2KOSA

Nmr solution structures of octanoyl-acp from streptomyces coelicolor fatty acid synthase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport protein
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kosA00
2GDWA 4BPGA 1ACPA 2FQ2A 2FAEA 2KG8A 2KOQA 2K94A 2AVAA 1NQ4A 4CA3A 2XZ0D 1DV5A 1X3OA 2FACA 2CNRA 5KP7B 1DNYA 2N6ZA 4H2WC 2KOOA 3EJEA 2KR5A 2L0QA 1HQBA 2AFDA 5CZDB 1VKUA 2JU1A 1AF8A 3EJBA 2KORA 1KLPA 2MR7A 2K93A 2MVUA 4BPFA 2FADA 2FVFA 1T8KA 2EHSA 2KOSA 2N50A 2GDXA 5HV8A 2AFEA 2XZ1C 4MRTC 2LMLA 3NY7B 2MY5A 4H2XC 4BPHA 2KGCA 2LIWA 2FQ1A 2KGAA 2KGEA 2N5HA 3EJDA 2JU2A 2CG5B 3RG2A 4R0MA 2FVAA 2MVVA 2K0XA 1L0IA 2FVEA 2LL8A 1OR5A 5HVCA 2LTEA 2QNWA 4IZ6A 2KWLA 2PNGA 2KG6A 5KP8B 2N6YA 2JGPA 2FHSC 3LMOA 2AF8A 1HY8A 2LIUA 2L9FA 5KP6B 2KW2A 4H2YC 4PWVB 2DNWA 2X2BA 4PXHB 2CGQA 2K2QA 2L22A 2L4BA 2KGDA 2MD9A 4HKGA 3CE7A 2LPKA 2JQ4A 2LOLA 2ROQA 2GDYA 2CQ8A 2MF4A 2FQ0A 2K0YA 3GZLA 2K92A 2N5IA 2KOPA 2N98A 4NEOA 2MR8A 2VSQA 4DG9A 2KG9A 3GZMA 1L0HA 1F80D 2M5RA 2LKIA 5EJDA 2EHTA
chains in the Genus database with same CATH superfamily
3DS1A 3G4SP 2JBGA 3DS4A 1M6EX 2FQ2A 2M8PA 2KG8A 4GR6A 1K30A 2AVAA 1NQ4A 1ZMBA 2XZ0D 2FACA 2PEJA 2KOOA 3EJEA 1HQBA 1EIAA 3VRLC 1IMQA 5CZDB 1VKUA 3CCMP 1M90Q 1YIJP 1QVFO 2Z46A 2MVUA 4M0IA 2GZFA 1IUQA 1CEIA 1T8KA 2KOSA 2N50A 2GDXA 2JYLA 2XZ1C 3DS0A 4MRTC 5F2KA 1GXGA 2JU2A 4PH0A 1Q82Q 2K0XA 1FR2A 2LL8A 2Z45A 2WPTA 2XV6A 1Q7YQ 3CMEP 2KWLA 2VLPA 3CCQP 3E2DA 5DCKA 2N6YA 3CCRP 1VQKP 4IPYA 3CCSP 1E0HA 3G28A 2M8LA 2DNWA 1YI2P 1K9MQ 2JB0A 4U0DA 2LOLA 2ROQA 3DS3A 2N5IA 4XFYA 2N98A 2VSQA 1RNIA 1VQPP 2KG9A 2GZIA 2DGYA 1F80D 5EJDA 2JYGA 3MGEA 2GDWA 2XXMA 2M8NA 3LRYA 1AYIA 4U0FA 1GPJA 2CWOA 1QVGO 1W2BO 2VLNA 3CCVP 2PEQA 2KR5A 4COCA 4U0CA 2AFDA 4XFZA 2JU1A 3EJBA 4QKOA 3HYBA 3CXCO 1M6NA 1VQ9P 4BPFA 4XRQA 4BPHA 2KGCA 2LIWA 2KGAA 3G26A 3EJDA 5F2NA 2ONTA 1K8AQ 3G6EP 3P05A 4R0MA 3DTJA 3H47A 3B4QA 5BS1A 1M1KQ 2LTEA 1KC8Q 1VQNP 1A8OA 1YJWP 2JO0A 2OARA 3LMOA 2AF8A 1HY8A 2BHVA 2GZEA 4XROA 2EIAA 2X2BA 