3G1IA

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: intermediate ph
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
76
structure length
76
Chain Sequence
GPWADIMQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Gag polyprotein
publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
total genus 27
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g1iA00
4U0EA 3G0VA 3G21A 2L6EA 3H4EA 4XFYA 3H47A 3DPHA 3DS1A 4U0CA 3MGEA 3G1GA 4QNBA 4U0AA 4IPYA 4U0DA 2JO0A 3DS3A 2XXMA 1EOQA 1A43A 4U0FA 3VRLC 4COPA 3DS2A 4M0IA 1EIAA 1QRJA 2JYLA 3DTJA 2KODA 4XROA 2M8LA 4COCA 1D1DA 2XT1A 3G28A 5HGMA 4XFZA 5JPAA 4XRQA 3G1IA 4PH1A 2XV6A 1A8OA 2M8NA 4XFXA 5HGNA 1E6JP 5HGLA 2EIAA 2JYGA 2BUOA 3P05A 3G29A 5DCKA 1BAJA 4PH0A 3DS4A 4U0BA 4WYMA 2M8PA 2ONTA 1AUMA 2LF4A 3DS5A 3G26A 3LRYA 3NTEA 5HGOA 5I4TG 3DS0A
chains in the Genus database with same CATH superfamily
3NY7B 1VQ4P 2N50A 2GZEA 4HKGA 2L22A 2AFEA 1VQNP 2L9FA 2PEOA 3P05A 2EG5A 5CZDB 3CCEP 4XFXA 2JAZA 5HGOA 4U0EA 1VQ7P 1KC8Q 3CCUP 1A43A 2GZIA 2ERHA 1VQ8P 2VLPA 1Q82Q 1YI2P 2QEXP 4IZ6A 4UHPB 2K92A 3DS4A 2M8PA 1ACPA 5KP7B 2CQ8A 4QNBA 4U0AA 3HYBA 2AF8A 4MRTC 3HZQA 1EIAA 4XROA 5EW5E 2GZFA 3EJBA 3E2DA 2N5IA 2LIUA 3CCJP 4PH1A 2PEJA 2ROQA 3CCQP 1HQBA 3I55P 1YIJP 7CEIA 2EHTA 1L0IA 5EJDA 3CMAP 2VLOA 1YJWP 1Z6MA 4BPFA 2FVEA 3U43A 1QVGO 2KR5A 2MR7A 3RG6C 2AVAA 2VLNA 2M8LA 2N98A 1VQMP 2DNWA 1IUQA 3CMEP 3G4SP 2PEMA 1M6EX 5KP6B 5BS2A 2MVVA 1KQSO 4CA3A 2VLQA 3WBHA 2QA4P 3CE7A 3OW2O 2P9XA 2PEKA 2KG8A 3CXCO 2MR8A 4COPA 3DS2A 2LOLA 4PXHB 1CEIA 1Q81Q 1NQ4A 2MVUA 5HGLA 5KP8B 4WYMA 4BPGA 2FQ2A 3G21A 1RO0A 3H4EA 2GZGA 3DS1A 3CC7P 1X3OA 4U0DA 1E0HA 2FADA 2KGAA 4XRQA 1DNYA 1L0HA 2JGPA 3H0DA 1F80D 2BUOA 1IMQA 2KG9A 2LL8A 2XZ1C 1EMVA 2MF4A 4DG9A 2PEQA 2KGCA 3CCSP 3GJNA 3MGEA 3DTJA 2FQ0A 2KODA 4GR2A 1RNIA 3G1IA 3Q20A 1AYIA 4H2YC 1YJ9P 1VQ6P 3CC2P 1VQ9P 2GYKA 2ONTA 1AUMA 1VQOP 4GR6A 1VKUA 3H47A 3DPHA 2MD9A 3CCMP 1AF8A 1QRJA 2E1MA 1N8RQ 2K0DX 5HGNA 2GDXA 2EIAA 2Z44A 5DCKA 2QNWA 1S72P 2N6YA 2L6EA 3EJDA 1IMPA 