A;  3CCM P;  2PY8 A;  2JBG A;  4XRO A;  3CCQ P;  2OAR A;  4PWV B;  2KGA A;  3CPW O;  2JU2 A;  3EJB A;  3CCE P;  2KGD A;  2KOD A;  2KOS A;  2JYG A;  3GZL A;  1BAJ A;  2MVU A;  4U0B A;  4U0A A;  3CXC O;  3OW2 O;  1VHN A;  1VQL P;  3RG2 A;  2FQ1 A;  3H0D A;  2DNW A;  4H2W C;  3VRL C;  5EJD A;  2VLO A;  2L4B A;  1CEI A;  2GZF A;  3DPH A;  5BS2 A;  1GXH A;  2XZ0 D;  4HKG A;  3CCR P; 
#chains in the Genus database with same CATH homology
 2EG5 A;  2PEJ A;  2DGY A;  1RNI A;  1YJW P;  3CCL P;  5HGN A;  4XFY A;  1YI2 P;  1K8A Q;  3CC4 P;  2EFJ A;  4U0E A;  1JJ2 O;  3G21 A;  2XV6 A;  3I55 P;  3HYB A;  2M8P A;  3MGE A;  1VQ9 P;  1M1K Q;  3DS2 A;  1QVG O;  1AUM A;  4COP A;  2BHV A;  2P9X A;  5HGM A;  4XFZ A;  2PEI A;  3G28 A;  3G26 A;  3DS5 A;  1Q7Y Q;  1EOQ A;  4GR6 A;  1VQP P;  1KC8 Q;  2XT1 A;  2Z45 A;  3DTJ A;  5I4T G;  1Q86 Q;  3G29 A;  1YHQ P;  5F2O A;  1K73 Q;  1RO0 A;  2ONT A;  1Q82 Q;  2XXM A;  3LRY A;  3DS0 A;  2EIA A;  1KQS O;  1A8O A;  2PEK A;  1YJN P;  2Z44 A;  1E6J P;  3CC7 P;  3G1G A;  4M0I A;  3CD6 P;  1W2B O;  2QA4 P;  5F2N A;  1Q81 Q;  1VQM P;  1K30 A;  1ZMB A;  1EIA A;  2JO0 A;  3G6E P;  4U0F A;  3Q20 A;  2M8N A;  1M6E X;  1N8R Q;  3NTE A;  3P05 A;  3DS4 A;  3E2D A;  3CCS P;  2Z46 A;  1M74 A;  4COC A;  5DCK A;  4XFX A;  1M6N A;  4U0C A;  3I56 P;  3CCM P;  2PY8 A;  4XRO A;  3G0V A;  4WYM A;  3CCQ P;  2JYL A;  2L6E A;  4IPY A;  1QRJ A;  2OAR A;  4GR2 A;  3H47 A;  3CPW O;  3WBH A;  1VQ4 P;  1VQO P;  1VQ8 P;  3CCE P;  2OTL P;  3CCU P;  1VQ7 P;  1A43 A;  2KOD A;  3DS3 A;  1S72 P;  2PEM A;  2LF4 A;  2JYG A;  4U0D A;  3CME P;  3B5I A;  3CC2 P;  1KD1 Q;  3CCJ P;  2CWO A;  2QEX P;  5BS1 A;  2PEQ A;  2OTJ P;  1NJI Q;  1M90 Q;  2BUO A;  5JPA A;  1BAJ A;  5HGO A;  4U0B A;  1D1D A;  4U0A A;  2PEN A;  3CXC O;  1VQN P;  3CCV P;  3G1I A;  3OW2 O;  1K9M Q;  1VQL P;  5HGL A;  3G4S P;  3H0D A;  2PEO A;  3RG6 C;  4XRQ A;  5F2K A;  3VRL C;  3DS1 A;  3G71 P;  1YJ9 P;  4QNB A;  1QVF O;  2M8L A;  3M1M A;  3CMA P;  1YIJ P;  1RO2 A;  3DPH A;  4PH0 A;  1VQ5 P;  1IUQ A;  5BS2 A;  3H4E A;  1YIT P;  3HZQ A;  1VQ6 P;  1VQK P;  4PH1 A;  2E1M A;  3CCR P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...