2PEMA

Crystal structure of rbcx in complex with substrate
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
110
structure length
110
Chain Sequence
b'EFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 48
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2pemA00
4GR2A 2PENA 2Z45A 2PEOA 2Z44A 5BS2A 2PEJA 2PEIA 2PY8A 2PEMA 2PEQA 3Q20A 2Z46A 4GR6A 5BS1A 3HYBA 2PEKA 3RG6C
chains in the Genus database with same CATH superfamily
1QVGO 3U43A 1KQSO 2XT1A 2MD9A 2LF4A 4DG9A 3RG6C 2K0DX 4IZ6A 1HQBA 2EG5A 2OTLP 2AF8A 3H4EA 2FVFA 2K93A 1VQOP 3CE7A 3I56P 3LMOA 3CCJP 1KLPA 1Z6MA 3EJEA 4PH1A 2M8PA 3VRLC 3G0VA 2L22A 2QA4P 2N6ZA 2LIWA 1YITP 2FADA 2JU1A 4NEOA 3OW2O 5EJDA 2DNWA 2KGCA 2N98A 1T8KA 5CZDB 1Q86Q 2GZGA 3E2DA 2GZIA 2BHVA 3NY7B 5JPAA 2ERHA 1Q7YQ 5HGNA 2XZ1C 4H2WC 1VQKP 3CCQP 2VLNA 2Z44A 4CA3A 1KC8Q 1RO2A 3M1MA 2LMLA 4GR2A 5HV8A 2AFDA 4GR6A 5DCKA 1VQNP 1BAJA 2PENA 2KGEA 2MY5A 2KR5A 2EHSA 2Z46A 3DTJA 2FQ1A 1YHQP 1NJIQ 1N8RQ 1IUQA 1VQLP 3HZQA 4UHPB 1W2BO 3DS2A 2VLOA 1A43A 1EOQA 3I55P 3H47A 2JBGA 1VQ7P 2M8NA 2MVVA 1L0HA 1YJWP 2EHTA 2MR7A 1M6EX 4BPFA 5HGOA 1YI2P 4U0BA 3DPHA 1K9MQ 2MF4A 2P9XA 2EFJA 3CCEP 2L4BA 2N50A 3DS3A 2MVUA 3G4SP 1K8AQ 2JYLA 3B4QA 4WYMA 1GXHA 1OR5A 2DGYA 5F2NA 1AF8A 4PH0A 1M1KQ 3GKLC 2LIUA 4HKGA 4R0MA 1IMPA 1K73Q 3GJNA 2FACA 2K92A 2K5XA 4XFZA 2K2QA 2KG8A 4COPA 2GZFA 2K0XA 2LL8A 4XROA 4U0EA 1Q81Q 2PY8A 2JAZA 2OARA 5F2KA 1Q82Q 1UNKA 2VLPA 2K0YA 3G21A 2CWOA 1DV5A 5EW5E 2WPTA 1MZ8A 2M5RA 2PEIA 2L0QA 3CPWO 1YJ9P 2GDXA 1JJ2O 3B5IA 2CQ8A 4PWVB 2E1MA 2KGDA 1VQ8P 2FVAA 1UJZA 2CGQA 3HYBA 3NTEA 1YIJP 2PEJA 5KP6B 1AUMA 4U0FA 5BS1A 2GDWA 1YJNP 3DS1A 3CD6P 2BUOA 2JYGA 1HY8A 7CEIA 2M8LA 1RO0A 4U0CA 2JQ4A 1AYIA 1F80D 3H0DA 4F37A 3CMAP 4H2XC 2N5IA 2KW2A 3CCRP 3GZMA 2KOQA 1GXGA 1E0HA 3G1IA 3CMEP 2QNWA 2GZEA 5KP7B 4BPHA 2FQ0A 2KG9A 2KOSA 2GDYA 4QKOA 1S72P 1VQPP 2KORA 2N5HA 4XFXA 1E6JP 2MR8A 2VLQA 2KOPA 5HGMA 2K94A 2CNRA 2FVEA 3DS4A 1VQMP 5HGLA 2JB0A 3CCSP 2XV6A 3CC2P 3CCVP 5I4TG 1L0IA 1VQ9P 2PEQA 3CC7P 4U0DA 3CCMP 2AFEA 2KWLA 4XRQA 4BPGA 3RG2A 2LOLA 1VHNA 2JGPA 1ZMBA 3EJBA 1VQ5P 1QVFO 3Q20A 2GYKA 2LTEA 1M90Q 3LRYA 5KP8B 2FHSC 2KGAA 1X3OA 1KD1Q 2AVAA 1M74A 2FQ2A 4QNBA 2KOOA 2ONTA 2LPKA 2JU2A 1FR2A 2L6EA 2KODA 2N6YA 3CCLP 3CC4P 2X2BA 1ACPA 1EIAA 4IPYA 4H2YC 2NO8A 3G26A 3EJDA 3WBHA 2LKIA 