2PEMA

Crystal structure of rbcx in complex with substrate
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
110
structure length
110
Chain Sequence
EFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Chaperone
molecule keywords ORF134
total genus 48
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2pemA00
4GR6A 2Z44A 2Z46A 5BS2A 2PEKA 2PEMA 2PEIA 2PENA 2PEOA 2PY8A 3Q20A 2PEJA 3HYBA 3RG6C 5BS1A 2PEQA 2Z45A 4GR2A
chains in the Genus database with same CATH superfamily
1EMVA 2N6YA 1VQOP 1EOQA 1VKUA 4DG9A 2FACA 4BPHA 1Z6MA 2GDYA 3G28A 4PXHB 2N6ZA 3LRYA 2FQ2A 2K2QA 2L0QA 3CCLP 1T8KA 2KGAA 4U0CA 2VSQA 2JU2A 2EFJA 5HVCA 2VLPA 1YJ9P 2WPTA 3B5IA 3CC2P 3Q20A 3U43A 2ERHA 1BXIA 3GZMA 3RG2A 2XZ1C 1VQ8P 2QA4P 1QRJA 1RNIA 1L0HA 1VQ6P 1Q81Q 5EJDA 2AFDA 2K0YA 2FQ1A 1K9MQ 2GZIA 2JYLA 1IUQA 2EHSA 1YITP 1UNKA 3G29A 5KP6B 4H2YC 2CG5B 4HKGA 2K0DX 2AFEA 2KGCA 2L4BA 1N8RQ 5BS2A 2NO8A 3CPWO 1NJIQ 2LTEA 4CA3A 2LPKA 3CCVP 1Q86Q 2KG6A 3G0VA 2EHTA 5EW5E 2QNWA 2VLQA 5DCKA 2FHSC 2Z44A 3MGEA 1M74A 3VRLC 1VQ9P 4R0MA 2LMLA 4U0FA 1ZMBA 2JQ4A 4XROA 1NQ4A 4BPFA 2BHVA 2JBGA 3GKLC 3G6EP 4QNBA 2KR5A 2KWLA 4U0EA 2CWOA 4F37A 2GYKA 1YI2P 1W2BO 4BPGA 2EG5A 1ZNVA 2MVVA 5F2KA 2FQ0A 3E2DA 2PY8A 1YHQP 1QVFO 2XZ0D 1S72P 2KODA 1YIJP 3M1MA 1RO0A 3CCRP 3DS0A 1K8AQ 1Q82Q 2L9FA 2FAEA 3I56P 4PH0A 4COPA 5HGNA 1BAJA 3CD6P 1IMPA 2EIAA 2MD9A 1KQSO 2M5RA 1X3OA 3H4EA 4GR2A 5HGMA 2CQ8A 2PEIA 1YJWP 1VQ5P 4PWVB 1UJZA 3CMAP 2KW2A 1D1DA 2OTJP 2GDXA 2M8PA 2XXMA 3B4QA 4COCA 2L22A 4WYMA 5F2OA 4U0BA 3WBHA 1ACPA 2N5HA 2OARA 1YJNP 4PH1A 2MR7A 1AF8A 4IZ6A 3DS1A 5F2NA 1JJ2O 2VLNA 2QEXP 2MVUA 3DS4A 1GXHA 1M6NA 3H0DA 2DGYA 2N98A 3CMEP 2DNWA 1E0HA 1IMQA 1F80D 2K93A 4U0AA 2JYGA 1GXGA 2KG8A 2GZGA 2LF4A 2OTLP 2Z45A 1VQNP 4IPYA 2CNRA 4M0IA 3GZLA 3CC4P 3LMOA 3G4SP 1Q7YQ 1VQMP 2FADA 3DS2A 3HYBA 4MRTC 2M8LA 1HQBA 5KP8B 1DNYA 1A43A 2P9XA 2K5XA 1RO2A 2BUOA 2N50A 1HY8A 2PNGA 3I55P 2KG9A 4UHPB 4XFXA 4QKOA 3DS3A 2AF8A 2ROQA 3DS5A 3G1IA 2JGPA 2LL8A 2PEJA 3CCEP 3CE7A 1M90Q 1M1KQ 7CEIA 5CZDB 2LOLA 5HGLA 2E1MA 4GR6A 2PEMA 3H47A 1VQLP 2L6EA 1L0IA 2KORA 2X2BA 4XFYA 3G26A 1QVGO 3OW2O 2PEKA 2FVFA 4H2WC 2PEOA 1E6JP 2KGDA 3GJNA 5HGOA 2FVAA 2K92A 2MR8A 1VQKP 3DPHA 2PENA 3CCMP 1KD1Q 2N5IA 3EJEA 5JPAA 2CGQA 3CXCO 2LIUA 3NY7B 3EJBA 2GZFA 3DTJA 1K30A 2JO0A 2KGEA 1GPJA 2JB0A 1CEIA 