2QEXP 3GKLC 4PXHB 2K2QA 4U0EA 4HKGA 1JJ2O 1ZNVA 1QRJA 2JQ4A 3GZLA 2K92A 2Z44A 3OW2O 4PH1A 2MR8A 4DG9A 2PY8A 4UHPB 1VQOP 2GZJA 4U0AA 2PEKA 2L6EA 1L0HA 1Q86Q 2M5RA 1VQMP 3CMAP 4BPGA 1ACPA 3GJNA 5HGOA 4COPA 2KOQA 1E6JP 2K94A 4CA3A 1YJNP 1RO2A 4U0BA 5BS2A 1N8RQ 2CNRA 3I56P 5KP7B 4H2WC 2EG5A 3H4EA 1UNKA 1AF8A 3M1MA 2P9XA 1VQLP 2FADA 1MZ8A 2FVFA 2EHSA 2K0DX 2EFJA 2AFEA 2LMLA 3CCEP 4GR2A 2MY5A 3G0VA 1KQSO 1YHQP 2KGEA 2N5HA 4F37A 2MVVA 1UJZA 2VLOA 1VQ7P 1OR5A 1YITP 2QNWA 4IZ6A 2PNGA 2KG6A 5KP8B 3CCLP 3HZQA 2JGPA 2FHSC 1A43A 2L9FA 5KP6B 4H2YC 4PWVB 3DPHA 3CC7P 2L22A 2KGDA 2LPKA 1EOQA 1RO0A 1YJ9P 2K5XA 2MF4A 3I55P 2FQ0A 5I4TG 4NEOA 1KD1Q 4QNBA 2KODA 2PEOA 5HGLA 3NTEA 1K73Q 5JPAA 3GZMA 2OTLP 1GXHA 5HVCA 5HGMA 1VQ4P 3CC4P 1Z6MA 2FAEA 1NJIQ 1DV5A 1X3OA 3CC2P 1DNYA 2N6ZA 3CD6P 3G71P 3G29A 2L0QA 3CPWO 2LF4A 1KLPA 2KORA 2NO8A 2MR7A 2K93A 1VHNA 1VQ8P 2ERHA 5F2OA 1BXIA 5HV8A 3NY7B 4H2XC 3U43A 2E1MA 2FQ1A 1IMPA 2CG5B 3RG2A 2FVAA 1L0IA 2FVEA 4XFXA 3CCJP 3CCUP 1BAJA 3G1GA 2QA4P 3DS2A 2OTJP 1EMVA 2LIUA 3G1IA 1VQ5P 2KW2A 2PEIA 2PEMA 2CGQA 1D1DA 2XT1A 2L4BA 2MD9A 3H0DA 3CE7A 1S72P 5HGNA 2GDYA 2CQ8A 2K0YA 2KOPA 5EW5E 2GYKA 1M74A 3Q20A 2VLQA 3G21A 3B5IA 3WBHA 2GZGA 3DS5A 1VQ6P 4WYMA 1Q81Q 1AUMA 2PENA 2JAZA 7CEIA 2LKIA 3RG6C 2EHTA 2BUOA
chains in the Genus database with same CATH topology
2GDWA 4BPGA 1ACPA 2FQ2A 2FAEA 2KG8A 2KOQA 2K94A 2AVAA 1NQ4A 4CA3A 2XZ0D 1DV5A 1X3OA 2FACA 2CNRA 5KP7B 1DNYA 2N6ZA 4H2WC 2KOOA 3EJEA 2KR5A 2L0QA 1HQBA 2AFDA 5CZDB 1VKUA 2JU1A 1AF8A 3EJBA 2KORA 1KLPA 2MR7A 2K93A 2MVUA 4BPFA 2FADA 2FVFA 1T8KA 2EHSA 2KOSA 2N50A 2GDXA 5HV8A 2AFEA 2XZ1C 4MRTC 2LMLA 3NY7B 2MY5A 4H2XC 4BPHA 2KGCA 2LIWA 2FQ1A 2KGAA 2KGEA 2N5HA 3EJDA 2JU2A 2CG5B 3RG2A 4R0MA 2FVAA 2MVVA 2K0XA 1L0IA 2FVEA 2LL8A 1OR5A 5HVCA 2LTEA 2QNWA 4IZ6A 2KWLA 2PNGA 2KG6A 5KP8B 2N6YA 2JGPA 2FHSC 3LMOA 2AF8A 1HY8A 2LIUA 2L9FA 5KP6B 2KW2A 4H2YC 4PWVB 2DNWA 2X2BA 4PXHB 2CGQA 2K2QA 2L22A 2L4BA 2KGDA 2MD9A 4HKGA 3CE7A 2LPKA 2JQ4A 2LOLA 2ROQA 2GDYA 2CQ8A 2MF4A 