2PEMA

Crystal structure of rbcx in complex with substrate
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
110
structure length
110
Chain Sequence
EFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 48
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2pemA00
5BS2A 2PEQA 3HYBA 4GR6A 2PEKA 2Z45A 3Q20A 4GR2A 2PEJA 2PEOA 3RG6C 5BS1A 2PEMA 2Z44A 2PY8A 2Z46A 2PEIA 2PENA
chains in the Genus database with same CATH superfamily
1VQPP 4U0EA 1IMPA 5KP6B 5JPAA 2PEMA 2GDYA 1BXIA 2K0YA 4XFZA 3G1GA 1VQ9P 1UNKA 1VQOP 2K5XA 2P9XA 2FQ0A 2LPKA 2JYGA 2GZFA 2KG8A 4COPA 1Q82Q 2N5HA 1Q7YQ 1N8RQ 5KP7B 1VHNA 1K30A 3OW2O 2PEKA 4U0DA 2L22A 1UJZA 2KOQA 2KWLA 2FVAA 3GZLA 2KOOA 3CCLP 3G4SP 3CCQP 2JBGA 2JB0A 2NO8A 1KD1Q 2GDWA 4XRQA 2MR7A 1A43A 3CE7A 1F80D 2K0DX 3DTJA 1Q86Q 3HYBA 2QEXP 1M6EX 3G21A 5EW5E 3CC4P 2BHVA 1AYIA 2EHTA 4QNBA 2CG5B 4QKOA 3EJBA 4U0FA 1VQLP 2LMLA 1W2BO 2QA4P 2AVAA 2N6ZA 3CCMP 2FVFA 2PEOA 1HY8A 2LOLA 3DS0A 2M5RA 5HGNA 1X3OA 1MZ8A 2VLOA 2N50A 4PWVB 4XROA 4WYMA 3LRYA 1S72P 2MY5A 2FQ1A 2CNRA 5F2NA 5I4TG 1DV5A 4MRTC 2EHSA 3RG2A 2FACA 2K2QA 1YIJP 3DS4A 2FQ2A 5HGOA 3CMAP 4IPYA 1VQMP 1YJWP 2XT1A 2VLNA 2GZEA 4NEOA 5F2KA 2K93A 3E2DA 2DNWA 2XZ0D 3B4QA 2QNWA 3RG6C 2VLQA 2GZJA 2XZ1C 2PEIA 5HVCA 4M0IA 5CZDB 3CXCO 1L0HA 3G29A 1YI2P 4F37A 2KG6A 2MD9A 1NJIQ 4XFXA 2N98A 4CA3A 3GZMA 5F2OA 3LMOA 3M1MA 2MVVA 2M8PA 5HGMA 1GXHA 2KOPA 5EJDA 5KP8B 1L0IA 2VLPA 1QVFO 2M8NA 2CGQA 1HQBA 4GR6A 1JJ2O 2JO0A 3G71P 1M90Q 4R0MA 2GYKA 3G1IA 3NTEA 4PH0A 3I55P 3CCRP 2JGPA 1Q81Q 2KGDA 1AF8A 1RNIA 1BAJA 1VKUA 2Z46A 1M6NA 2GDXA 1VQKP 3G0VA 3P05A 2BUOA 4IZ6A 4BPGA 2ERHA 1YITP 1YHQP 5DCKA 3CCEP 1ZMBA 4PH1A 1VQ8P 2XV6A 1YJ9P 2KODA 2JU2A 4UHPB 3VRLC 3DS2A 4PXHB 2MF4A 4U0CA 1IUQA 2JAZA 2CWOA 3EJDA 2AFDA 2ONTA 1VQ4P 2KR5A 2LIWA 2L6EA 2JQ4A 1EOQA 1AUMA 2K0XA 2CQ8A 2LTEA 2KG9A 2MVUA 2OTJP 1K8AQ 3HZQA 2EIAA 1FR2A 2FHSC 1D1DA 5HGLA 5BS2A 1OR5A 2LKIA 2X2BA 3I56P 2KGEA 2KGCA 2L9FA 1Z6MA 3H47A 2LL8A 2OARA 2N6YA 1E0HA 4XFYA 2FVEA 3DS5A 1VQNP 1VQ7P 3GJNA 2FADA 2KORA 1CEIA 1GPJA 3NY7B 1GXGA 2N5IA 7CEIA 2AFEA 2LF4A 3CC7P 2LIUA 3Q20A 1ACPA 3CPWO 1QVGO 4GR2A 1E6JP 4COCA 1ZNVA 4HKGA 1EIAA 2PNGA 5BS1A 1M74A 2L4BA 4DG9A 3H0DA 4H2WC 2K94A 1M1KQ 2E1MA 3EJEA 3GKLC 4U0BA 1K73Q 2JU1A 1KLPA 3G28A 3B5IA 2EG5A 2JYLA 2PEQA 3CCUP 3U43A 1QRJA 1IMQA 