1KC8Q 1EIAA 1VQPP 2LKIA 2MY5A 1VHNA 2GZEA 1AYIA 3CCUP 2VLOA 1DV5A 2KOOA 4NEOA 2ONTA 3G21A 3CCQP 1VQ7P 2M8NA 1M6EX 2KOPA 4U0DA 3HZQA 2KOQA 2KOSA 2GDWA 4XFZA 4H2XC 3G1GA 2JU1A 2JAZA 1OR5A 2XV6A 2AVAA 5HV8A 5I4TG 2XT1A 2FVEA 2GZJA 1VQ4P 3CC7P 3CCJP 5KP7B 3EJDA 1K73Q 2PEQA 1AUMA 2K0XA 2Z46A 3NTEA 1A8OA 2K94A 1KLPA 3CCSP 3G71P 1FR2A 3RG6C 2MF4A 3P05A 1MZ8A 2LIWA 4XRQA 5BS1A
chains in the Genus database with same CATH topology
5F2NA 1JJ2O 1VQKP 3DPHA 2PENA 3CCMP 2QEXP 1KD1Q 1YI2P 5JPAA 3CXCO 1VQOP 1W2BO 3DS4A 1EOQA 3G28A 2EG5A 3LRYA 1M6NA 3DTJA 3H0DA 2DGYA 1K30A 3CCLP 2JO0A 5F2KA 3CMEP 4U0CA 2EFJA 3E2DA 2PY8A 1YJ9P 1YHQP 1KC8Q 4U0AA 1QVFO 1EIAA 3B5IA 3CC2P 2JYGA 1VQPP 1S72P 3Q20A 2LF4A 2KODA 2OTLP 1YIJP 3CCUP 2Z45A 1VQNP 1VQ8P 2QA4P 4IPYA 1QRJA 4M0IA 1RNIA 1VQ6P 3M1MA 3CC4P 1Q81Q 1RO0A 3CCRP 3G4SP 3DS0A 1K8AQ 1Q7YQ 1Q82Q 1VQMP 3HYBA 3DS2A 3I56P 1K9MQ 2ONTA 4PH0A 2JYLA 2M8LA 3G21A 4COPA 1BAJA 1IUQA 5HGNA 3CD6P 3CCQP 1VQ7P 2M8NA 2EIAA 1YITP 1M6EX 1A43A 3G29A 1KQSO 2P9XA 4U0DA 1RO2A 2BUOA 3I55P 3H4EA 3HZQA 4GR2A 5HGMA 1N8RQ 4XFZA 5BS2A 4XFXA 2PEIA 3CPWO 3G1GA 1YJWP 1NJIQ 1VQ5P 3DS3A 2XV6A 3DS5A 3G1IA 5I4TG 2PEJA 3CMAP 2XT1A 1D1DA 3CCEP 2OTJP 2M8PA 1M90Q 3CCVP 1M1KQ 1VQ4P 2XXMA 3CC7P 3CCJP 5HGLA 2E1MA 4GR6A 4COCA 1Q86Q 2PEMA 3G0VA 4WYMA 3H47A 5F2OA 1K73Q 1VQLP 2L6EA 4U0BA 3WBHA 5DCKA 2PEQA 4XFYA 1AUMA 2Z44A 3G26A 2Z46A 3MGEA 2PEKA 1M74A 3NTEA 3OW2O 1QVGO 1A8OA 3VRLC 2PEOA 1VQ9P 2OARA 1E6JP 3CCSP 5HGOA 3G71P 4U0FA 1ZMBA 4XROA 1YJNP 3RG6C 2BHVA 3P05A 3G6EP 4QNBA 4PH1A 4U0EA 2CWOA 4XRQA 5BS1A 3DS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GR6 A;  2Z44 A;  2Z46 A;  5BS2 A;  2PEK A;  2PEM A;  2PEI A;  2PEN A;  2PEO A;  2PY8 A;  3Q20 A;  2PEJ A;  3HYB A;  3RG6 C;  5BS1 A;  2PEQ A;  2Z45 A;  4GR2 A; 
#chains in the Genus database with same CATH topology
 1EMV A;  2N6Y A;  1VQO P;  1EOQ A;  1VKU A;  4DG9 A;  2FAC A;  4BPH A;  1Z6M A;  2GDY A;  3G28 A;  4PXH B;  2N6Z A;  3LRY A;  2FQ2 A;  2K2Q A;  2L0Q A;  3CCL P;  1T8K A;  2KGA A;  4U0C A;  2VSQ A;  2JU2 A;  2EFJ A;  5HVC A;  2VLP A;  1YJ9 P;  2WPT A;  3B5I A;  3CC2 P;  3Q20 A;  3U43 A;  2ERH A;  1BXI A;  3GZM A;  3RG2 A;  2XZ1 C;  1VQ8 P;  2QA4 P;  1QRJ A;  1RNI A;  1L0H A;  1VQ6 P;  1Q81 Q;  5EJD A;  2AFD A;  2K0Y A;  2FQ1 A;  1K9M Q;  2GZI A;  