2FQ0A 2K0YA 3GZLA 2K92A 2N5IA 2KOPA 2N98A 4NEOA 2MR8A 2VSQA 4DG9A 2KG9A 3GZMA 1L0HA 1F80D 2M5RA 2LKIA 5EJDA 2EHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDW A;  4BPG A;  1ACP A;  2FQ2 A;  2FAE A;  2KG8 A;  2KOQ A;  2K94 A;  2AVA A;  1NQ4 A;  4CA3 A;  2XZ0 D;  1DV5 A;  1X3O A;  2FAC A;  2CNR A;  5KP7 B;  1DNY A;  2N6Z A;  4H2W C;  2KOO A;  3EJE A;  2KR5 A;  2L0Q A;  1HQB A;  2AFD A;  5CZD B;  1VKU A;  2JU1 A;  1AF8 A;  3EJB A;  2KOR A;  1KLP A;  2MR7 A;  2K93 A;  2MVU A;  4BPF A;  2FAD A;  2FVF A;  1T8K A;  2EHS A;  2KOS A;  2N50 A;  2GDX A;  5HV8 A;  2AFE A;  2XZ1 C;  4MRT C;  2LML A;  3NY7 B;  2MY5 A;  4H2X C;  4BPH A;  2KGC A;  2LIW A;  2FQ1 A;  2KGA A;  2KGE A;  2N5H A;  3EJD A;  2JU2 A;  2CG5 B;  3RG2 A;  4R0M A;  2FVA A;  2MVV A;  2K0X A;  1L0I A;  2FVE A;  2LL8 A;  1OR5 A;  5HVC A;  2LTE A;  2QNW A;  4IZ6 A;  2KWL A;  2PNG A;  2KG6 A;  5KP8 B;  2N6Y A;  2JGP A;  2FHS C;  3LMO A;  2AF8 A;  1HY8 A;  2LIU A;  2L9F A;  5KP6 B;  2KW2 A;  4H2Y C;  4PWV B;  2DNW A;  2X2B A;  4PXH B;  2CGQ A;  2K2Q A;  2L22 A;  2L4B A;  2KGD A;  2MD9 A;  4HKG A;  3CE7 A;  2LPK A;  2JQ4 A;  2LOL A;  2ROQ A;  2GDY A;  2CQ8 A;  2MF4 A;  2FQ0 A;  2K0Y A;  3GZL A;  2K92 A;  2N5I A;  2KOP A;  2N98 A;  4NEO A;  2MR8 A;  2VSQ A;  4DG9 A;  2KG9 A;  3GZM A;  1L0H A;  1F80 D;  2M5R A;  2LKI A;  5EJD A;  2EHT A; 
#chains in the Genus database with same CATH topology
 3DS1 A;  3G4S P;  2JBG A;  3DS4 A;  1M6E X;  2FQ2 A;  2M8P A;  2KG8 A;  4GR6 A;  1K30 A;  2AVA A;  1NQ4 A;  1ZMB A;  2XZ0 D;  2FAC A;  2PEJ A;  2KOO A;  3EJE A;  1HQB A;  1EIA A;  3VRL C;  1IMQ A;  5CZD B;  1VKU A;  3CCM P;  1M90 Q;  1YIJ P;  1QVF O;  2Z46 A;  2MVU A;  4M0I A;  2GZF A;  1IUQ A;  1CEI A;  1T8K A;  2KOS A;  2N50 A;  2GDX A;  2JYL A;  2XZ1 C;  3DS0 A;  4MRT C;  5F2K A;  1GXG A;  2JU2 A;  4PH0 A;  1Q82 Q;  2K0X A;  1FR2 A;  2LL8 A;  2Z45 A;  2WPT A;  2XV6 A;  1Q7Y Q;  3CME P;  2KWL A;  2VLP A;  3CCQ P;  3E2D A;  5DCK A;  2N6Y A;  3CCR P;  1VQK