2XXMA 1EOQA 1W2BO 2CNRA 2K5XA 2GDWA 3EJEA 4XFZA 1BXIA 2VSQA 2N6ZA 1E6JP 1Q86Q 1DV5A 1BAJA 3G26A 1K9MQ 2LMLA 1OR5A 4NEOA 3B5IA 2K0YA 3CC4P 1FR2A 2LPKA 2JU1A 2PY8A 1GPJA 4H2XC 2N5HA 1D1DA 2KOSA 3GZMA 2EFJA 5HGMA 5F2NA 2OARA 2GZJA 3CD6P 3M1MA 1T8KA 1YJNP 1M6NA 2K2QA 2KORA 3CCLP 3GKLC 3DS5A 2K93A 2JU2A 2PENA 4BPHA 1K73Q 2NO8A 2KGDA 2OTLP 4U0FA 2LTEA 2FVAA 1K8AQ 2M8NA 2FACA 1KLPA 1YITP 2GDYA 2FVFA 4PH0A 2KOQA 3CCVP 4PWVB 2KW2A 5HVCA 4IPYA 5HV8A 2AFDA 4M0IA 1VQPP 5JPAA 1ZMBA 2DGYA 1A8OA 1ZNVA 2JYGA 2JQ4A 4H2WC 2FHSC 2KWLA 4U0BA 2Z45A 4R0MA 2Z46A 1VHNA 2FQ1A 3I56P 2KOPA 2BHVA 1KD1Q 4COCA 2JYLA 2X2BA 1YHQP 2XT1A 3CCRP 1UNKA 3GZLA 3RG2A 1UJZA 1VQKP 2OTJP 2EHSA 3CPWO 2FAEA 1Q7YQ 2KOOA 3LMOA 2JBGA 3G0VA 2K94A 2JO0A 3DS3A 2PNGA 3VRLC 2CG5B 5F2KA 1RO2A 1GXGA 2KG6A 2K0XA 2LIWA 1K30A 3B4QA 3LRYA 3DS0A 3G29A 4XFYA 1M90Q 2MY5A 2CWOA 3G28A 2CGQA 1M74A 2JB0A 2LKIA 2XV6A 1VQ5P 1GXHA 2KGEA 2LF4A 3NTEA 1QVFO 4QKOA 2M5RA 2XZ0D 4U0CA 3G1GA 3G71P 2WPTA 5BS1A 1M1KQ 1VQLP 2L4BA 5F2OA 2PEIA 1MZ8A 4F37A 3G6EP 1JJ2O 1HY8A 2L0QA 5I4TG 1NJIQ
chains in the Genus database with same CATH topology
3WBHA 2Z46A 2QA4P 2L6EA 3I56P 3OW2O 2P9XA 1VQ4P 2BHVA 2PEKA 1KD1Q 2XXMA 1EOQA 3CXCO 1W2BO 4COPA 3DS2A 4COCA 2JYLA 1YHQP 2XT1A 3CCRP 1Q81Q 4XFZA 1VQNP 2PEOA 1VQKP 2OTJP 1E6JP 5HGLA 3CPWO 1Q86Q 3P05A 2EG5A 1BAJA 1Q7YQ 4WYMA 3G26A 1K9MQ 3CCEP 4XFXA 5HGOA 3G21A 4U0EA 3G0VA 1RO0A 3H4EA 3B5IA 1VQ7P 3DS1A 3CC4P 3CC7P 4U0DA 2JO0A 3DS3A 1KC8Q 3CCUP 1A43A 3VRLC 1VQ8P 2PY8A 1D1DA 5F2KA 1RO2A 2EFJA 5HGMA 1Q82Q 1YI2P 5F2NA 4XRQA 2QEXP 1K30A 2OARA 3CD6P 3H0DA 3M1MA 1YJNP 2BUOA 1M6NA 3DS4A 3CCLP 2M8PA 3LRYA 3DS5A 3G29A 3DS0A 2PENA 2PEQA 4XFYA 1M90Q 1K73Q 3CCSP 3MGEA 4QNBA 4U0AA 2OTLP 3HYBA 2CWOA 4U0FA 3HZQA 1EIAA 3DTJA 4XROA 2KODA 3G28A 1M74A 3E2DA 4GR2A 3CCJP 1RNIA 3G1IA 3Q20A 4PH1A 2XV6A 2PEJA 1K8AQ 2M8NA 1VQ5P 1YITP 3CCQP 1YJ9P 1VQ6P 3I55P 1YIJP 3CC2P 1VQ9P 4PH0A 3CCVP 2ONTA 1AUMA 2LF4A 3NTEA 3CMAP 1QVFO 1NJIQ 1VQOP 4GR6A 3H47A 3DPHA 4U0CA 1YJWP 3G1GA 3G71P 4IPYA 5BS1A 1M1KQ 