2JYL A;  1IUQ A;  2EHS A;  1YIT P;  1UNK A;  3G29 A;  5KP6 B;  4H2Y C;  2CG5 B;  4HKG A;  2K0D X;  2AFE A;  2KGC A;  2L4B A;  1N8R Q;  5BS2 A;  2NO8 A;  3CPW O;  1NJI Q;  2LTE A;  4CA3 A;  2LPK A;  3CCV P;  1Q86 Q;  2KG6 A;  3G0V A;  2EHT A;  5EW5 E;  2QNW A;  2VLQ A;  5DCK A;  2FHS C;  2Z44 A;  3MGE A;  1M74 A;  3VRL C;  1VQ9 P;  4R0M A;  2LML A;  4U0F A;  1ZMB A;  2JQ4 A;  4XRO A;  1NQ4 A;  4BPF A;  2BHV A;  2JBG A;  3GKL C;  3G6E P;  4QNB A;  2KR5 A;  2KWL A;  4U0E A;  2CWO A;  4F37 A;  2GYK A;  1YI2 P;  1W2B O;  4BPG A;  2EG5 A;  1ZNV A;  2MVV A;  5F2K A;  2FQ0 A;  3E2D A;  2PY8 A;  1YHQ P;  1QVF O;  2XZ0 D;  1S72 P;  2KOD A;  1YIJ P;  3M1M A;  1RO0 A;  3CCR P;  3DS0 A;  1K8A Q;  1Q82 Q;  2L9F A;  2FAE A;  3I56 P;  4PH0 A;  4COP A;  5HGN A;  1BAJ A;  3CD6 P;  1IMP A;  2EIA A;  2MD9 A;  1KQS O;  2M5R A;  1X3O A;  3H4E A;  4GR2 A;  5HGM A;  2CQ8 A;  2PEI A;  1YJW P;  1VQ5 P;  4PWV B;  1UJZ A;  3CMA P;  2KW2 A;  1D1D A;  2OTJ P;  2GDX A;  2M8P A;  2XXM A;  3B4Q A;  4COC A;  2L22 A;  4WYM A;  5F2O A;  4U0B A;  3WBH A;  1ACP A;  2N5H A;  2OAR A;  1YJN P;  4PH1 A;  2MR7 A;  1AF8 A;  4IZ6 A;  3DS1 A;  5F2N A;  1JJ2 O;  2VLN A;  2QEX P;  2MVU A;  3DS4 A;  1GXH A;  1M6N A;  3H0D A;  2DGY A;  2N98 A;  3CME P;  2DNW A;  1E0H A;  1IMQ A;  1F80 D;  2K93 A;  4U0A A;  2JYG A;  1GXG A;  2KG8 A;  2GZG A;  2LF4 A;  2OTL P;  2Z45 A;  1VQN P;  4IPY A;  2CNR A;  4M0I A;  3GZL A;  3CC4 P;  3LMO A;  3G4S P;  1Q7Y Q;  1VQM P;  2FAD A;  3DS2 A;  3HYB A;  4MRT C;  2M8L A;  1HQB A;  5KP8 B;  1DNY A;  1A43 A;  2P9X A;  2K5X A;  1RO2 A;  2BUO A;  2N50 A;  1HY8 A;  2PNG A;  3I55 P;  2KG9 A;  4UHP B;  4XFX A;  4QKO A;  3DS3 A;  2AF8 A;  2ROQ A;  3DS5 A;  3G1I A;  2JGP A;  2LL8 A;  2PEJ A;  3CCE P;  3CE7 A;  1M90 Q;  1M1K Q;  7CEI A;  5CZD B;  2LOL A;  5HGL A;  2E1M A;  4GR6 A;  2PEM A;  3H47 A;  1VQL P;  2L6E A;  1L0I A;  2KOR A;  2X2B A;  4XFY A;  3G26 A;  1QVG O;  3OW2 O;  2PEK A;  2FVF A;  4H2W C;  2PEO A;  1E6J P;  2KGD A;  3GJN A;  5HGO A;  2FVA A;  2K92 A;  2MR8 A;  1VQK P;  3DPH A;  2PEN A;  3CCM P;  1KD1 Q;  2N5I A;  3EJE A;  5JPA A;  2CGQ A;  3CXC O;  2LIU A;  3NY7 B;  3EJB A;  2GZF A;  3DTJ A;  1K30 A;  2JO0 A;  2KGE A;  1GPJ A;  2JB0 A;  1CEI A;  1KC8 Q;  1EIA A;  1VQP P;  2LKI A;  2MY5 A;  1VHN A;  2GZE A;  