2PEMA

Crystal structure of rbcx in complex with substrate
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
110
structure length
110
Chain Sequence
EFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Chaperone
molecule keywords ORF134
total genus 48
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2pemA00
3HYBA 2PEIA 2PEJA 2PEMA 2PENA 2PY8A 3RG6C 5BS2A 5BS1A 2PEQA 2PEOA 3Q20A 2Z44A 2PEKA 4GR6A 2Z46A 4GR2A 2Z45A
chains in the Genus database with same CATH superfamily
4H2XC 3P05A 2XV6A 1D1DA 3HYBA 3CCUP 2PEQA 2M8LA 1Z6MA 2GZJA 2LF4A 2KG6A 4XFYA 2K94A 3EJDA 3G29A 3CE7A 2M8NA 3DTJA 3G71P 1QVGO 3GKLC 2LMLA 2KODA 3DS0A 4IZ6A 4H2YC 5F2NA 5DCKA 4BPGA 1KD1Q 2EHTA 2GZIA 3B5IA 4U0CA 4U0EA 2MR7A 1YIJP 2FAEA 2K5XA 2X2BA 3CCQP 4QKOA 2Z44A 5HGOA 2EIAA 2N50A 4U0DA 1EOQA 1S72P 2LIUA 2PEIA 2KOQA 2FQ2A 1X3OA 2WPTA 2PEKA 3U43A 5KP6B 1AF8A 2K0XA 1FR2A 5HV8A 1ZNVA 4HKGA 2K0DX 2MVUA 4CA3A 2KOPA 3EJEA 2M5RA 2CWOA 1EMVA 1QRJA 1VQ6P 1N8RQ 2QEXP 1ZMBA 1BXIA 2LPKA 1YHQP 1Q82Q 2XZ1C 2AFEA 2AFDA 2VLOA 2EG5A 2L9FA 2FQ0A 2MD9A 3CXCO 4XRQA 3CCEP 2ERHA 4COPA 2GZGA 2JGPA 3GZMA 3MGEA 1DV5A 1NQ4A 1VQ8P 3G6EP 3B4QA 3DS3A 3M1MA 1UJZA 3DPHA 5I4TG 2PEJA 2JAZA 3Q20A 3CC2P 2FQ1A 2PNGA 2EFJA 1VQLP 3NY7B 1VQNP 1M6NA 2CQ8A 2KGCA 2KGAA 3G28A 1RO2A 2XT1A 7CEIA 3HZQA 1HQBA 1K8AQ 3E2DA 2VLPA 3OW2O 4QNBA 2CGQA 2NO8A 4MRTC 1L0IA 1A8OA 5KP7B 2JB0A 1VQKP 2AVAA 1KQSO 2OTJP 1VQ5P 3LRYA 1YITP 1Q81Q 5BS1A 3CCVP 4R0MA 4U0BA 4PWVB 1VQOP 2L22A 1KLPA 2E1MA 2KOOA 1RO0A 1E0HA 2XXMA 1NJIQ 2LL8A 3CMAP 2OTLP 4H2WC 3CD6P 2KG8A 2GDWA 2PEOA 1DNYA 2LIWA 1YJWP 2N5IA 2K92A 5KP8B 3DS4A 2L0QA 1VQ7P 1GXHA 2BHVA 2GZEA 2PEMA 1M6EX 2DGYA 2JYGA 4BPFA 1VQPP 4XFZA 2JBGA 2JO0A 2MVVA 2Z46A 2KG9A 2FVAA 5HGNA 2PY8A 4WYMA 2LTEA 3DS2A 2GDYA 1K30A 2EHSA 4BPHA 2M8PA 3LMOA 2VLQA 4M0IA 1MZ8A 3CC7P 2K0YA 5BS2A 3G1IA 2QNWA 2KGEA 1W2BO 1IMQA 4U0AA 3RG6C 2KR5A 1IUQA 1M90Q 3H47A 1JJ2O 3EJBA 1CEIA 4UHPB 1UNKA 1Q86Q 3DS5A 1K73Q 1K9MQ 3DS1A 2QA4P 3CCSP 2FHSC 2LOLA 5HVCA 2N6YA 2JYLA 3G1GA 2OARA 2VLNA 4GR2A 2XZ0D 3G21A 2N98A 3CCRP 1RNIA 2DNWA 1EIAA 1VQ4P 5EW5E 3NTEA 3I55P 2LKIA 1VQMP 4COCA 2KOSA 3GZLA 2Z45A 2N5HA 2KORA 1L0HA 3G4SP 4IPYA 1GPJA 2MY5A 2BUOA 4PH1A 3H0DA 1KC8Q 1IMPA 1GXGA 4XFXA 3VRLC 1AUMA 5CZDB 2P9XA 2GZFA 2CG5B 3RG2A 4DG9A 5HGLA 2AF8A 1M1KQ 2JQ4A 4PH0A 2CNRA 2L6EA 