2KOSA

Nmr solution structures of octanoyl-acp from streptomyces coelicolor fatty acid synthase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport protein
molecule keywords Acyl carrier protein
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kosA00
4PWVB 1ACPA 1X3OA 2N50A 2N6ZA 4H2YC 2DNWA 2KOSA 1HQBA 2MR8A 1OR5A 2M5RA 2QNWA 2KOOA 4CA3A 1VKUA 3EJEA 2AF8A 1T8KA 2CG5B 3GZMA 2N98A 2VSQA 2CGQA 2KGEA 2N6YA 1L0HA 2FVFA 3EJBA 4IZ6A 4BPGA 4BPHA 4H2WC 2FAEA 1KLPA 2KOPA 2LTEA 4BPFA 2AVAA 1F80D 2XZ1C 2ROQA 2FHSC 2EHTA 2CNRA 2LIUA 3EJDA 4PXHB 2LL8A 4DG9A 2MVVA 2EHSA 2K94A 2KGDA 2KW2A 2JU1A 2FQ1A 2N5IA 2AFDA 2JGPA 2JQ4A 2KGCA 2MF4A 2L9FA 2LOLA 2KG9A 5KP7B 2AFEA 1NQ4A 3NY7B 5CZDB 2GDXA 2LPKA 1HY8A 5EJDA 2KR5A 2KG6A 2K2QA 2KGAA 2FQ2A 2MD9A 2JU2A 2XZ0D 2KG8A 2LKIA 5HVCA 2N5HA 2L0QA 4H2XC 2FVAA 1AF8A 3GZLA 2FADA 4HKGA 1DV5A 2KOQA 1DNYA 4R0MA 2GDYA 2PNGA 2L22A 2CQ8A 2KWLA 2GDWA 1L0IA 2LMLA 4NEOA 5HV8A 2FVEA 2K93A 2FQ0A 4MRTC 2MVUA 2FACA 2L4BA 2LIWA 2K0XA 2KORA 5KP8B 5KP6B 2MR7A 2K0YA 3RG2A 2MY5A 3LMOA 2X2BA 3CE7A 2K92A
chains in the Genus database with same CATH superfamily
3CCUP 1JJ2O 4PWVB 2N6ZA 1GXGA 2CG5B 4U0FA 2VSQA 2GZGA 2KGEA 2N6YA 1L0HA 3HZQA 4BPGA 4BPHA 2EFJA 1EMVA 1KLPA 2LTEA 3G21A 1VQ9P 2BUOA 1F80D 3LRYA 1VQOP 1M6EX 2LIUA 2LL8A 3CC4P 3VRLC 1A43A 1IMQA 2GZIA 2KGDA 2KW2A 4XROA 2KGCA 5HGOA 3CC7P 1YIJP 2EIAA 1HY8A 2PEJA 3Q20A 2PEQA 2KGAA 2PEOA 2PEMA 3DPHA 5HVCA 1A8OA 4U0CA 1RNIA 2N5HA 4XRQA 1N8RQ 2DGYA 4WYMA 2PENA 3GZLA 1FR2A 2KOQA 5HGMA 1VQ4P 2L22A 2KODA 1L0IA 2LMLA 2M8LA 3P05A 1QVFO 2FACA 2ONTA 3DS4A 2VLQA 3E2DA 3G4SP 3I55P 2XV6A 5F2KA 1E6JP 3CCLP 5F2OA 2K0YA 3RG2A 3CCMP 2Z44A 3CXCO 1X3OA 1YI2P 3I56P 2DNWA 2JO0A 2KOSA 4CA3A 1VKUA 4COPA 1ZMBA 1T8KA 2N98A 3CCEP 1VQ5P 2XT1A 2KOPA 2XXMA 2AVAA 2Z45A 2XZ1C 2K5XA 2FHSC 2CNRA 2EHTA 3EJDA 4DG9A 2MVVA 4COCA 1KQSO 2M8PA 2N5IA 2ERHA 1M6NA 2AFDA 2JGPA 4XFZA 1Z6MA 1GXHA 2KG9A 2EG5A 