2PEOA 3P05A 1RNIA 4M0IA 2GZJA 2L9FA 5BS2A 2QEXP 4MRTC 2CG5B 3G29A 5F2OA 3G1GA 1A8OA 2PNGA 4PXHB 1ZNVA 1VQ6P 1GPJA 1DNYA 2OTJP 2ROQA 4COCA 3DS0A 3CCUP 3GZLA 1D1DA 3DS5A 1VKUA 2FAEA 4U0AA 1CEIA 2XXMA 2VSQA 3MGEA 1IMQA 2KG6A 1BXIA 1K30A 3G71P 2EIAA 1M6NA 1EMVA 2PEMA 3G28A 1NQ4A 4XFYA 2XZ0D 2JO0A 2PEKA 1VQ4P 2Z45A 3G6EP 1QRJA 5HVCA 3CXCO
chains in the Genus database with same CATH topology
1QVGO 1VQ7P 2M8NA 2L6EA 1KQSO 2XT1A 2LF4A 2KODA 2M8LA 3RG6C 1YJWP 1M6EX 1RO0A 4U0CA 5HGOA 3H0DA 1YI2P 2EG5A 2OTLP 3CMAP 4U0BA 3DPHA 3H4EA 3CCLP 3CC4P 3CCRP 1VQOP 1K9MQ 2P9XA 3I56P 2EFJA 1EIAA 4IPYA 3CCEP 3G1IA 3CMEP 3G26A 3WBHA 3DS3A 3CCJP 2PEOA 3G4SP 3P05A 1K8AQ 1RNIA 2JYLA 4M0IA 4PH1A 4WYMA 2DGYA 2M8PA 5F2NA 5BS2A 3VRLC 3G0VA 2QEXP 4PH0A 2QA4P 1M1KQ 3G29A 1YITP 1S72P 1VQPP 5F2OA 3G1GA 1K73Q 1A8OA 4XFXA 1E6JP 3OW2O 5HGMA 1VQ6P 3DS4A 1VQMP 5HGLA 4XFZA 3CCSP 2XV6A 3CC2P 3CCVP 4COPA 5I4TG 1Q86Q 4XROA 2OTJP 4U0EA 1Q81Q 3E2DA 2BHVA 4COCA 1VQ9P 2PY8A 2PEQA 2OARA 5F2KA 5JPAA 1Q82Q 1Q7YQ 3CC7P 4U0DA 5HGNA 3CCMP 1VQKP 3DS0A 3CCUP 3CCQP 2Z44A 1D1DA 3G21A 2CWOA 3DS5A 4XRQA 1KC8Q 1RO2A 2PEIA 1ZMBA 4U0AA 3M1MA 3CPWO 4GR2A 1YJ9P 2XXMA 3MGEA 1JJ2O 1VQ5P 3B5IA 1QVFO 5DCKA 4GR6A 3Q20A 1K30A 2E1MA 1VQNP 3G71P 1BAJA 2EIAA 2PENA 1M6NA 1VQ8P 2PEMA 3G28A 2Z46A 4XFYA 1M90Q 3DTJA 2JO0A 3HYBA 2PEKA 3NTEA 1VQ4P 3LRYA 2Z45A 3G6EP 1YHQP 1YIJP 1IUQA 1NJIQ 1N8RQ 1KD1Q 2PEJA 1QRJA 1VQLP 1M74A 1AUMA 4U0FA 3HZQA 5BS1A 1W2BO 1YJNP 3DS2A 4QNBA 1A43A 2ONTA 3DS1A 1EOQA 3I55P 3H47A 3CD6P 2BUOA 2JYGA 3CXCO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GR2 A;  2PEN A;  2Z45 A;  2PEO A;  2Z44 A;  5BS2 A;  2PEJ A;  2PEI A;  2PY8 A;  2PEM A;  2PEQ A;  3Q20 A;  2Z46 A;  4GR6 A;  5BS1 A;  3HYB A;  2PEK A;  3RG6 C; 
#chains in the Genus database with same CATH topology
 1QVG O;  3U43 A;  1KQS O;  2XT1 A;  2MD9 A;  2LF4 A;  4DG9 A;  3RG6 C;  2K0D X;  4IZ6 A;  1HQB A;  2EG5 A;  2OTL P;  2AF8 A;  3H4E A;  2FVF A;  2K93 A;  1VQO P;  3CE7 A;  3I56 P;  3LMO A;  3CCJ P;  1KLP A;  1Z6M A;  3EJE A;  4PH1 A;  2M8P A;  3VRL C;  3G0V A;  2L22 A;  2QA4 P;  2N6Z A;  2LIW A;  1YIT P;  2FAD A;  2JU1 A;  4NEO A;  3OW2 O;  5EJD A;  2DNW A;  2KGC A;  2N98 A;  1T8K A;  5CZD B;  1Q86 Q;  2GZG A;  3E2D A;  2GZI A;  2BHV A;  3NY7 B;  5JPA A;  2ERH A;  1Q7Y