2GZIA 3WBHA 1KQSO 2L0QA 4U0AA 3CCJP 2VSQA 2EFJA 1A8OA 1T8KA 2KW2A 5HV8A 3DPHA 2DGYA 2FAEA 1EMVA 2K92A 1RO2A 2PENA 2ROQA 2OTLP 2Z45A 2PEJA 2PY8A 2KOSA 3CCVP 4H2XC 2GZGA 3H4EA 3G6EP 3MGEA 2M8LA 2Z44A 1RO0A 1VQ6P 3CCSP 3CD6P 3CMEP 1YJNP 1K9MQ 1KC8Q 1DNYA 2WPTA 3CC2P 3DS1A 4BPFA 2KGAA 1NQ4A 1VQ5P 2MR8A 4H2YC 3G26A 3DS3A 2AF8A 2XXMA 4BPHA
chains in the Genus database with same CATH topology
3CC7P 1VQPP 1RNIA 3Q20A 1BAJA 4XROA 4U0EA 4WYMA 3LRYA 3CPWO 1S72P 1QVGO 2Z46A 1M6NA 4GR2A 5F2NA 1VQKP 3G0VA 3P05A 5JPAA 1E6JP 2BUOA 4COCA 2PEMA 5I4TG 1YITP 1EIAA 4XFZA 3G1GA 1YHQP 1VQ9P 5DCKA 5BS1A 1VQOP 3CCEP 1ZMBA 1M74A 4PH1A 2P9XA 1VQ8P 3H0DA 2JYGA 2XV6A 1YIJP 3DS4A 1YJ9P 3CMAP 5HGOA 1M1KQ 2E1MA 4IPYA 1VQMP 2KODA 3VRLC 1YJWP 2XT1A 4U0BA 1K73Q 3DS2A 4U0CA 1IUQA 3G28A 4COPA 3B5IA 1Q82Q 5F2KA 2CWOA 2EG5A 2JYLA 3E2DA 2PEQA 1Q7YQ 3CCUP 3RG6C 2ONTA 1VQ4P 1QRJA 1N8RQ 1K30A 2L6EA 2PEIA 3WBHA 3OW2O 1KQSO 4M0IA 2PEKA 4U0DA 1EOQA 4U0AA 3CCJP 2EFJA 3CXCO 1AUMA 1A8OA 3G29A 1YI2P 3DPHA 2DGYA 1NJIQ 4XFXA 2OTJP 1K8AQ 3CCLP 3HZQA 2EIAA 3G4SP 3CCQP 5F2OA 1D1DA 5HGLA 1RO2A 2PENA 5BS2A 3M1MA 1KD1Q 2OTLP 2Z45A 2PEJA 4XRQA 3I56P 2PY8A 2M8PA 5HGMA 1A43A 3DTJA 1Q86Q 3HYBA 2QEXP 1M6EX 3CCVP 3G21A 3CC4P 3H4EA 1QVFO 2BHVA 2M8NA 3G6EP 3MGEA 2M8LA 2Z44A 1RO0A 1VQ6P 3CCSP 3CD6P 3H47A 4QNBA 3CMEP 1YJNP 2OARA 4U0FA 4GR6A 1JJ2O 2JO0A 3G71P 1KC8Q 1K9MQ 1VQLP 3CC2P 1M90Q 4XFYA 1W2BO 3DS1A 3DS5A 2QA4P 1VQ7P 1VQNP 3G1IA 3CCMP 3NTEA 2PEOA 1VQ5P 4PH0A 3I55P 3G26A 3DS0A 3DS3A 5HGNA 2LF4A 2XXMA 3CCRP 1Q81Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BS2 A;  2PEQ A;  3HYB A;  4GR6 A;  2PEK A;  2Z45 A;  3Q20 A;  4GR2 A;  2PEJ A;  2PEO A;  3RG6 C;  5BS1 A;  2PEM A;  2Z44 A;  2PY8 A;  2Z46 A;  2PEI A;  2PEN A; 
#chains in the Genus database with same CATH topology
 1VQP P;  4U0E A;  1IMP A;  5KP6 B;  5JPA A;  2PEM A;  2GDY A;  1BXI A;  2K0Y A;  4XFZ A;  3G1G A;  1VQ9 P;  1UNK A;  1VQO P;  2K5X A;  2P9X A;  2FQ0 A;  2LPK A;  2JYG A;  2GZF A;  2KG8 A;  4COP A;  1Q82 Q;  2N5H A;  1Q7Y Q;  1N8R Q;  5KP7 B;  1VHN A;  1K30 A;  3OW2 O;  2PEK A;  4U0D A;  2L22 A;  1UJZ A;  2KOQ A;  2KWL A;  2FVA A;  3GZL A;  2KOO A;  3CCL P;  3G4S P;  3CCQ P;  2JBG A;  2JB0 A;  2NO8 A;  1KD1 Q;  2GDW A;  4XRQ A;  2MR7 A;  1A43 A;  3CE7 A;  1F80 D;  2K0D X;  