1NQ4A 3NY7B 2VLNA 3CCQP 1VQPP 5EJDA 1VQLP 2KG6A 2K2QA 3H4EA 5JPAA 2FQ2A 2XZ0D 4XFYA 1M90Q 2KG8A 4XFXA 4GR2A 5HGNA 1AYIA 4H2XC 3CPWO 3CC2P 1UJZA 1YHQP 3CMEP 1YJNP 2GDWA 1K30A 1AUMA 2FVEA 2K93A 1W2BO 3CCVP 3G28A 2L4BA 2K0XA 1YJ9P 2WPTA 1VHNA 2E1MA 4QNBA 3CMAP 2MY5A 2X2BA 2VLPA 2CWOA 3NTEA 1Q7YQ 4H2YC 1OR5A 2M5RA 2QNWA 1D1DA 1YITP 3CCJP 3DS5A 4U0EA 1CEIA 2FVFA 2JYLA 2FAEA 1IMPA 2PY8A 3G1GA 1Q82Q 4BPFA 1VQKP 2M8NA 2PEKA 3G26A 2ROQA 2JBGA 2BHVA 2EHSA 4GR6A 1S72P 2JU1A 4F37A 4UHPB 1QVGO 2JQ4A 2JAZA 2MF4A 1QRJA 3DS3A 3G29A 4U0AA 2LOLA 2AFEA 5CZDB 5DCKA 7CEIA 1KC8Q 2LKIA 3GJNA 2VLOA 3HYBA 3H47A 2FVAA 3DS1A 1M74A 2GZEA 1DV5A 5F2NA 2PNGA 2CQ8A 3U43A 1VQNP 3DS0A 3G6EP 5EW5E 2NO8A 2GZFA 1IUQA 2JB0A 4M0IA 1EOQA 1K9MQ 4MRTC 5BS1A 2OTLP 1VQMP 2KORA 2OARA 2MR7A 5I4TG 3CCSP 3CE7A 1RO2A 1UNKA 1ACPA 1Q81Q 3G0VA 5HGLA 2N50A 1VQ8P 2OTJP 1HQBA 2MR8A 2KOOA 3EJEA 2AF8A 3DS2A 1ZNVA 3GZMA 2CGQA 3CD6P 1BXIA 2GYKA 3EJBA 4IZ6A 4H2WC 1VQ7P 1EIAA 3GKLC 2Z46A 1VQ6P 4PXHB 4PH0A 1BAJA 2K94A 5BS2A 2FQ1A 1E0HA 1MZ8A 2JYGA 2L9FA 1K8AQ 5KP7B 3B5IA 2GDXA 2LPKA 1Q86Q 2QEXP 3RG6C 2KR5A 1NJIQ 2MD9A 2JU2A 3G71P 2L0QA 1YJWP 2P9XA 1AF8A 2K0DX 2FADA 4HKGA 3B4QA 2LF4A 1M1KQ 1DNYA 4R0MA 2GDYA 3DTJA 2PEIA 2KWLA 4QKOA 5HV8A 4NEOA 2L6EA 3WBHA 3M1MA 2FQ0A 3MGEA 2QA4P 2GZJA 4IPYA 2MVUA 1K73Q 2LIWA 3OW2O 3CCRP 1RO0A 3G1IA 3H0DA 1GPJA 4U0DA 1KD1Q 5KP8B 5KP6B 4PH1A 4U0BA 3LMOA 2K92A
chains in the Genus database with same CATH topology
4PWVB 1ACPA 1X3OA 2N50A 2N6ZA 4H2YC 2DNWA 2KOSA 1HQBA 2MR8A 1OR5A 2M5RA 2QNWA 2KOOA 4CA3A 1VKUA 3EJEA 2AF8A 1T8KA 2CG5B 3GZMA 2N98A 2VSQA 2CGQA 2KGEA 2N6YA 1L0HA 2FVFA 3EJBA 4IZ6A 4BPGA 4BPHA 4H2WC 2FAEA 1KLPA 2KOPA 2LTEA 4BPFA 2AVAA 1F80D 2XZ1C 2ROQA 2FHSC 2EHTA 2CNRA 2LIUA 3EJDA 4PXHB 2LL8A 4DG9A 2MVVA 2EHSA 2K94A 2KGDA 2KW2A 2JU1A 2FQ1A 2N5IA 2AFDA 2JGPA 2JQ4A 2KGCA 2MF4A 2L9FA 2LOLA 2KG9A 5KP7B 2AFEA 1NQ4A 3NY7B 5CZDB 2GDXA 2LPKA 1HY8A 