Q;  5HGN A;  2XZ1 C;  4H2W C;  1VQK P;  3CCQ P;  2VLN A;  2Z44 A;  4CA3 A;  1KC8 Q;  1RO2 A;  3M1M A;  2LML A;  4GR2 A;  5HV8 A;  2AFD A;  4GR6 A;  5DCK A;  1VQN P;  1BAJ A;  2PEN A;  2KGE A;  2MY5 A;  2KR5 A;  2EHS A;  2Z46 A;  3DTJ A;  2FQ1 A;  1YHQ P;  1NJI Q;  1N8R Q;  1IUQ A;  1VQL P;  3HZQ A;  4UHP B;  1W2B O;  3DS2 A;  2VLO A;  1A43 A;  1EOQ A;  3I55 P;  3H47 A;  2JBG A;  1VQ7 P;  2M8N A;  2MVV A;  1L0H A;  1YJW P;  2EHT A;  2MR7 A;  1M6E X;  4BPF A;  5HGO A;  1YI2 P;  4U0B A;  3DPH A;  1K9M Q;  2MF4 A;  2P9X A;  2EFJ A;  3CCE P;  2L4B A;  2N50 A;  3DS3 A;  2MVU A;  3G4S P;  1K8A Q;  2JYL A;  3B4Q A;  4WYM A;  1GXH A;  1OR5 A;  2DGY A;  5F2N A;  1AF8 A;  4PH0 A;  1M1K Q;  3GKL C;  2LIU A;  4HKG A;  4R0M A;  1IMP A;  1K73 Q;  3GJN A;  2FAC A;  2K92 A;  2K5X A;  4XFZ A;  2K2Q A;  2KG8 A;  4COP A;  2GZF A;  2K0X A;  2LL8 A;  4XRO A;  4U0E A;  1Q81 Q;  2PY8 A;  2JAZ A;  2OAR A;  5F2K A;  1Q82 Q;  1UNK A;  2VLP A;  2K0Y A;  3G21 A;  2CWO A;  1DV5 A;  5EW5 E;  2WPT A;  1MZ8 A;  2M5R A;  2PEI A;  2L0Q A;  3CPW O;  1YJ9 P;  2GDX A;  1JJ2 O;  3B5I A;  2CQ8 A;  4PWV B;  2E1M A;  2KGD A;  1VQ8 P;  2FVA A;  1UJZ A;  2CGQ A;  3HYB A;  3NTE A;  1YIJ P;  2PEJ A;  5KP6 B;  1AUM A;  4U0F A;  5BS1 A;  2GDW A;  1YJN P;  3DS1 A;  3CD6 P;  2BUO A;  2JYG A;  1HY8 A;  7CEI A;  2M8L A;  1RO0 A;  4U0C A;  2JQ4 A;  1AYI A;  1F80 D;  3H0D A;  4F37 A;  3CMA P;  4H2X C;  2N5I A;  2KW2 A;  3CCR P;  3GZM A;  2KOQ A;  1GXG A;  1E0H A;  3G1I A;  3CME P;  2QNW A;  2GZE A;  5KP7 B;  4BPH A;  2FQ0 A;  2KG9 A;  2KOS A;  2GDY A;  4QKO A;  1S72 P;  1VQP P;  2KOR A;  2N5H A;  4XFX A;  1E6J P;  2MR8 A;  2VLQ A;  2KOP A;  5HGM A;  2K94 A;  2CNR A;  2FVE A;  3DS4 A;  1VQM P;  5HGL A;  2JB0 A;  3CCS P;  2XV6 A;  3CC2 P;  3CCV P;  5I4T G;  1L0I A;  1VQ9 P;  2PEQ A;  3CC7 P;  4U0D A;  3CCM P;  2AFE A;  2KWL A;  4XRQ A;  4BPG A;  3RG2 A;  2LOL A;  1VHN A;  2JGP A;  1ZMB A;  3EJB A;  1VQ5 P;  1QVF O;  3Q20 A;  2GYK A;  2LTE A;  1M90 Q;  3LRY A;  5KP8 B;  2FHS C;  2KGA A;  1X3O A;  1KD1 Q;  2AVA A;  1M74 A;  2FQ2 A;  4QNB A;  2KOO A;  2ONT A;  2LPK A;  2JU2 A;  1FR2 A;  2L6E A;  2KOD A;  2N6Y A;  3CCL P;  3CC4 P;  2X2B A;  1ACP A;  1EIA A;  4IPY A;  4H2Y C;  2NO8 A;  3G26 A;  3EJD A;  3WBH A;  2LKI A;  2PEO A;  3P05 A;  1RNI