2PEMA

Crystal structure of rbcx in complex with substrate
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
110
structure length
110
Chain Sequence
EFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
total genus 48
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2pemA00
2PEQA 4GR6A 5BS1A 3RG6C 3HYBA 3Q20A 2PY8A 2PEOA 2PENA 2Z44A 2Z46A 4GR2A 5BS2A 2PEJA 2PEMA 2PEKA 2Z45A 2PEIA
chains in the Genus database with same CATH superfamily
1T8KA 2QEXP 2M8NA 3CMAP 2CGQA 4U0CA 3CCEP 1AYIA 2AF8A 1KQSO 1QRJA 5BS1A 5DCKA 1FR2A 2ROQA 1M6NA 3H47A 2KOQA 1EMVA 1RO2A 2CG5B 2K94A 3DS3A 5KP6B 4H2YC 2LF4A 2JGPA 1KC8Q 1HQBA 2JQ4A 3U43A 1K30A 2NO8A 2MVVA 1Q7YQ 2JU2A 2KGAA 4XFXA 1Q86Q 4BPGA 1UJZA 2LIWA 2N5HA 2KR5A 2FQ0A 3H0DA 1Q82Q 2JYGA 1GPJA 2K93A 3CCJP 1JJ2O 2KW2A 2K2QA 3CXCO 3CCQP 2FACA 2GZEA 2XZ0D 1Q81Q 5HGMA 2QA4P 1YIJP 4GR6A 1VQOP 1IUQA 5EW5E 5BS2A 4XROA 5JPAA 2PNGA 4XFYA 3OW2O 2XT1A 4HKGA 2Z45A 1UNKA 2GZFA 3LMOA 2XZ1C 1YJNP 2MVUA 2BHVA 3HZQA 5KP8B 2KOOA 2KG9A 2N6ZA 2DGYA 2PEKA 3G29A 2GZJA 1VQ4P 1L0HA 1S72P 3EJDA 2K0YA 2GZIA 3CCLP 1DV5A 2GDXA 3DPHA 2N98A 2GDYA 1ACPA 2FVAA 3GZLA 3GJNA 2QNWA 3G71P 1NJIQ 2MD9A 2JBGA 5F2NA 2FQ1A 3I55P 2KORA 3CE7A 3VRLC 4IZ6A 2CQ8A 3MGEA 4U0AA 2N50A 5F2KA 4BPHA 1MZ8A 4XRQA 1D1DA 3NTEA 1YHQP 5EJDA 2PY8A 1QVGO 2M8LA 2LL8A 1KLPA 2X2BA 1M6EX 1X3OA 2OTLP 2ERHA 1IMPA 2EHTA 4CA3A 3DTJA 2AFEA 3H4EA 2FVFA 1RO0A 2PEJA 2WPTA 3CCUP 2EG5A 3WBHA 1F80D 3CD6P 1E6JP 1W2BO 3G0VA 2Z46A 2KWLA 3G1GA 1VQMP 1M1KQ 1VQ7P 2XXMA 1BAJA 4PH0A 2JB0A 1VQKP 1AF8A 4DG9A 3EJBA 1GXHA 2L4BA 1VQ5P 2DNWA 2VLOA 4H2XC 4IPYA 1E0HA 1A43A 3RG6C 1KD1Q 1VQPP 2MR7A 7CEIA 1N8RQ 2N6YA 1VQ8P 3P05A 2AFDA 5HGOA 2KGCA 1YI2P 5I4TG 1VHNA 3CMEP 3B5IA 4QKOA 3RG2A 2VLPA 4NEOA 1ZMBA 3CC2P 5HGNA 3M1MA 1EIAA 2PEQA 4M0IA 2VLNA 2FHSC 4R0MA 2EIAA 1RNIA 1K73Q 4U0BA 4COPA 3NY7B 2GYKA 2VLQA 4XFZA 5KP7B 3DS1A 1EOQA 1YJWP 2M8PA 2LIUA 4U0EA 4PXHB 2K0XA 1YJ9P 2LMLA 3G28A 1CEIA 2JAZA 2JO0A 2OARA 2CWOA 2LPKA 2MY5A 2K0DX 4COCA 1OR5A 1A8OA 4GR2A 5HV8A 1VQ6P 2L22A 2MR8A 1AUMA 5F2OA 3GZMA 3CPWO 1DNYA 3DS4A 2N5IA 2K5XA 4PWVB 3B4QA 1ZNVA 3CCMP 5HVCA 1VQNP 2KGEA 4PH1A 3CC4P 3LRYA 2L0QA 2OTJP 2MF4A 1HY8A 4QNBA 2KODA 2LTEA 2GDWA 2P9XA 4U0DA 3CCSP 2FAEA 2CNRA 3Q20A 2JYLA 4WYMA 3EJEA 3HYBA 3DS5A 2M5RA 2PEIA 2L9FA 1Z6MA 2XV6A 2KG6A 4BPFA 