2VSQA 4F37A 1VKUA 2GYKA 1AYIA 4XROA 1YJ9P 2FADA 2N6ZA 3H4EA 1BAJA 1YJNP 5JPAA 3CMEP 2K93A 1E6JP 2GDXA 4PXHB 3CPWO 1VQ9P 2MF4A 5F2KA 2PENA 1QVFO 2FVEA 3CCLP 1YI2P 2ONTA 5HGMA 1HY8A 3I56P 4GR6A 1M74A 2MR8A 1T8KA 2ROQA 3CC4P 2JU2A 2FACA 2FVFA 2KWLA 2K2QA 3CCMP 4NEOA 4U0FA 1F80D 3CCJP 3G26A 3GJNA 2JU1A 5EJDA 1ACPA 2KGDA 5F2OA 1A43A 3WBHA 3G0VA 1OR5A 2KW2A 1Q7YQ 2L4BA 1VHNA
chains in the Genus database with same CATH topology
1YJWP 3DS4A 3CXCO 4XRQA 3CCEP 3P05A 3G4SP 4IPYA 1VQ7P 2XV6A 1D1DA 4COPA 2BHVA 3HYBA 2PEMA 1M6EX 2DGYA 2JYGA 3CCUP 2BUOA 4PH1A 4XFZA 3MGEA 2PEQA 3H0DA 1VQPP 1KC8Q 2JO0A 1VQ8P 2M8LA 4XFXA 3G6EP 2Z46A 3VRLC 1AUMA 2LF4A 2P9XA 3DS3A 3M1MA 5HGNA 3DPHA 5HGLA 5I4TG 4XFYA 1M1KQ 2PEJA 2PY8A 4WYMA 4PH0A 3DS2A 3Q20A 3CC2P 2L6EA 3G29A 1QVGO 2M8NA 3DTJA 3G71P 1K30A 2EFJA 2KODA 1VQLP 1VQNP 1M6NA 3DS0A 4XROA 2M8PA 5F2NA 3G28A 1YJ9P 5DCKA 1RO2A 2XT1A 4M0IA 3HZQA 3CC7P 1KD1Q 3H4EA 1K8AQ 5BS2A 1BAJA 3E2DA 3B5IA 3G1IA 1YJNP 1W2BO 4U0CA 3OW2O 4U0EA 4U0AA 5JPAA 1YIJP 4QNBA 3RG6C 3CMEP 1IUQA 1M90Q 3H47A 1E6JP 1JJ2O 3CCQP 1A8OA 2Z44A 5HGOA 3CPWO 1VQ9P 2EIAA 4U0DA 5F2KA 2PENA 1EOQA 1Q86Q 1S72P 1QVFO 1VQKP 1KQSO 3DS5A 1K73Q 2OTJP 1K9MQ 3DS1A 2QA4P 3CCSP 2PEIA 1VQ5P 3CCLP 3LRYA 1YI2P 2ONTA 5HGMA 1YITP 3I56P 2PEKA 4GR6A 1M74A 1Q81Q 2JYLA 3CC4P 5BS1A 3G1GA 2OARA 3CCVP 4U0BA 4GR2A 3G21A 3CCRP 1RNIA 3CCMP 1VQOP 4U0FA 3CCJP 2CWOA 2E1MA 3G26A 1EIAA 1QRJA 1VQ6P 1N8RQ 1RO0A 2QEXP 1VQ4P 1ZMBA 2XXMA 3NTEA 1NJIQ 3CMAP 1YHQP 2OTLP 1Q82Q 3I55P 5F2OA 3CD6P 1A43A 3WBHA 3G0VA 1VQMP 4COCA 2PEOA 1Q7YQ 2EG5A 2Z45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HYB A;  2PEI A;  2PEJ A;  2PEM A;  2PEN A;  2PY8 A;  3RG6 C;  5BS2 A;  5BS1 A;  2PEQ A;  2PEO A;  3Q20 A;  2Z44 A;  2PEK A;  4GR6 A;  2Z46 A;  4GR2 A;  2Z45 A; 
#chains in the Genus database with same CATH topology
 4H2X C;  3P05 A;  2XV6 A;  1D1D A;  3HYB A;  3CCU P;  2PEQ A;  2M8L A;  1Z6M A;  2GZJ A;  2LF4 A;  2KG6 A;  4XFY A;  2K94 A;  3EJD A;  3G29 A;  3CE7 A;  2M8N A;  3DTJ A;  3G71 P;  1QVG O;  3GKL C;  2LML A;  2KOD A;  3DS0 A;  4IZ6 A;  4H2Y C;  5F2N A;  5DCK A;  4BPG A;  1KD1 Q;  2EHT A;  2GZI A;  3B5I A;  4U0C A;  4U0E A;  2MR7 A;  1YIJ P;  2FAE A;  2K5X A;  2X2B A;  3CCQ P;  4QKO A;  2Z44 A;  5HGO A;  2EIA A;  2N50 A;  4U0D A;  1EOQ A;  1S72 P;  