P;  4IPY A;  3CCS P;  1E0H A;  3G28 A;  2M8L A;  2DNW A;  1YI2 P;  1K9M Q;  2JB0 A;  4U0D A;  2LOL A;  2ROQ A;  3DS3 A;  2N5I A;  4XFY A;  2N98 A;  2VSQ A;  1RNI A;  1VQP P;  2KG9 A;  2GZI A;  2DGY A;  1F80 D;  5EJD A;  2JYG A;  3MGE A;  2GDW A;  2XXM A;  2M8N A;  3LRY A;  1AYI A;  4U0F A;  1GPJ A;  2CWO A;  1QVG O;  1W2B O;  2VLN A;  3CCV P;  2PEQ A;  2KR5 A;  4COC A;  4U0C A;  2AFD A;  4XFZ A;  2JU1 A;  3EJB A;  4QKO A;  3HYB A;  3CXC O;  1M6N A;  1VQ9 P;  4BPF A;  4XRQ A;  4BPH A;  2KGC A;  2LIW A;  2KGA A;  3G26 A;  3EJD A;  5F2N A;  2ONT A;  1K8A Q;  3G6E P;  3P05 A;  4R0M A;  3DTJ A;  3H47 A;  3B4Q A;  5BS1 A;  1M1K Q;  2LTE A;  1KC8 Q;  1VQN P;  1A8O A;  1YJW P;  2JO0 A;  2OAR A;  3LMO A;  2AF8 A;  1HY8 A;  2BHV A;  2GZE A;  4XRO A;  2EIA A;  2X2B A;  2QEX P;  3GKL C;  4PXH B;  2K2Q A;  4U0E A;  4HKG A;  1JJ2 O;  1ZNV A;  1QRJ A;  2JQ4 A;  3GZL A;  2K92 A;  2Z44 A;  3OW2 O;  4PH1 A;  2MR8 A;  4DG9 A;  2PY8 A;  4UHP B;  1VQO P;  2GZJ A;  4U0A A;  2PEK A;  2L6E A;  1L0H A;  1Q86 Q;  2M5R A;  1VQM P;  3CMA P;  4BPG A;  1ACP A;  3GJN A;  5HGO A;  4COP A;  2KOQ A;  1E6J P;  2K94 A;  4CA3 A;  1YJN P;  1RO2 A;  4U0B A;  5BS2 A;  1N8R Q;  2CNR A;  3I56 P;  5KP7 B;  4H2W C;  2EG5 A;  3H4E A;  1UNK A;  1AF8 A;  3M1M A;  2P9X A;  1VQL P;  2FAD A;  1MZ8 A;  2FVF A;  2EHS A;  2K0D X;  2EFJ A;  2AFE A;  2LML A;  3CCE P;  4GR2 A;  2MY5 A;  3G0V A;  1KQS O;  1YHQ P;  2KGE A;  2N5H A;  4F37 A;  2MVV A;  1UJZ A;  2VLO A;  1VQ7 P;  1OR5 A;  1YIT P;  2QNW A;  4IZ6 A;  2PNG A;  2KG6 A;  5KP8 B;  3CCL P;  3HZQ A;  2JGP A;  2FHS C;  1A43 A;  2L9F A;  5KP6 B;  4H2Y C;  4PWV B;  3DPH A;  3CC7 P;  2L22 A;  2KGD A;  2LPK A;  1EOQ A;  1RO0 A;  1YJ9 P;  2K5X A;  2MF4 A;  3I55 P;  2FQ0 A;  5I4T G;  4NEO A;  1KD1 Q;  4QNB A;  2KOD A;  2PEO A;  5HGL A;  3NTE A;  1K73 Q;  5JPA A;  3GZM A;  2OTL P;  1GXH A;  5HVC A;  5HGM A;  1VQ4 P;  3CC4 P;  1Z6M A;  2FAE A;  1NJI Q;  1DV5 A;  1X3O A;  3CC2 P;  1DNY A;  2N6Z A;  3CD6 P;  3G71 