1QVGO 1VQLP 3RG6C 3CCMP 4M0IA 1QRJA 5F2OA 2M8LA 2E1MA 1VQPP 1N8RQ 5JPAA 1ZMBA 1VQMP 2DGYA 1IUQA 1A8OA 2PEIA 3G4SP 3CMEP 2PEMA 1M6EX 5HGNA 3G6EP 1JJ2O 2EIAA 2JYGA 2Z44A 5DCKA 4U0BA 5BS2A 5I4TG 2Z45A 1KQSO 1S72P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0E A;  3G0V A;  3G21 A;  2L6E A;  3H4E A;  4XFY A;  3H47 A;  3DPH A;  3DS1 A;  4U0C A;  3MGE A;  3G1G A;  4QNB A;  4U0A A;  4IPY A;  4U0D A;  2JO0 A;  3DS3 A;  2XXM A;  1EOQ A;  1A43 A;  4U0F A;  3VRL C;  4COP A;  3DS2 A;  4M0I A;  1EIA A;  1QRJ A;  2JYL A;  3DTJ A;  2KOD A;  4XRO A;  2M8L A;  4COC A;  1D1D A;  2XT1 A;  3G28 A;  5HGM A;  4XFZ A;  5JPA A;  4XRQ A;  3G1I A;  4PH1 A;  2XV6 A;  1A8O A;  2M8N A;  4XFX A;  5HGN A;  1E6J P;  5HGL A;  2EIA A;  2JYG A;  2BUO A;  3P05 A;  3G29 A;  5DCK A;  1BAJ A;  4PH0 A;  3DS4 A;  4U0B A;  4WYM A;  2M8P A;  2ONT A;  1AUM A;  2LF4 A;  3DS5 A;  3G26 A;  3LRY A;  3NTE A;  5HGO A;  5I4T G;  3DS0 A; 
#chains in the Genus database with same CATH topology
 3NY7 B;  1VQ4 P;  2N50 A;  2GZE A;  4HKG A;  2L22 A;  2AFE A;  1VQN P;  2L9F A;  2PEO A;  3P05 A;  2EG5 A;  5CZD B;  3CCE P;  4XFX A;  2JAZ A;  5HGO A;  4U0E A;  1VQ7 P;  1KC8 Q;  3CCU P;  1A43 A;  2GZI A;  2ERH A;  1VQ8 P;  2VLP A;  1Q82 Q;  1YI2 P;  2QEX P;  4IZ6 A;  4UHP B;  2K92 A;  3DS4 A;  2M8P A;  1ACP A;  5KP7 B;  2CQ8 A;  4QNB A;  4U0A A;  3HYB A;  2AF8 A;  4MRT C;  3HZQ A;  1EIA A;  4XRO A;  5EW5 E;  2GZF A;  3EJB A;  3E2D A;  2N5I A;  2LIU A;  3CCJ P;  4PH1 A;  2PEJ A;  2ROQ A;  3CCQ P;  1HQB A;  3I55 P;  1YIJ P;  7CEI A;  2EHT A;  1L0I A;  5EJD A;  3CMA P;  2VLO A;  1YJW P;  1Z6M A;  4BPF A;  2FVE A;  3U43 A;  1QVG O;  2KR5 A;  2MR7 A;  3RG6 C;  2AVA A;  2VLN A;  2M8L A;  2N98 A;  1VQM P;  2DNW A;  1IUQ A;  3CME P;  3G4S P;  2PEM A;  1M6E X;  5KP6 B;  5BS2 A;  2MVV A;  1KQS O;  4CA3 A;  2VLQ A;  3WBH A;  2QA4 P;  3CE7 A;  3OW2 O;  2P9X A;  2PEK A;  2KG8 A;  3CXC O;  2MR8 A;  4COP A;  3DS2 A;  2LOL A;  4PXH B;  1CEI A;  1Q81 Q;  1NQ4 A;  2MVU A;  5HGL A;  5KP8 B;  4WYM