2LIU A;  2PEI A;  2KOQ A;  2FQ2 A;  1X3O A;  2WPT A;  2PEK A;  3U43 A;  5KP6 B;  1AF8 A;  2K0X A;  1FR2 A;  5HV8 A;  1ZNV A;  4HKG A;  2K0D X;  2MVU A;  4CA3 A;  2KOP A;  3EJE A;  2M5R A;  2CWO A;  1EMV A;  1QRJ A;  1VQ6 P;  1N8R Q;  2QEX P;  1ZMB A;  1BXI A;  2LPK A;  1YHQ P;  1Q82 Q;  2XZ1 C;  2AFE A;  2AFD A;  2VLO A;  2EG5 A;  2L9F A;  2FQ0 A;  2MD9 A;  3CXC O;  4XRQ A;  3CCE P;  2ERH A;  4COP A;  2GZG A;  2JGP A;  3GZM A;  3MGE A;  1DV5 A;  1NQ4 A;  1VQ8 P;  3G6E P;  3B4Q A;  3DS3 A;  3M1M A;  1UJZ A;  3DPH A;  5I4T G;  2PEJ A;  2JAZ A;  3Q20 A;  3CC2 P;  2FQ1 A;  2PNG A;  2EFJ A;  1VQL P;  3NY7 B;  1VQN P;  1M6N A;  2CQ8 A;  2KGC A;  2KGA A;  3G28 A;  1RO2 A;  2XT1 A;  7CEI A;  3HZQ A;  1HQB A;  1K8A Q;  3E2D A;  2VLP A;  3OW2 O;  4QNB A;  2CGQ A;  2NO8 A;  4MRT C;  1L0I A;  1A8O A;  5KP7 B;  2JB0 A;  1VQK P;  2AVA A;  1KQS O;  2OTJ P;  1VQ5 P;  3LRY A;  1YIT P;  1Q81 Q;  5BS1 A;  3CCV P;  4R0M A;  4U0B A;  4PWV B;  1VQO P;  2L22 A;  1KLP A;  2E1M A;  2KOO A;  1RO0 A;  1E0H A;  2XXM A;  1NJI Q;  2LL8 A;  3CMA P;  2OTL P;  4H2W C;  3CD6 P;  2KG8 A;  2GDW A;  2PEO A;  1DNY A;  2LIW A;  1YJW P;  2N5I A;  2K92 A;  5KP8 B;  3DS4 A;  2L0Q A;  1VQ7 P;  1GXH A;  2BHV A;  2GZE A;  2PEM A;  1M6E X;  2DGY A;  2JYG A;  4BPF A;  1VQP P;  4XFZ A;  2JBG A;  2JO0 A;  2MVV A;  2Z46 A;  2KG9 A;  2FVA A;  5HGN A;  2PY8 A;  4WYM A;  2LTE A;  3DS2 A;  2GDY A;  1K30 A;  2EHS A;  4BPH A;  2M8P A;  3LMO A;  2VLQ A;  4M0I A;  1MZ8 A;  3CC7 P;  2K0Y A;  5BS2 A;  3G1I A;  2QNW A;  2KGE A;  1W2B O;  1IMQ A;  4U0A A;  3RG6 C;  2KR5 A;  1IUQ A;  1M90 Q;  3H47 A;  1JJ2 O;  3EJB A;  1CEI A;  4UHP B;  1UNK A;  1Q86 Q;  3DS5 A;  1K73 Q;  1K9M Q;  3DS1 A;  2QA4 P;  3CCS P;  2FHS C;  2LOL A;  5HVC A;  2N6Y A;  2JYL A;  3G1G A;  2OAR A;  2VLN A;  4GR2 A;  2XZ0 D;  3G21 A;  2N98 A;  3CCR P;  1RNI A;  2DNW A;  1EIA A;  1VQ4 P;  5EW5 E;  3NTE A;  3I55 P;  2LKI A;  1VQM P;  4COC A;  2KOS A;  3GZL A;  2Z45 A;  2N5H A;  2KOR A;  1L0H A;  3G4S P;  4IPY A;  1GPJ A;  2MY5 A;  2BUO A;  4PH1 A;  3H0D A;  1KC8 Q;  1IMP A;  1GXG A;  4XFX A;  3VRL C;  1AUM A;  5CZD B;  2P9X A;  2GZF A;  2CG5 B;  3RG2 A;  4DG9 A;  5HGL A;  2AF8 A;  1M1K Q;  2JQ4 A;  4PH0 A;  2CNR A;  2L6E A;  2VSQ A;  4F37 A;  1VKU A;  2GYK A;  1AYI A;  4XRO A;  1YJ9 P;  