P;  3G29 A;  2L0Q A;  3CPW O;  2LF4 A;  1KLP A;  2KOR A;  2NO8 A;  2MR7 A;  2K93 A;  1VHN A;  1VQ8 P;  2ERH A;  5F2O A;  1BXI A;  5HV8 A;  3NY7 B;  4H2X C;  3U43 A;  2E1M A;  2FQ1 A;  1IMP A;  2CG5 B;  3RG2 A;  2FVA A;  1L0I A;  2FVE A;  4XFX A;  3CCJ P;  3CCU P;  1BAJ A;  3G1G A;  2QA4 P;  3DS2 A;  2OTJ P;  1EMV A;  2LIU A;  3G1I A;  1VQ5 P;  2KW2 A;  2PEI A;  2PEM A;  2CGQ A;  1D1D A;  2XT1 A;  2L4B A;  2MD9 A;  3H0D A;  3CE7 A;  1S72 P;  5HGN A;  2GDY A;  2CQ8 A;  2K0Y A;  2KOP A;  5EW5 E;  2GYK A;  1M74 A;  3Q20 A;  2VLQ A;  3G21 A;  3B5I A;  3WBH A;  2GZG A;  3DS5 A;  1VQ6 P;  4WYM A;  1Q81 Q;  1AUM A;  2PEN A;  2JAZ A;  7CEI A;  2LKI A;  3RG6 C;  2EHT A;  2BUO A; 
#chains in the Genus database with same CATH homology
 2GDW A;  4BPG A;  1ACP A;  2FQ2 A;  2FAE A;  2KG8 A;  2KOQ A;  2K94 A;  2AVA A;  1NQ4 A;  4CA3 A;  2XZ0 D;  1DV5 A;  1X3O A;  2FAC A;  2CNR A;  5KP7 B;  1DNY A;  2N6Z A;  4H2W C;  2KOO A;  3EJE A;  2KR5 A;  2L0Q A;  1HQB A;  2AFD A;  5CZD B;  1VKU A;  2JU1 A;  1AF8 A;  3EJB A;  2KOR A;  1KLP A;  2MR7 A;  2K93 A;  2MVU A;  4BPF A;  2FAD A;  2FVF A;  1T8K A;  2EHS A;  2KOS A;  2N50 A;  2GDX A;  5HV8 A;  2AFE A;  2XZ1 C;  4MRT C;  2LML A;  3NY7 B;  2MY5 A;  4H2X C;  4BPH A;  2KGC A;  2LIW A;  2FQ1 A;  2KGA A;  2KGE A;  2N5H A;  3EJD A;  2JU2 A;  2CG5 B;  3RG2 A;  4R0M A;  2FVA A;  2MVV A;  2K0X A;  1L0I A;  2FVE A;  2LL8 A;  1OR5 A;  5HVC A;  2LTE A;  2QNW A;  4IZ6 A;  2KWL A;  2PNG A;  2KG6 A;  5KP8 B;  2N6Y A;  2JGP A;  2FHS C;  3LMO A;  2AF8 A;  1HY8 A;  2LIU A;  2L9F A;  5KP6 B;  2KW2 A;  4H2Y C;  4PWV B;  2DNW A;  2X2B A;  4PXH B;  2CGQ A;  2K2Q A;  2L22 A;  2L4B A;  2KGD A;  2MD9 A;  4HKG A;  3CE7 A;  2LPK A;  2JQ4 A;  2LOL A;  2ROQ A;  2GDY A;  2CQ8 A;  2MF4 A;  2FQ0 A;  2K0Y A;  3GZL A;  2K92 A;  2N5I A;  2KOP A;  2N98 A;  4NEO A;  2MR8 A;  2VSQ A;  4DG9 A;  2KG9 A;  3GZM A;  1L0H A;  1F80 D;  2M5R A;  2LKI A;  5EJD A;  2EHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...