A;  4BPG A;  2FQ2 A;  3G21 A;  1RO0 A;  3H4E A;  2GZG A;  3DS1 A;  3CC7 P;  1X3O A;  4U0D A;  1E0H A;  2FAD A;  2KGA A;  4XRQ A;  1DNY A;  1L0H A;  2JGP A;  3H0D A;  1F80 D;  2BUO A;  1IMQ A;  2KG9 A;  2LL8 A;  2XZ1 C;  1EMV A;  2MF4 A;  4DG9 A;  2PEQ A;  2KGC A;  3CCS P;  3GJN A;  3MGE A;  3DTJ A;  2FQ0 A;  2KOD A;  4GR2 A;  1RNI A;  3G1I A;  3Q20 A;  1AYI A;  4H2Y C;  1YJ9 P;  1VQ6 P;  3CC2 P;  1VQ9 P;  2GYK A;  2ONT A;  1AUM A;  1VQO P;  4GR6 A;  1VKU A;  3H47 A;  3DPH A;  2MD9 A;  3CCM P;  1AF8 A;  1QRJ A;  2E1M A;  1N8R Q;  2K0D X;  5HGN A;  2GDX A;  2EIA A;  2Z44 A;  5DCK A;  2QNW A;  1S72 P;  2N6Y A;  2L6E A;  3EJD A;  1IMP A;  2XXM A;  1EOQ A;  1W2B O;  2CNR A;  2K5X A;  2GDW A;  3EJE A;  4XFZ A;  1BXI A;  2VSQ A;  2N6Z A;  1E6J P;  1Q86 Q;  1DV5 A;  1BAJ A;  3G26 A;  1K9M Q;  2LML A;  1OR5 A;  4NEO A;  3B5I A;  2K0Y A;  3CC4 P;  1FR2 A;  2LPK A;  2JU1 A;  2PY8 A;  1GPJ A;  4H2X C;  2N5H A;  1D1D A;  2KOS A;  3GZM A;  2EFJ A;  5HGM A;  5F2N A;  2OAR A;  2GZJ A;  3CD6 P;  3M1M A;  1T8K A;  1YJN P;  1M6N A;  2K2Q A;  2KOR A;  3CCL P;  3GKL C;  3DS5 A;  2K93 A;  2JU2 A;  2PEN A;  4BPH A;  1K73 Q;  2NO8 A;  2KGD A;  2OTL P;  4U0F A;  2LTE A;  2FVA A;  1K8A Q;  2M8N A;  2FAC A;  1KLP A;  1YIT P;  2GDY A;  2FVF A;  4PH0 A;  2KOQ A;  3CCV P;  4PWV B;  2KW2 A;  5HVC A;  4IPY A;  5HV8 A;  2AFD A;  4M0I A;  1VQP P;  5JPA A;  1ZMB A;  2DGY A;  1A8O A;  1ZNV A;  2JYG A;  2JQ4 A;  4H2W C;  2FHS C;  2KWL A;  4U0B A;  2Z45 A;  4R0M A;  2Z46 A;  1VHN A;  2FQ1 A;  3I56 P;  2KOP A;  2BHV A;  1KD1 Q;  4COC A;  2JYL A;  2X2B A;  1YHQ P;  2XT1 A;  3CCR P;  1UNK A;  3GZL A;  3RG2 A;  1UJZ A;  1VQK P;  2OTJ P;  2EHS A;  3CPW O;  2FAE A;  1Q7Y Q;  2KOO A;  3LMO A;  2JBG A;  3G0V A;  2K94 A;  2JO0 A;  3DS3 A;  2PNG A;  3VRL C;  2CG5 B;  5F2K A;  1RO2 A;  1GXG A;  2KG6 A;  2K0X A;  2LIW A;  1K30 A;  3B4Q A;  3LRY A;  3DS0 A;  3G29 A;  4XFY A;  1M90 Q;  2MY5 A;  2CWO A;  3G28 A;  2CGQ A;  1M74 A;  2JB0 A;  2LKI A;  2XV6 A;  1VQ5 P;  1GXH A;  2KGE A;  2LF4 A;  3NTE A;  1QVF O;  4QKO A;  2M5R A;  2XZ0 D;  4U0C A;  3G1G A;  3G71 P;  2WPT A;  5BS1 A;  1M1K Q;  1VQL P;  2L4B A;  5F2O A;  2PEI A;  1MZ8 A;  4F37 A;  3G6E P;  1JJ2 O;  1HY8 A;  2L0Q A;  5I4T G;  1NJI Q; 