5EJDA 2KR5A 2KG6A 2K2QA 2KGAA 2FQ2A 2MD9A 2JU2A 2XZ0D 2KG8A 2LKIA 5HVCA 2N5HA 2L0QA 4H2XC 2FVAA 1AF8A 3GZLA 2FADA 4HKGA 1DV5A 2KOQA 1DNYA 4R0MA 2GDYA 2PNGA 2L22A 2CQ8A 2KWLA 2GDWA 1L0IA 2LMLA 4NEOA 5HV8A 2FVEA 2K93A 2FQ0A 4MRTC 2MVUA 2FACA 2L4BA 2LIWA 2K0XA 2KORA 5KP8B 5KP6B 2MR7A 2K0YA 3RG2A 2MY5A 3LMOA 2X2BA 3CE7A 2K92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PWV B;  1ACP A;  1X3O A;  2N50 A;  2N6Z A;  4H2Y C;  2DNW A;  2KOS A;  1HQB A;  2MR8 A;  1OR5 A;  2M5R A;  2QNW A;  2KOO A;  4CA3 A;  1VKU A;  3EJE A;  2AF8 A;  1T8K A;  2CG5 B;  3GZM A;  2N98 A;  2VSQ A;  2CGQ A;  2KGE A;  2N6Y A;  1L0H A;  2FVF A;  3EJB A;  4IZ6 A;  4BPG A;  4BPH A;  4H2W C;  2FAE A;  1KLP A;  2KOP A;  2LTE A;  4BPF A;  2AVA A;  1F80 D;  2XZ1 C;  2ROQ A;  2FHS C;  2EHT A;  2CNR A;  2LIU A;  3EJD A;  4PXH B;  2LL8 A;  4DG9 A;  2MVV A;  2EHS A;  2K94 A;  2KGD A;  2KW2 A;  2JU1 A;  2FQ1 A;  2N5I A;  2AFD A;  2JGP A;  2JQ4 A;  2KGC A;  2MF4 A;  2L9F A;  2LOL A;  2KG9 A;  5KP7 B;  2AFE A;  1NQ4 A;  3NY7 B;  5CZD B;  2GDX A;  2LPK A;  1HY8 A;  5EJD A;  2KR5 A;  2KG6 A;  2K2Q A;  2KGA A;  2FQ2 A;  2MD9 A;  2JU2 A;  2XZ0 D;  2KG8 A;  2LKI A;  5HVC A;  2N5H A;  2L0Q A;  4H2X C;  2FVA A;  1AF8 A;  3GZL A;  2FAD A;  4HKG A;  1DV5 A;  2KOQ A;  1DNY A;  4R0M A;  2GDY A;  2PNG A;  2L22 A;  2CQ8 A;  2KWL A;  2GDW A;  1L0I A;  2LML A;  4NEO A;  5HV8 A;  2FVE A;  2K93 A;  2FQ0 A;  4MRT C;  2MVU A;  2FAC A;  2L4B A;  2LIW A;  2K0X A;  2KOR A;  5KP8 B;  5KP6 B;  2MR7 A;  2K0Y A;  3RG2 A;  2MY5 A;  3LMO A;  2X2B A;  3CE7 A;  2K92 A; 
#chains in the Genus database with same CATH topology
