2PEMA

Crystal structure of rbcx in complex with substrate
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
110
structure length
110
Chain Sequence
EFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 48
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2pemA00
2Z45A 2PY8A 2Z44A 5BS2A 3RG6C 2PEIA 2PEJA 2PEKA 2Z46A 2PEOA 4GR2A 3Q20A 5BS1A 3HYBA 2PENA 2PEQA 2PEMA 4GR6A
chains in the Genus database with same CATH superfamily
2LIUA 1VQMP 2GDXA 3G29A 2L0QA 2MY5A 5DCKA 2XT1A 3GKLC 2GZEA 3H0DA 1DV5A 2VLPA 2JYGA 4BPGA 4XFZA 3EJEA 1S72P 5JPAA 1E6JP 1CEIA 3G6EP 2KW2A 3LMOA 1FR2A 3B5IA 4U0CA 1OR5A 2PY8A 2XXMA 2CG5B 5KP6B 1EIAA 1ZMBA 3HZQA 3U43A 2FQ2A 1M6NA 5KP7B 1RO2A 2P9XA 1KD1Q 2DGYA 1VQLP 2K5XA 1IMPA 1T8KA 2E1MA 2PEMA 1VQNP 4XFXA 5HV8A 2KOSA 2PEKA 2QNWA 3LRYA 3G21A 1EMVA 2PEJA 2LTEA 4U0BA 3NTEA 2PNGA 3DS2A 2AFEA 2GYKA 2EHTA 1VKUA 2LL8A 3CE7A 1JJ2O 2FVAA 1K73Q 4PXHB 2N5IA 2KGEA 2K93A 4BPFA 2CWOA 2KOPA 3CCEP 2Z45A 2L4BA 1Q82Q 1RNIA 1IUQA 3CC4P 1QVGO 1GXGA 1VQPP 1GPJA 4R0MA 1KQSO 1VQ7P 2VLNA 4WYMA 3CMEP 1F80D 4DG9A 1YITP 2JAZA 1VQ6P 2AFDA 2K0DX 3MGEA 3EJDA 5EW5E 2FQ0A 1AYIA 5HGMA 2X2BA 1YJNP 2KWLA 1HY8A 2MR8A 5CZDB 2EG5A 2EIAA 1L0HA 2MR7A 1UJZA 1ACPA 3DS5A 2GZGA 2GZIA 1EOQA 1MZ8A 2MD9A 2Z46A 3OW2O 4U0AA 2N6YA 2KGAA 2GZFA 1M1KQ 4MRTC 2K0XA 1NQ4A 1W2BO 1ZNVA 1A8OA 2M5RA 4QKOA 2PEOA 5HGOA 2AF8A 1L0IA 2XZ1C 3G0VA 3I55P 2CNRA 4U0DA 4GR6A 2M8LA 2KODA 5F2NA 4HKGA 1HQBA 1K8AQ 4U0EA 1AUMA 2K94A 1Q81Q 1QVFO 2L9FA 2VSQA 2JO0A 4IZ6A 3G1IA 4XFYA 1VHNA 3DS4A 5I4TG 2QA4P 1K9MQ 2LPKA 5HVCA 4F37A 2L6EA 3P05A 1YI2P 4COCA 2KOOA 2N6ZA 1Z6MA 1VQ5P 2VLOA 2LKIA 3CCVP 3G1GA 2MVVA 2KG6A 3RG6C 3CCRP 2MF4A 1RO0A 7CEIA 2KG9A 1BXIA 1Q7YQ 3CCMP 3CXCO 3DS3A 3CMAP 2LOLA 4H2XC 3G71P 2WPTA 1VQ4P 4XROA 2K2QA 1D1DA 3CC2P 2JYLA 3I56P 2DNWA 3GZMA 2N5HA 2KOQA 4CA3A 3DTJA 2MVUA 2FAEA 2FHSC 1DNYA 3E2DA 2PEQA 2QEXP 1AF8A 5BS2A 3WBHA 2JB0A 1VQ9P 4PH1A 1IMQA 1YJWP 3CCSP 5HGNA 3GZLA 1QRJA 4H2YC 5BS1A 4U0FA 3G28A 2KR5A 2OARA 1KLPA 2Z44A 3EJBA 2FADA 2KG8A 1A43A 5EJDA 2FVEA 2CQ8A 2JU2A 3VRLC 4XRQA 1YHQP 5F2OA 4UHPB 1NJIQ 3M1MA 2GDWA 3H4EA 3NY7B 4PWVB 3CCJP 2LMLA 3CCQP 1M90Q 4H2WC 1X3OA 2OTLP 2K0YA 3H47A 2GDYA 3DS0A 5F2KA 2KGDA 2EFJA 4BPHA 3G26A 4M0IA 2LIWA 2NO8A 2JU1A 3GJNA 2M8NA 2BUOA 4QNBA 3CCLP 2KORA 3CPWO 2BHVA 2LF4A 2XV6A 