A;  4M0I A;  2GZJ A;  2L9F A;  5BS2 A;  2QEX P;  4MRT C;  2CG5 B;  3G29 A;  5F2O A;  3G1G A;  1A8O A;  2PNG A;  4PXH B;  1ZNV A;  1VQ6 P;  1GPJ A;  1DNY A;  2OTJ P;  2ROQ A;  4COC A;  3DS0 A;  3CCU P;  3GZL A;  1D1D A;  3DS5 A;  1VKU A;  2FAE A;  4U0A A;  1CEI A;  2XXM A;  2VSQ A;  3MGE A;  1IMQ A;  2KG6 A;  1BXI A;  1K30 A;  3G71 P;  2EIA A;  1M6N A;  1EMV A;  2PEM A;  3G28 A;  1NQ4 A;  4XFY A;  2XZ0 D;  2JO0 A;  2PEK A;  1VQ4 P;  2Z45 A;  3G6E P;  1QRJ A;  5HVC A;  3CXC O; 
#chains in the Genus database with same CATH homology
 1QVG O;  1VQ7 P;  2M8N A;  2L6E A;  1KQS O;  2XT1 A;  2LF4 A;  2KOD A;  2M8L A;  3RG6 C;  1YJW P;  1M6E X;  1RO0 A;  4U0C A;  5HGO A;  3H0D A;  1YI2 P;  2EG5 A;  2OTL P;  3CMA P;  4U0B A;  3DPH A;  3H4E A;  3CCL P;  3CC4 P;  3CCR P;  1VQO P;  1K9M Q;  2P9X A;  3I56 P;  2EFJ A;  1EIA A;  4IPY A;  3CCE P;  3G1I A;  3CME P;  3G26 A;  3WBH A;  3DS3 A;  3CCJ P;  2PEO A;  3G4S P;  3P05 A;  1K8A Q;  1RNI A;  2JYL A;  4M0I A;  4PH1 A;  4WYM A;  2DGY A;  2M8P A;  5F2N A;  5BS2 A;  3VRL C;  3G0V A;  2QEX P;  4PH0 A;  2QA4 P;  1M1K Q;  3G29 A;  1YIT P;  1S72 P;  1VQP P;  5F2O A;  3G1G A;  1K73 Q;  1A8O A;  4XFX A;  1E6J P;  3OW2 O;  5HGM A;  1VQ6 P;  3DS4 A;  1VQM P;  5HGL A;  4XFZ A;  3CCS P;  2XV6 A;  3CC2 P;  3CCV P;  4COP A;  5I4T G;  1Q86 Q;  4XRO A;  2OTJ P;  4U0E A;  1Q81 Q;  3E2D A;  2BHV A;  4COC A;  1VQ9 P;  2PY8 A;  2PEQ A;  2OAR A;  5F2K A;  5JPA A;  1Q82 Q;  1Q7Y Q;  3CC7 P;  4U0D A;  5HGN A;  3CCM P;  1VQK P;  3DS0 A;  3CCU P;  3CCQ P;  2Z44 A;  1D1D A;  3G21 A;  2CWO A;  3DS5 A;  4XRQ A;  1KC8 Q;  1RO2 A;  2PEI A;  1ZMB A;  4U0A A;  3M1M A;  3CPW O;  4GR2 A;  1YJ9 P;  2XXM A;  3MGE A;  1JJ2 O;  1VQ5 P;  3B5I A;  1QVF O;  5DCK A;  4GR6 A;  3Q20 A;  1K30 A;  2E1M A;  1VQN P;  3G71 P;  1BAJ A;  2EIA A;  2PEN A;  1M6N A;  1VQ8 P;  2PEM A;  3G28 A;  2Z46 A;  4XFY A;  1M90 Q;  3DTJ A;  2JO0 A;  3HYB A;  2PEK A;  3NTE A;  1VQ4 P;  3LRY A;  2Z45 A;  3G6E P;  1YHQ P;  1YIJ P;  1IUQ A;  1NJI Q;  1N8R Q;  1KD1 Q;  2PEJ A;  1QRJ A;  1VQL P;  1M74 A;  1AUM A;  4U0F A;  3HZQ A;  5BS1 A;  1W2B O;  1YJN P;  3DS2 A;  4QNB A;  1A43 A;  2ONT A;  3DS1 A;  1EOQ A;  3I55 P;  3H47 A;  3CD6 P;  2BUO A;  2JYG A;  3CXC O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...