3DTJ A;  1Q86 Q;  3HYB A;  2QEX P;  1M6E X;  3G21 A;  5EW5 E;  3CC4 P;  2BHV A;  1AYI A;  2EHT A;  4QNB A;  2CG5 B;  4QKO A;  3EJB A;  4U0F A;  1VQL P;  2LML A;  1W2B O;  2QA4 P;  2AVA A;  2N6Z A;  3CCM P;  2FVF A;  2PEO A;  1HY8 A;  2LOL A;  3DS0 A;  2M5R A;  5HGN A;  1X3O A;  1MZ8 A;  2VLO A;  2N50 A;  4PWV B;  4XRO A;  4WYM A;  3LRY A;  1S72 P;  2MY5 A;  2FQ1 A;  2CNR A;  5F2N A;  5I4T G;  1DV5 A;  4MRT C;  2EHS A;  3RG2 A;  2FAC A;  2K2Q A;  1YIJ P;  3DS4 A;  2FQ2 A;  5HGO A;  3CMA P;  4IPY A;  1VQM P;  1YJW P;  2XT1 A;  2VLN A;  2GZE A;  4NEO A;  5F2K A;  2K93 A;  3E2D A;  2DNW A;  2XZ0 D;  3B4Q A;  2QNW A;  3RG6 C;  2VLQ A;  2GZJ A;  2XZ1 C;  2PEI A;  5HVC A;  4M0I A;  5CZD B;  3CXC O;  1L0H A;  3G29 A;  1YI2 P;  4F37 A;  2KG6 A;  2MD9 A;  1NJI Q;  4XFX A;  2N98 A;  4CA3 A;  3GZM A;  5F2O A;  3LMO A;  3M1M A;  2MVV A;  2M8P A;  5HGM A;  1GXH A;  2KOP A;  5EJD A;  5KP8 B;  1L0I A;  2VLP A;  1QVF O;  2M8N A;  2CGQ A;  1HQB A;  4GR6 A;  1JJ2 O;  2JO0 A;  3G71 P;  1M90 Q;  4R0M A;  2GYK A;  3G1I A;  3NTE A;  4PH0 A;  3I55 P;  3CCR P;  2JGP A;  1Q81 Q;  2KGD A;  1AF8 A;  1RNI A;  1BAJ A;  1VKU A;  2Z46 A;  1M6N A;  2GDX A;  1VQK P;  3G0V A;  3P05 A;  2BUO A;  4IZ6 A;  4BPG A;  2ERH A;  1YIT P;  1YHQ P;  5DCK A;  3CCE P;  1ZMB A;  4PH1 A;  1VQ8 P;  2XV6 A;  1YJ9 P;  2KOD A;  2JU2 A;  4UHP B;  3VRL C;  3DS2 A;  4PXH B;  2MF4 A;  4U0C A;  1IUQ A;  2JAZ A;  2CWO A;  3EJD A;  2AFD A;  2ONT A;  1VQ4 P;  2KR5 A;  2LIW A;  2L6E A;  2JQ4 A;  1EOQ A;  1AUM A;  2K0X A;  2CQ8 A;  2LTE A;  2KG9 A;  2MVU A;  2OTJ P;  1K8A Q;  3HZQ A;  2EIA A;  1FR2 A;  2FHS C;  1D1D A;  5HGL A;  5BS2 A;  1OR5 A;  2LKI A;  2X2B A;  3I56 P;  2KGE A;  2KGC A;  2L9F A;  1Z6M A;  3H47 A;  2LL8 A;  2OAR A;  2N6Y A;  1E0H A;  4XFY A;  2FVE A;  3DS5 A;  1VQN P;  1VQ7 P;  3GJN A;  2FAD A;  2KOR A;  1CEI A;  1GPJ A;  3NY7 B;  1GXG A;  2N5I A;  7CEI A;  2AFE A;  2LF4 A;  3CC7 P;  2LIU A;  3Q20 A;  1ACP A;  3CPW O;  1QVG O;  4GR2 A;  1E6J P;  4COC A;  1ZNV A;  4HKG A;  1EIA A;  2PNG A;  5BS1 A;  1M74 A;  2L4B A;  4DG9 A;  3H0D A;  4H2W C;  2K94 A;  1M1K Q;  2E1M A;  3EJE A;  3GKL C;  4U0B A;  1K73 Q;  2JU1 A;  1KLP A;  3G28 A;  3B5I A;  2EG5 A;  2JYL A;  2PEQ A;  3CCU P;  3U43 A;  1QRJ A;  1IMQ A;  2GZI A;  3WBH A;  1KQS