1M6EX 2FQ1A 3CD6P 3Q20A 2ROQA 3DPHA 2FACA 4PH0A 3HYBA 2JQ4A 2N98A 1VQOP 2EHSA 1YJ9P 3CCUP 2K92A 2PEIA 1KC8Q 1UNKA 2L22A 2PENA 1YIJP 2XZ0D 1K30A 1GXHA 3G4SP 3RG2A 2VLQA 3CC7P 1BAJA 2FVFA 1VQ8P 5HGLA 2KGCA 2AVAA 3DS1A 2CGQA 2M8PA 5KP8B 4GR2A 3B4QA 1M74A 1N8RQ 2OTJP 2ONTA 1VQKP 2JBGA 2ERHA 4NEOA 2GZJA 2N50A 4IPYA 1Q86Q 1E0HA 4COPA 2JGPA
chains in the Genus database with same CATH topology
2L6EA 1IUQA 3CC4P 1QVGO 3P05A 1VQPP 1YI2P 1VQMP 3G29A 1KQSO 3DS0A 4COCA 5DCKA 1VQ7P 2XT1A 3H0DA 1VQ5P 4WYMA 1RNIA 3CMEP 1YITP 3CCVP 5F2KA 3G1GA 1VQ6P 2JYGA 3RG6C 3CCRP 3MGEA 1RO0A 2EFJA 4XFZA 3G26A 4M0IA 1Q7YQ 1S72P 3CCMP 3CXCO 5JPAA 1E6JP 2M8NA 3DS3A 2BUOA 3CMAP 3G71P 5HGMA 1VQ4P 4QNBA 4XROA 3CCLP 3CPWO 1YJNP 2BHVA 2LF4A 1D1DA 2XV6A 1M6EX 2EG5A 2EIAA 3G6EP 2JYLA 3CC2P 3I56P 3CD6P 3B5IA 4U0CA 3Q20A 2PY8A 2XXMA 3DS5A 1EOQA 3DPHA 3DTJA 2Z46A 1EIAA 4PH0A 3HYBA 3OW2O 1ZMBA 4U0AA 1VQOP 3HZQA 1M1KQ 3E2DA 1M6NA 1RO2A 2PEQA 1YJ9P 2P9XA 2QEXP 3CCUP 2DGYA 1W2BO 1KD1Q 5BS2A 1VQLP 3WBHA 1A8OA 2PEIA 4PH1A 1VQ9P 1KC8Q 2PEOA 5HGOA 1YJWP 2E1MA 2PENA 2PEMA 1VQNP 3CCSP 5HGNA 3G0VA 4XFXA 3I55P 2PEKA 4U0DA 1YIJP 3LRYA 1QRJA 4GR6A 3G21A 5BS1A 4U0FA 1K30A 3G28A 2M8LA 2PEJA 4U0BA 2OARA 3NTEA 3G4SP 2KODA 5F2NA 2Z44A 3DS2A 3CC7P 1K8AQ 1BAJA 4U0EA 1VQ8P 5HGLA 1JJ2O 3DS1A 1AUMA 2M8PA 1A43A 1K73Q 4GR2A 1M74A 1N8RQ 1Q81Q 2OTJP 1QVFO 2ONTA 2JO0A 3VRLC 4XRQA 3G1IA 1YHQP 1VQKP 5F2OA 1NJIQ 2CWOA 4XFYA 3M1MA 3CCEP 3DS4A 3H4EA 2Z45A 3CCJP 3CCQP 4IPYA 1M90Q 5I4TG 2QA4P 1Q86Q 4COPA 1Q82Q 2OTLP 1K9MQ 3H47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z45 A;  2PY8 A;  2Z44 A;  5BS2 A;  3RG6 C;  2PEI A;  2PEJ A;  2PEK A;  2Z46 A;  2PEO A;  4GR2 A;  3Q20 A;  5BS1 A;  3HYB A;  2PEN A;  2PEQ A;  2PEM A;  4GR6 A; 
#chains in the Genus database with same CATH topology
 2LIU A;  1VQM P;  2GDX A;  3G29 A;  2L0Q A;  2MY5 A;  5DCK A;  2XT1 A;  3GKL C;  2GZE A;  3H0D A;  1DV5 A;  2VLP A;  2JYG A;  4BPG A;  4XFZ A;  3EJE A;  1S72 P;  5JPA A;  1E6J P;  1CEI A;  3G6E P;  2KW2 A;  3LMO A;  1FR2 A;  3B5I A;  4U0C A;  1OR5 A;  2PY8 A;  2XXM A;  2CG5 B;  5KP6 B;  1EIA A;  1ZMB A;  3HZQ A;  3U43 A;  2FQ2 A;  1M6N A;  5KP7 B;  1RO2 A;  2P9X A;  1KD1 Q;  2DGY A;  1VQL P;  2K5X A;  1IMP A;  1T8K A;  2E1M A;  2PEM A;  1VQN P;  4XFX A;  5HV8 A;  2KOS A;  