#chains in the Genus database with same CATH homology
 3WBH A;  2Z46 A;  2QA4 P;  2L6E A;  3I56 P;  3OW2 O;  2P9X A;  1VQ4 P;  2BHV A;  2PEK A;  1KD1 Q;  2XXM A;  1EOQ A;  3CXC O;  1W2B O;  4COP A;  3DS2 A;  4COC A;  2JYL A;  1YHQ P;  2XT1 A;  3CCR P;  1Q81 Q;  4XFZ A;  1VQN P;  2PEO A;  1VQK P;  2OTJ P;  1E6J P;  5HGL A;  3CPW O;  1Q86 Q;  3P05 A;  2EG5 A;  1BAJ A;  1Q7Y Q;  4WYM A;  3G26 A;  1K9M Q;  3CCE P;  4XFX A;  5HGO A;  3G21 A;  4U0E A;  3G0V A;  1RO0 A;  3H4E A;  3B5I A;  1VQ7 P;  3DS1 A;  3CC4 P;  3CC7 P;  4U0D A;  2JO0 A;  3DS3 A;  1KC8 Q;  3CCU P;  1A43 A;  3VRL C;  1VQ8 P;  2PY8 A;  1D1D A;  5F2K A;  1RO2 A;  2EFJ A;  5HGM A;  1Q82 Q;  1YI2 P;  5F2N A;  4XRQ A;  2QEX P;  1K30 A;  2OAR A;  3CD6 P;  3H0D A;  3M1M A;  1YJN P;  2BUO A;  1M6N A;  3DS4 A;  3CCL P;  2M8P A;  3LRY A;  3DS5 A;  3G29 A;  3DS0 A;  2PEN A;  2PEQ A;  4XFY A;  1M90 Q;  1K73 Q;  3CCS P;  3MGE A;  4QNB A;  4U0A A;  2OTL P;  3HYB A;  2CWO A;  4U0F A;  3HZQ A;  1EIA A;  3DTJ A;  4XRO A;  2KOD A;  3G28 A;  1M74 A;  3E2D A;  4GR2 A;  3CCJ P;  1RNI A;  3G1I A;  3Q20 A;  4PH1 A;  2XV6 A;  2PEJ A;  1K8A Q;  2M8N A;  1VQ5 P;  1YIT P;  3CCQ P;  1YJ9 P;  1VQ6 P;  3I55 P;  1YIJ P;  3CC2 P;  1VQ9 P;  4PH0 A;  3CCV P;  2ONT A;  1AUM A;  2LF4 A;  3NTE A;  3CMA P;  1QVF O;  1NJI Q;  1VQO P;  4GR6 A;  3H47 A;  3DPH A;  4U0C A;  1YJW P;  3G1G A;  3G71 P;  4IPY A;  5BS1 A;  1M1K Q;  1QVG O;  1VQL P;  3RG6 C;  3CCM P;  4M0I A;  1QRJ A;  5F2O A;  2M8L A;  2E1M A;  1VQP P;  1N8R Q;  5JPA A;  1ZMB A;  1VQM P;  2DGY A;  1IUQ A;  1A8O A;  2PEI A;  3G4S P;  3CME P;  2PEM A;  1M6E X;  5HGN A;  3G6E P;  1JJ2 O;  2EIA A;  2JYG A;  2Z44 A;  5DCK A;  4U0B A;  5BS2 A;  5I4T G;  2Z45 A;  1KQS O;  1S72 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...