4F37A 2LOLA 4UHPB 3G26A 3GKLC 4MRTC 2FVEA 3DS2A 2EFJA 3DS0A 3G4SP 2LKIA 5HGLA 1VQ9P 2FQ2A 2JU1A 1GXGA 3E2DA 2E1MA 5CZDB 1IMQA 2K92A 2FADA 2KOPA 2KGDA 3G6EP 1QVFO 1K8AQ 2Z44A 2GZGA 2VSQA 3CCVP 2L6EA 2PENA 1L0IA 1VQLP 2KOSA 3CC7P 4U0FA 1M74A 1VKUA 2BUOA 1K9MQ 3CCRP 3G21A 2AVAA 1NQ4A 4H2WC 1M90Q 1BXIA 2EHSA 2KG8A 1YITP 3I56P 2PEMA 2PEOA 2ONTA 3G1IA
chains in the Genus database with same CATH topology
2QEXP 2M8NA 3CMAP 2OTJP 1VQ5P 4U0CA 4QNBA 2KODA 4IPYA 1A43A 3RG6C 1KD1Q 1VQPP 3CCEP 3G71P 1KQSO 2P9XA 1N8RQ 4U0DA 1VQ8P 1QRJA 1NJIQ 3CCSP 5BS1A 5DCKA 3P05A 5F2NA 3Q20A 2JYLA 1M6NA 4WYMA 3H47A 1RO2A 3HYBA 3I55P 3DS5A 3DS3A 5HGOA 2LF4A 1KC8Q 1YI2P 3VRLC 5I4TG 3MGEA 3CMEP 4U0AA 3B5IA 1K30A 2PEIA 5F2KA 2XV6A 4XRQA 1D1DA 1Q7YQ 4XFXA 3NTEA 1Q86Q 1ZMBA 3CC2P 1YHQP 3G26A 5HGNA 3M1MA 2PY8A 1QVGO 2M8LA 1EIAA 3H0DA 1Q82Q 2PEQA 4M0IA 3DS2A 1M6EX 2JYGA 2EFJA 3CCJP 1JJ2O 3DS0A 2EIAA 1RNIA 1K73Q 3CXCO 4U0BA 3G4SP 3CCQP 4COPA 4XFZA 5HGLA 1VQ9P 3DS1A 1Q81Q 1EOQA 5HGMA 2QA4P 1YIJP 1YJWP 4GR6A 1VQOP 1IUQA 2OTLP 2M8PA 2E1MA 3E2DA 5BS2A 4XROA 4U0EA 5JPAA 1YJ9P 3DTJA 3G28A 3H4EA 4XFYA 3OW2O 3G6EP 2PEJA 1RO0A 2JO0A 1QVFO 2OARA 2CWOA 3CCUP 2EG5A 1K8AQ 2XT1A 3WBHA 2Z44A 3CD6P 2Z45A 1E6JP 1W2BO 3G0VA 4COCA 3CCVP 1A8OA 2L6EA 2PENA 2Z46A 4GR2A 1VQLP 1VQ6P 1YJNP 3CC7P 4U0FA 2BHVA 3G1GA 1M74A 1AUMA 3HZQA 5F2OA 1VQMP 2BUOA 1M1KQ 1VQ7P 3CPWO 2XXMA 1K9MQ 3CCRP 3G21A 1BAJA 2DGYA 2PEKA 3DS4A 1M90Q 3G29A 1VQ4P 1YITP 4PH0A 1S72P 3I56P 3CCMP 2PEMA 1VQNP 3CCLP 1VQKP 2PEOA 4PH1A 3DPHA 2ONTA 3G1IA 3CC4P 3LRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEQ A;  4GR6 A;  5BS1 A;  3RG6 C;  3HYB A;  3Q20 A;  2PY8 A;  2PEO A;  2PEN A;  2Z44 A;  2Z46 A;  4GR2 A;  5BS2 A;  2PEJ A;  2PEM A;  2PEK A;  2Z45 A;  2PEI A; 
#chains in the Genus database with same CATH topology
 1T8K A;  2QEX P;  2M8N A;  3CMA P;  2CGQ A;  4U0C A;  3CCE P;  1AYI A;  2AF8 A;  1KQS O;  1QRJ A;  5BS1 A;  5DCK A;  1FR2 A;  2ROQ A;  1M6N A;  3H47 A;  2KOQ A;  1EMV A;  1RO2 A;  2CG5 B;  2K94 A;  3DS3 A;  5KP6 B;  4H2Y C;  2LF4 A;  2JGP A;  1KC8 Q;  1HQB A;  2JQ4 A;  3U43 A;  1K30 A;  2NO8 A;  2MVV A;  1Q7Y Q;  2JU2 A;  2KGA A;  4XFX A;  1Q86 Q;  4BPG A;  1UJZ A;  2LIW A;  2N5H A;  2KR5 A;  2FQ0 A;  3H0D A;  1Q82 Q;  2JYG A;  1GPJ A;  2K93 A;  3CCJ P;  1JJ2 O;  