 3CCU P;  1JJ2 O;  4PWV B;  2N6Z A;  1GXG A;  2CG5 B;  4U0F A;  2VSQ A;  2GZG A;  2KGE A;  2N6Y A;  1L0H A;  3HZQ A;  4BPG A;  4BPH A;  2EFJ A;  1EMV A;  1KLP A;  2LTE A;  3G21 A;  1VQ9 P;  2BUO A;  1F80 D;  3LRY A;  1VQO P;  1M6E X;  2LIU A;  2LL8 A;  3CC4 P;  3VRL C;  1A43 A;  1IMQ A;  2GZI A;  2KGD A;  2KW2 A;  4XRO A;  2KGC A;  5HGO A;  3CC7 P;  1YIJ P;  2EIA A;  1HY8 A;  2PEJ A;  3Q20 A;  2PEQ A;  2KGA A;  2PEO A;  2PEM A;  3DPH A;  5HVC A;  1A8O A;  4U0C A;  1RNI A;  2N5H A;  4XRQ A;  1N8R Q;  2DGY A;  4WYM A;  2PEN A;  3GZL A;  1FR2 A;  2KOQ A;  5HGM A;  1VQ4 P;  2L22 A;  2KOD A;  1L0I A;  2LML A;  2M8L A;  3P05 A;  1QVF O;  2FAC A;  2ONT A;  3DS4 A;  2VLQ A;  3E2D A;  3G4S P;  3I55 P;  2XV6 A;  5F2K A;  1E6J P;  3CCL P;  5F2O A;  2K0Y A;  3RG2 A;  3CCM P;  2Z44 A;  3CXC O;  1X3O A;  1YI2 P;  3I56 P;  2DNW A;  2JO0 A;  2KOS A;  4CA3 A;  1VKU A;  4COP A;  1ZMB A;  1T8K A;  2N98 A;  3CCE P;  1VQ5 P;  2XT1 A;  2KOP A;  2XXM A;  2AVA A;  2Z45 A;  2XZ1 C;  2K5X A;  2FHS C;  2CNR A;  2EHT A;  3EJD A;  4DG9 A;  2MVV A;  4COC A;  1KQS O;  2M8P A;  2N5I A;  2ERH A;  1M6N A;  2AFD A;  2JGP A;  4XFZ A;  1Z6M A;  1GXH A;  2KG9 A;  2EG5 A;  1NQ4 A;  3NY7 B;  2VLN A;  3CCQ P;  1VQP P;  5EJD A;  1VQL P;  2KG6 A;  2K2Q A;  3H4E A;  5JPA A;  2FQ2 A;  2XZ0 D;  4XFY A;  1M90 Q;  2KG8 A;  4XFX A;  4GR2 A;  5HGN A;  1AYI A;  4H2X C;  3CPW O;  3CC2 P;  1UJZ A;  1YHQ P;  3CME P;  1YJN P;  2GDW A;  1K30 A;  1AUM A;  2FVE A;  2K93 A;  1W2B O;  3CCV P;  3G28 A;  2L4B A;  2K0X A;  1YJ9 P;  2WPT A;  1VHN A;  2E1M A;  4QNB A;  3CMA P;  2MY5 A;  2X2B A;  2VLP A;  2CWO A;  3NTE A;  1Q7Y Q;  4H2Y C;  1OR5 A;  2M5R A;  2QNW A;  1D1D A;  1YIT P;  3CCJ P;  3DS5 A;  4U0E A;  1CEI A;  2FVF A;  2JYL A;  2FAE A;  1IMP A;  2PY8 A;  3G1G A;  1Q82 Q;  4BPF A;  1VQK P;  2M8N A;  2PEK A;  3G26 A;  2ROQ A;  2JBG A;  2BHV A;  2EHS A;  4GR6 A;  1S72 P;  2JU1 A;  4F37 A;  4UHP B;  1QVG O;  2JQ4 A;  2JAZ A;  2MF4 A;  1QRJ A;  3DS3 A;  3G29 A;  4U0A A;  2LOL A;  2AFE A;  5CZD B;  5DCK A;  7CEI A;  1KC8 Q;  2LKI A;  3GJN A;  2VLO A;  3HYB A;  3H47 A;  2FVA A;  3DS1 A;  1M74 A;  2GZE A;  1DV5 A;  5F2N A;  2PNG A;  2CQ8 A;  