2PEK A;  2QNW A;  3LRY A;  3G21 A;  1EMV A;  2PEJ A;  2LTE A;  4U0B A;  3NTE A;  2PNG A;  3DS2 A;  2AFE A;  2GYK A;  2EHT A;  1VKU A;  2LL8 A;  3CE7 A;  1JJ2 O;  2FVA A;  1K73 Q;  4PXH B;  2N5I A;  2KGE A;  2K93 A;  4BPF A;  2CWO A;  2KOP A;  3CCE P;  2Z45 A;  2L4B A;  1Q82 Q;  1RNI A;  1IUQ A;  3CC4 P;  1QVG O;  1GXG A;  1VQP P;  1GPJ A;  4R0M A;  1KQS O;  1VQ7 P;  2VLN A;  4WYM A;  3CME P;  1F80 D;  4DG9 A;  1YIT P;  2JAZ A;  1VQ6 P;  2AFD A;  2K0D X;  3MGE A;  3EJD A;  5EW5 E;  2FQ0 A;  1AYI A;  5HGM A;  2X2B A;  1YJN P;  2KWL A;  1HY8 A;  2MR8 A;  5CZD B;  2EG5 A;  2EIA A;  1L0H A;  2MR7 A;  1UJZ A;  1ACP A;  3DS5 A;  2GZG A;  2GZI A;  1EOQ A;  1MZ8 A;  2MD9 A;  2Z46 A;  3OW2 O;  4U0A A;  2N6Y A;  2KGA A;  2GZF A;  1M1K Q;  4MRT C;  2K0X A;  1NQ4 A;  1W2B O;  1ZNV A;  1A8O A;  2M5R A;  4QKO A;  2PEO A;  5HGO A;  2AF8 A;  1L0I A;  2XZ1 C;  3G0V A;  3I55 P;  2CNR A;  4U0D A;  4GR6 A;  2M8L A;  2KOD A;  5F2N A;  4HKG A;  1HQB A;  1K8A Q;  4U0E A;  1AUM A;  2K94 A;  1Q81 Q;  1QVF O;  2L9F A;  2VSQ A;  2JO0 A;  4IZ6 A;  3G1I A;  4XFY A;  1VHN A;  3DS4 A;  5I4T G;  2QA4 P;  1K9M Q;  2LPK A;  5HVC A;  4F37 A;  2L6E A;  3P05 A;  1YI2 P;  4COC A;  2KOO A;  2N6Z A;  1Z6M A;  1VQ5 P;  2VLO A;  2LKI A;  3CCV P;  3G1G A;  2MVV A;  2KG6 A;  3RG6 C;  3CCR P;  2MF4 A;  1RO0 A;  7CEI A;  2KG9 A;  1BXI A;  1Q7Y Q;  3CCM P;  3CXC O;  3DS3 A;  3CMA P;  2LOL A;  4H2X C;  3G71 P;  2WPT A;  1VQ4 P;  4XRO A;  2K2Q A;  1D1D A;  3CC2 P;  2JYL A;  3I56 P;  2DNW A;  3GZM A;  2N5H A;  2KOQ A;  4CA3 A;  3DTJ A;  2MVU A;  2FAE A;  2FHS C;  1DNY A;  3E2D A;  2PEQ A;  2QEX P;  1AF8 A;  5BS2 A;  3WBH A;  2JB0 A;  1VQ9 P;  4PH1 A;  1IMQ A;  1YJW P;  3CCS P;  5HGN A;  3GZL A;  1QRJ A;  4H2Y C;  5BS1 A;  4U0F A;  3G28 A;  2KR5 A;  2OAR A;  1KLP A;  2Z44 A;  3EJB A;  2FAD A;  2KG8 A;  1A43 A;  5EJD A;  2FVE A;  2CQ8 A;  2JU2 A;  3VRL C;  4XRQ A;  1YHQ P;  5F2O A;  4UHP B;  1NJI Q;  3M1M A;  2GDW A;  3H4E A;  3NY7 B;  4PWV B;  3CCJ P;  2LML A;  3CCQ P;  1M90 Q;  4H2W C;  1X3O A;  2OTL P;  2K0Y A;  3H47 A;  2GDY A;  3DS0 A;  5F2K A;  2KGD A;  2EFJ A;  4BPH A;  3G26 A;  4M0I A;  2LIW A;  2NO8 A;  2JU1 A;  3GJN A;  2M8N A;  2BUO A;  4QNB A;  3CCL P;  2KOR A;  3CPW O;  2BHV A;  2LF4 A;  2XV6 A;  1M6E X;  2FQ1 A;  3CD6 