2KW2 A;  2K2Q A;  3CXC O;  3CCQ P;  2FAC A;  2GZE A;  2XZ0 D;  1Q81 Q;  5HGM A;  2QA4 P;  1YIJ P;  4GR6 A;  1VQO P;  1IUQ A;  5EW5 E;  5BS2 A;  4XRO A;  5JPA A;  2PNG A;  4XFY A;  3OW2 O;  2XT1 A;  4HKG A;  2Z45 A;  1UNK A;  2GZF A;  3LMO A;  2XZ1 C;  1YJN P;  2MVU A;  2BHV A;  3HZQ A;  5KP8 B;  2KOO A;  2KG9 A;  2N6Z A;  2DGY A;  2PEK A;  3G29 A;  2GZJ A;  1VQ4 P;  1L0H A;  1S72 P;  3EJD A;  2K0Y A;  2GZI A;  3CCL P;  1DV5 A;  2GDX A;  3DPH A;  2N98 A;  2GDY A;  1ACP A;  2FVA A;  3GZL A;  3GJN A;  2QNW A;  3G71 P;  1NJI Q;  2MD9 A;  2JBG A;  5F2N A;  2FQ1 A;  3I55 P;  2KOR A;  3CE7 A;  3VRL C;  4IZ6 A;  2CQ8 A;  3MGE A;  4U0A A;  2N50 A;  5F2K A;  4BPH A;  1MZ8 A;  4XRQ A;  1D1D A;  3NTE A;  1YHQ P;  5EJD A;  2PY8 A;  1QVG O;  2M8L A;  2LL8 A;  1KLP A;  2X2B A;  1M6E X;  1X3O A;  2OTL P;  2ERH A;  1IMP A;  2EHT A;  4CA3 A;  3DTJ A;  2AFE A;  3H4E A;  2FVF A;  1RO0 A;  2PEJ A;  2WPT A;  3CCU P;  2EG5 A;  3WBH A;  1F80 D;  3CD6 P;  1E6J P;  1W2B O;  3G0V A;  2Z46 A;  2KWL A;  3G1G A;  1VQM P;  1M1K Q;  1VQ7 P;  2XXM A;  1BAJ A;  4PH0 A;  2JB0 A;  1VQK P;  1AF8 A;  4DG9 A;  3EJB A;  1GXH A;  2L4B A;  1VQ5 P;  2DNW A;  2VLO A;  4H2X C;  4IPY A;  1E0H A;  1A43 A;  3RG6 C;  1KD1 Q;  1VQP P;  2MR7 A;  7CEI A;  1N8R Q;  2N6Y A;  1VQ8 P;  3P05 A;  2AFD A;  5HGO A;  2KGC A;  1YI2 P;  5I4T G;  1VHN A;  3CME P;  3B5I A;  4QKO A;  3RG2 A;  2VLP A;  4NEO A;  1ZMB A;  3CC2 P;  5HGN A;  3M1M A;  1EIA A;  2PEQ A;  4M0I A;  2VLN A;  2FHS C;  4R0M A;  2EIA A;  1RNI A;  1K73 Q;  4U0B A;  4COP A;  3NY7 B;  2GYK A;  2VLQ A;  4XFZ A;  5KP7 B;  3DS1 A;  1EOQ A;  1YJW P;  2M8P A;  2LIU A;  4U0E A;  4PXH B;  2K0X A;  1YJ9 P;  2LML A;  3G28 A;  1CEI A;  2JAZ A;  2JO0 A;  2OAR A;  2CWO A;  2LPK A;  2MY5 A;  2K0D X;  4COC A;  1OR5 A;  1A8O A;  4GR2 A;  5HV8 A;  1VQ6 P;  2L22 A;  2MR8 A;  1AUM A;  5F2O A;  3GZM A;  3CPW O;  1DNY A;  3DS4 A;  2N5I A;  2K5X A;  4PWV B;  3B4Q A;  1ZNV A;  3CCM P;  5HVC A;  1VQN P;  2KGE A;  4PH1 A;  3CC4 P;  3LRY A;  2L0Q A;  2OTJ P;  2MF4 A;  1HY8 A;  4QNB A;  2KOD A;  2LTE A;  2GDW A;  2P9X A;  4U0D A;  3CCS P;  2FAE A;  2CNR A;  3Q20 A;  2JYL A;  4WYM A;  3EJE A;  3HYB A;  3DS5 A;  2M5R A;  2PEI A;  2L9F A;  1Z6M A;  2XV6 A;  2KG6 A;  4BPF A;  4F37 A;  2LOL A;  4UHP B;  3G26 A;  