O;  2L0Q A;  4U0A A;  3CCJ P;  2VSQ A;  2EFJ A;  1A8O A;  1T8K A;  2KW2 A;  5HV8 A;  3DPH A;  2DGY A;  2FAE A;  1EMV A;  2K92 A;  1RO2 A;  2PEN A;  2ROQ A;  2OTL P;  2Z45 A;  2PEJ A;  2PY8 A;  2KOS A;  3CCV P;  4H2X C;  2GZG A;  3H4E A;  3G6E P;  3MGE A;  2M8L A;  2Z44 A;  1RO0 A;  1VQ6 P;  3CCS P;  3CD6 P;  3CME P;  1YJN P;  1K9M Q;  1KC8 Q;  1DNY A;  2WPT A;  3CC2 P;  3DS1 A;  4BPF A;  2KGA A;  1NQ4 A;  1VQ5 P;  2MR8 A;  4H2Y C;  3G26 A;  3DS3 A;  2AF8 A;  2XXM A;  4BPH A; 
#chains in the Genus database with same CATH homology
 3CC7 P;  1VQP P;  1RNI A;  3Q20 A;  1BAJ A;  4XRO A;  4U0E A;  4WYM A;  3LRY A;  3CPW O;  1S72 P;  1QVG O;  2Z46 A;  1M6N A;  4GR2 A;  5F2N A;  1VQK P;  3G0V A;  3P05 A;  5JPA A;  1E6J P;  2BUO A;  4COC A;  2PEM A;  5I4T G;  1YIT P;  1EIA A;  4XFZ A;  3G1G A;  1YHQ P;  1VQ9 P;  5DCK A;  5BS1 A;  1VQO P;  3CCE P;  1ZMB A;  1M74 A;  4PH1 A;  2P9X A;  1VQ8 P;  3H0D A;  2JYG A;  2XV6 A;  1YIJ P;  3DS4 A;  1YJ9 P;  3CMA P;  5HGO A;  1M1K Q;  2E1M A;  4IPY A;  1VQM P;  2KOD A;  3VRL C;  1YJW P;  2XT1 A;  4U0B A;  1K73 Q;  3DS2 A;  4U0C A;  1IUQ A;  3G28 A;  4COP A;  3B5I A;  1Q82 Q;  5F2K A;  2CWO A;  2EG5 A;  2JYL A;  3E2D A;  2PEQ A;  1Q7Y Q;  3CCU P;  3RG6 C;  2ONT A;  1VQ4 P;  1QRJ A;  1N8R Q;  1K30 A;  2L6E A;  2PEI A;  3WBH A;  3OW2 O;  1KQS O;  4M0I A;  2PEK A;  4U0D A;  1EOQ A;  4U0A A;  3CCJ P;  2EFJ A;  3CXC O;  1AUM A;  1A8O A;  3G29 A;  1YI2 P;  3DPH A;  2DGY A;  1NJI Q;  4XFX A;  2OTJ P;  1K8A Q;  3CCL P;  3HZQ A;  2EIA A;  3G4S P;  3CCQ P;  5F2O A;  1D1D A;  5HGL A;  1RO2 A;  2PEN A;  5BS2 A;  3M1M A;  1KD1 Q;  2OTL P;  2Z45 A;  2PEJ A;  4XRQ A;  3I56 P;  2PY8 A;  2M8P A;  5HGM A;  1A43 A;  3DTJ A;  1Q86 Q;  3HYB A;  2QEX P;  1M6E X;  3CCV P;  3G21 A;  3CC4 P;  3H4E A;  1QVF O;  2BHV A;  2M8N A;  3G6E P;  3MGE A;  2M8L A;  2Z44 A;  1RO0 A;  1VQ6 P;  3CCS P;  3CD6 P;  3H47 A;  4QNB A;  3CME P;  1YJN P;  2OAR A;  4U0F A;  4GR6 A;  1JJ2 O;  2JO0 A;  3G71 P;  1KC8 Q;  1K9M Q;  1VQL P;  3CC2 P;  1M90 Q;  4XFY A;  1W2B O;  3DS1 A;  3DS5 A;  2QA4 P;  1VQ7 P;  1VQN P;  3G1I A;  3CCM P;  3NTE A;  2PEO A;  1VQ5 P;  4PH0 A;  3I55 P;  3G26 A;  3DS0 A;  3DS3 A;  5HGN A;  2LF4 A;  2XXM A;  3CCR P;  1Q81 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...