1AYI A;  3CCU P;  2VLO A;  1DV5 A;  2KOO A;  4NEO A;  2ONT A;  3G21 A;  3CCQ P;  1VQ7 P;  2M8N A;  1M6E X;  2KOP A;  4U0D A;  3HZQ A;  2KOQ A;  2KOS A;  2GDW A;  4XFZ A;  4H2X C;  3G1G A;  2JU1 A;  2JAZ A;  1OR5 A;  2XV6 A;  2AVA A;  5HV8 A;  5I4T G;  2XT1 A;  2FVE A;  2GZJ A;  1VQ4 P;  3CC7 P;  3CCJ P;  5KP7 B;  3EJD A;  1K73 Q;  2PEQ A;  1AUM A;  2K0X A;  2Z46 A;  3NTE A;  1A8O A;  2K94 A;  1KLP A;  3CCS P;  3G71 P;  1FR2 A;  3RG6 C;  2MF4 A;  3P05 A;  1MZ8 A;  2LIW A;  4XRQ A;  5BS1 A; 
#chains in the Genus database with same CATH homology
 5F2N A;  1JJ2 O;  1VQK P;  3DPH A;  2PEN A;  3CCM P;  2QEX P;  1KD1 Q;  1YI2 P;  5JPA A;  3CXC O;  1VQO P;  1W2B O;  3DS4 A;  1EOQ A;  3G28 A;  2EG5 A;  3LRY A;  1M6N A;  3DTJ A;  3H0D A;  2DGY A;  1K30 A;  3CCL P;  2JO0 A;  5F2K A;  3CME P;  4U0C A;  2EFJ A;  3E2D A;  2PY8 A;  1YJ9 P;  1YHQ P;  1KC8 Q;  4U0A A;  1QVF O;  1EIA A;  3B5I A;  3CC2 P;  2JYG A;  1VQP P;  1S72 P;  3Q20 A;  2LF4 A;  2KOD A;  2OTL P;  1YIJ P;  3CCU P;  2Z45 A;  1VQN P;  1VQ8 P;  2QA4 P;  4IPY A;  1QRJ A;  4M0I A;  1RNI A;  1VQ6 P;  3M1M A;  3CC4 P;  1Q81 Q;  1RO0 A;  3CCR P;  3G4S P;  3DS0 A;  1K8A Q;  1Q7Y Q;  1Q82 Q;  1VQM P;  3HYB A;  3DS2 A;  3I56 P;  1K9M Q;  2ONT A;  4PH0 A;  2JYL A;  2M8L A;  3G21 A;  4COP A;  1BAJ A;  1IUQ A;  5HGN A;  3CD6 P;  3CCQ P;  1VQ7 P;  2M8N A;  2EIA A;  1YIT P;  1M6E X;  1A43 A;  3G29 A;  1KQS O;  2P9X A;  4U0D A;  1RO2 A;  2BUO A;  3I55 P;  3H4E A;  3HZQ A;  4GR2 A;  5HGM A;  1N8R Q;  4XFZ A;  5BS2 A;  4XFX A;  2PEI A;  3CPW O;  3G1G A;  1YJW P;  1NJI Q;  1VQ5 P;  3DS3 A;  2XV6 A;  3DS5 A;  3G1I A;  5I4T G;  2PEJ A;  3CMA P;  2XT1 A;  1D1D A;  3CCE P;  2OTJ P;  2M8P A;  1M90 Q;  3CCV P;  1M1K Q;  1VQ4 P;  2XXM A;  3CC7 P;  3CCJ P;  5HGL A;  2E1M A;  4GR6 A;  4COC A;  1Q86 Q;  2PEM A;  3G0V A;  4WYM A;  3H47 A;  5F2O A;  1K73 Q;  1VQL P;  2L6E A;  4U0B A;  3WBH A;  5DCK A;  2PEQ A;  4XFY A;  1AUM A;  2Z44 A;  3G26 A;  2Z46 A;  3MGE A;  2PEK A;  1M74 A;  3NTE A;  3OW2 O;  1QVG O;  1A8O A;  3VRL C;  2PEO A;  1VQ9 P;  2OAR A;  1E6J P;  3CCS P;  5HGO A;  3G71 P;  4U0F A;  1ZMB A;  4XRO A;  1YJN P;  3RG6 C;  2BHV A;  3P05 A;  3G6E P;  4QNB A;  4PH1 A;  4U0E A;  2CWO A;  4XRQ A;  5BS1 A;  3DS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...