2FAD A;  2N6Z A;  3H4E A;  1BAJ A;  1YJN P;  5JPA A;  3CME P;  2K93 A;  1E6J P;  2GDX A;  4PXH B;  3CPW O;  1VQ9 P;  2MF4 A;  5F2K A;  2PEN A;  1QVF O;  2FVE A;  3CCL P;  1YI2 P;  2ONT A;  5HGM A;  1HY8 A;  3I56 P;  4GR6 A;  1M74 A;  2MR8 A;  1T8K A;  2ROQ A;  3CC4 P;  2JU2 A;  2FAC A;  2FVF A;  2KWL A;  2K2Q A;  3CCM P;  4NEO A;  4U0F A;  1F80 D;  3CCJ P;  3G26 A;  3GJN A;  2JU1 A;  5EJD A;  1ACP A;  2KGD A;  5F2O A;  1A43 A;  3WBH A;  3G0V A;  1OR5 A;  2KW2 A;  1Q7Y Q;  2L4B A;  1VHN A; 
#chains in the Genus database with same CATH homology
 1YJW P;  3DS4 A;  3CXC O;  4XRQ A;  3CCE P;  3P05 A;  3G4S P;  4IPY A;  1VQ7 P;  2XV6 A;  1D1D A;  4COP A;  2BHV A;  3HYB A;  2PEM A;  1M6E X;  2DGY A;  2JYG A;  3CCU P;  2BUO A;  4PH1 A;  4XFZ A;  3MGE A;  2PEQ A;  3H0D A;  1VQP P;  1KC8 Q;  2JO0 A;  1VQ8 P;  2M8L A;  4XFX A;  3G6E P;  2Z46 A;  3VRL C;  1AUM A;  2LF4 A;  2P9X A;  3DS3 A;  3M1M A;  5HGN A;  3DPH A;  5HGL A;  5I4T G;  4XFY A;  1M1K Q;  2PEJ A;  2PY8 A;  4WYM A;  4PH0 A;  3DS2 A;  3Q20 A;  3CC2 P;  2L6E A;  3G29 A;  1QVG O;  2M8N A;  3DTJ A;  3G71 P;  1K30 A;  2EFJ A;  2KOD A;  1VQL P;  1VQN P;  1M6N A;  3DS0 A;  4XRO A;  2M8P A;  5F2N A;  3G28 A;  1YJ9 P;  5DCK A;  1RO2 A;  2XT1 A;  4M0I A;  3HZQ A;  3CC7 P;  1KD1 Q;  3H4E A;  1K8A Q;  5BS2 A;  1BAJ A;  3E2D A;  3B5I A;  3G1I A;  1YJN P;  1W2B O;  4U0C A;  3OW2 O;  4U0E A;  4U0A A;  5JPA A;  1YIJ P;  4QNB A;  3RG6 C;  3CME P;  1IUQ A;  1M90 Q;  3H47 A;  1E6J P;  1JJ2 O;  3CCQ P;  1A8O A;  2Z44 A;  5HGO A;  3CPW O;  1VQ9 P;  2EIA A;  4U0D A;  5F2K A;  2PEN A;  1EOQ A;  1Q86 Q;  1S72 P;  1QVF O;  1VQK P;  1KQS O;  3DS5 A;  1K73 Q;  2OTJ P;  1K9M Q;  3DS1 A;  2QA4 P;  3CCS P;  2PEI A;  1VQ5 P;  3CCL P;  3LRY A;  1YI2 P;  2ONT A;  5HGM A;  1YIT P;  3I56 P;  2PEK A;  4GR6 A;  1M74 A;  1Q81 Q;  2JYL A;  3CC4 P;  5BS1 A;  3G1G A;  2OAR A;  3CCV P;  4U0B A;  4GR2 A;  3G21 A;  3CCR P;  1RNI A;  3CCM P;  1VQO P;  4U0F A;  3CCJ P;  2CWO A;  2E1M A;  3G26 A;  1EIA A;  1QRJ A;  1VQ6 P;  1N8R Q;  1RO0 A;  2QEX P;  1VQ4 P;  1ZMB A;  2XXM A;  3NTE A;  1NJI Q;  3CMA P;  1YHQ P;  2OTL P;  1Q82 Q;  3I55 P;  5F2O A;  3CD6 P;  1A43 A;  3WBH A;  3G0V A;  1VQM P;  4COC A;  2PEO A;  1Q7Y Q;  2EG5 A;  2Z45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...