P;  3Q20 A;  2ROQ A;  3DPH A;  2FAC A;  4PH0 A;  3HYB A;  2JQ4 A;  2N98 A;  1VQO P;  2EHS A;  1YJ9 P;  3CCU P;  2K92 A;  2PEI A;  1KC8 Q;  1UNK A;  2L22 A;  2PEN A;  1YIJ P;  2XZ0 D;  1K30 A;  1GXH A;  3G4S P;  3RG2 A;  2VLQ A;  3CC7 P;  1BAJ A;  2FVF A;  1VQ8 P;  5HGL A;  2KGC A;  2AVA A;  3DS1 A;  2CGQ A;  2M8P A;  5KP8 B;  4GR2 A;  3B4Q A;  1M74 A;  1N8R Q;  2OTJ P;  2ONT A;  1VQK P;  2JBG A;  2ERH A;  4NEO A;  2GZJ A;  2N50 A;  4IPY A;  1Q86 Q;  1E0H A;  4COP A;  2JGP A; 
#chains in the Genus database with same CATH homology
 2L6E A;  1IUQ A;  3CC4 P;  1QVG O;  3P05 A;  1VQP P;  1YI2 P;  1VQM P;  3G29 A;  1KQS O;  3DS0 A;  4COC A;  5DCK A;  1VQ7 P;  2XT1 A;  3H0D A;  1VQ5 P;  4WYM A;  1RNI A;  3CME P;  1YIT P;  3CCV P;  5F2K A;  3G1G A;  1VQ6 P;  2JYG A;  3RG6 C;  3CCR P;  3MGE A;  1RO0 A;  2EFJ A;  4XFZ A;  3G26 A;  4M0I A;  1Q7Y Q;  1S72 P;  3CCM P;  3CXC O;  5JPA A;  1E6J P;  2M8N A;  3DS3 A;  2BUO A;  3CMA P;  3G71 P;  5HGM A;  1VQ4 P;  4QNB A;  4XRO A;  3CCL P;  3CPW O;  1YJN P;  2BHV A;  2LF4 A;  1D1D A;  2XV6 A;  1M6E X;  2EG5 A;  2EIA A;  3G6E P;  2JYL A;  3CC2 P;  3I56 P;  3CD6 P;  3B5I A;  4U0C A;  3Q20 A;  2PY8 A;  2XXM A;  3DS5 A;  1EOQ A;  3DPH A;  3DTJ A;  2Z46 A;  1EIA A;  4PH0 A;  3HYB A;  3OW2 O;  1ZMB A;  4U0A A;  1VQO P;  3HZQ A;  1M1K Q;  3E2D A;  1M6N A;  1RO2 A;  2PEQ A;  1YJ9 P;  2P9X A;  2QEX P;  3CCU P;  2DGY A;  1W2B O;  1KD1 Q;  5BS2 A;  1VQL P;  3WBH A;  1A8O A;  2PEI A;  4PH1 A;  1VQ9 P;  1KC8 Q;  2PEO A;  5HGO A;  1YJW P;  2E1M A;  2PEN A;  2PEM A;  1VQN P;  3CCS P;  5HGN A;  3G0V A;  4XFX A;  3I55 P;  2PEK A;  4U0D A;  1YIJ P;  3LRY A;  1QRJ A;  4GR6 A;  3G21 A;  5BS1 A;  4U0F A;  1K30 A;  3G28 A;  2M8L A;  2PEJ A;  4U0B A;  2OAR A;  3NTE A;  3G4S P;  2KOD A;  5F2N A;  2Z44 A;  3DS2 A;  3CC7 P;  1K8A Q;  1BAJ A;  4U0E A;  1VQ8 P;  5HGL A;  1JJ2 O;  3DS1 A;  1AUM A;  2M8P A;  1A43 A;  1K73 Q;  4GR2 A;  1M74 A;  1N8R Q;  1Q81 Q;  2OTJ P;  1QVF O;  2ONT A;  2JO0 A;  3VRL C;  4XRQ A;  3G1I A;  1YHQ P;  1VQK P;  5F2O A;  1NJI Q;  2CWO A;  4XFY A;  3M1M A;  3CCE P;  3DS4 A;  3H4E A;  2Z45 A;  3CCJ P;  3CCQ P;  4IPY A;  1M90 Q;  5I4T G;  2QA4 P;  1Q86 Q;  4COP A;  1Q82 Q;  2OTL P;  1K9M Q;  3H47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...