3GKL C;  4MRT C;  2FVE A;  3DS2 A;  2EFJ A;  3DS0 A;  3G4S P;  2LKI A;  5HGL A;  1VQ9 P;  2FQ2 A;  2JU1 A;  1GXG A;  3E2D A;  2E1M A;  5CZD B;  1IMQ A;  2K92 A;  2FAD A;  2KOP A;  2KGD A;  3G6E P;  1QVF O;  1K8A Q;  2Z44 A;  2GZG A;  2VSQ A;  3CCV P;  2L6E A;  2PEN A;  1L0I A;  1VQL P;  2KOS A;  3CC7 P;  4U0F A;  1M74 A;  1VKU A;  2BUO A;  1K9M Q;  3CCR P;  3G21 A;  2AVA A;  1NQ4 A;  4H2W C;  1M90 Q;  1BXI A;  2EHS A;  2KG8 A;  1YIT P;  3I56 P;  2PEM A;  2PEO A;  2ONT A;  3G1I A; 
#chains in the Genus database with same CATH homology
 2QEX P;  2M8N A;  3CMA P;  2OTJ P;  1VQ5 P;  4U0C A;  4QNB A;  2KOD A;  4IPY A;  1A43 A;  3RG6 C;  1KD1 Q;  1VQP P;  3CCE P;  3G71 P;  1KQS O;  2P9X A;  1N8R Q;  4U0D A;  1VQ8 P;  1QRJ A;  1NJI Q;  3CCS P;  5BS1 A;  5DCK A;  3P05 A;  5F2N A;  3Q20 A;  2JYL A;  1M6N A;  4WYM A;  3H47 A;  1RO2 A;  3HYB A;  3I55 P;  3DS5 A;  3DS3 A;  5HGO A;  2LF4 A;  1KC8 Q;  1YI2 P;  3VRL C;  5I4T G;  3MGE A;  3CME P;  4U0A A;  3B5I A;  1K30 A;  2PEI A;  5F2K A;  2XV6 A;  4XRQ A;  1D1D A;  1Q7Y Q;  4XFX A;  3NTE A;  1Q86 Q;  1ZMB A;  3CC2 P;  1YHQ P;  3G26 A;  5HGN A;  3M1M A;  2PY8 A;  1QVG O;  2M8L A;  1EIA A;  3H0D A;  1Q82 Q;  2PEQ A;  4M0I A;  3DS2 A;  1M6E X;  2JYG A;  2EFJ A;  3CCJ P;  1JJ2 O;  3DS0 A;  2EIA A;  1RNI A;  1K73 Q;  3CXC O;  4U0B A;  3G4S P;  3CCQ P;  4COP A;  4XFZ A;  5HGL A;  1VQ9 P;  3DS1 A;  1Q81 Q;  1EOQ A;  5HGM A;  2QA4 P;  1YIJ P;  1YJW P;  4GR6 A;  1VQO P;  1IUQ A;  2OTL P;  2M8P A;  2E1M A;  3E2D A;  5BS2 A;  4XRO A;  4U0E A;  5JPA A;  1YJ9 P;  3DTJ A;  3G28 A;  3H4E A;  4XFY A;  3OW2 O;  3G6E P;  2PEJ A;  1RO0 A;  2JO0 A;  1QVF O;  2OAR A;  2CWO A;  3CCU P;  2EG5 A;  1K8A Q;  2XT1 A;  3WBH A;  2Z44 A;  3CD6 P;  2Z45 A;  1E6J P;  1W2B O;  3G0V A;  4COC A;  3CCV P;  1A8O A;  2L6E A;  2PEN A;  2Z46 A;  4GR2 A;  1VQL P;  1VQ6 P;  1YJN P;  3CC7 P;  4U0F A;  2BHV A;  3G1G A;  1M74 A;  1AUM A;  3HZQ A;  5F2O A;  1VQM P;  2BUO A;  1M1K Q;  1VQ7 P;  3CPW O;  2XXM A;  1K9M Q;  3CCR P;  3G21 A;  1BAJ A;  2DGY A;  2PEK A;  3DS4 A;  1M90 Q;  3G29 A;  1VQ4 P;  1YIT P;  4PH0 A;  1S72 P;  3I56 P;  3CCM P;  2PEM A;  1VQN P;  3CCL P;  1VQK P;  2PEO A;  4PH1 A;  3DPH A;  2ONT A;  3G1I A;  3CC4 P;  3LRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...