3U43 A;  1VQN P;  3DS0 A;  3G6E P;  5EW5 E;  2NO8 A;  2GZF A;  1IUQ A;  2JB0 A;  4M0I A;  1EOQ A;  1K9M Q;  4MRT C;  5BS1 A;  2OTL P;  1VQM P;  2KOR A;  2OAR A;  2MR7 A;  5I4T G;  3CCS P;  3CE7 A;  1RO2 A;  1UNK A;  1ACP A;  1Q81 Q;  3G0V A;  5HGL A;  2N50 A;  1VQ8 P;  2OTJ P;  1HQB A;  2MR8 A;  2KOO A;  3EJE A;  2AF8 A;  3DS2 A;  1ZNV A;  3GZM A;  2CGQ A;  3CD6 P;  1BXI A;  2GYK A;  3EJB A;  4IZ6 A;  4H2W C;  1VQ7 P;  1EIA A;  3GKL C;  2Z46 A;  1VQ6 P;  4PXH B;  4PH0 A;  1BAJ A;  2K94 A;  5BS2 A;  2FQ1 A;  1E0H A;  1MZ8 A;  2JYG A;  2L9F A;  1K8A Q;  5KP7 B;  3B5I A;  2GDX A;  2LPK A;  1Q86 Q;  2QEX P;  3RG6 C;  2KR5 A;  1NJI Q;  2MD9 A;  2JU2 A;  3G71 P;  2L0Q A;  1YJW P;  2P9X A;  1AF8 A;  2K0D X;  2FAD A;  4HKG A;  3B4Q A;  2LF4 A;  1M1K Q;  1DNY A;  4R0M A;  2GDY A;  3DTJ A;  2PEI A;  2KWL A;  4QKO A;  5HV8 A;  4NEO A;  2L6E A;  3WBH A;  3M1M A;  2FQ0 A;  3MGE A;  2QA4 P;  2GZJ A;  4IPY A;  2MVU A;  1K73 Q;  2LIW A;  3OW2 O;  3CCR P;  1RO0 A;  3G1I A;  3H0D A;  1GPJ A;  4U0D A;  1KD1 Q;  5KP8 B;  5KP6 B;  4PH1 A;  4U0B A;  3LMO A;  2K92 A; 
#chains in the Genus database with same CATH homology
 4PWV B;  1ACP A;  1X3O A;  2N50 A;  2N6Z A;  4H2Y C;  2DNW A;  2KOS A;  1HQB A;  2MR8 A;  1OR5 A;  2M5R A;  2QNW A;  2KOO A;  4CA3 A;  1VKU A;  3EJE A;  2AF8 A;  1T8K A;  2CG5 B;  3GZM A;  2N98 A;  2VSQ A;  2CGQ A;  2KGE A;  2N6Y A;  1L0H A;  2FVF A;  3EJB A;  4IZ6 A;  4BPG A;  4BPH A;  4H2W C;  2FAE A;  1KLP A;  2KOP A;  2LTE A;  4BPF A;  2AVA A;  1F80 D;  2XZ1 C;  2ROQ A;  2FHS C;  2EHT A;  2CNR A;  2LIU A;  3EJD A;  4PXH B;  2LL8 A;  4DG9 A;  2MVV A;  2EHS A;  2K94 A;  2KGD A;  2KW2 A;  2JU1 A;  2FQ1 A;  2N5I A;  2AFD A;  2JGP A;  2JQ4 A;  2KGC A;  2MF4 A;  2L9F A;  2LOL A;  2KG9 A;  5KP7 B;  2AFE A;  1NQ4 A;  3NY7 B;  5CZD B;  2GDX A;  2LPK A;  1HY8 A;  5EJD A;  2KR5 A;  2KG6 A;  2K2Q A;  2KGA A;  2FQ2 A;  2MD9 A;  2JU2 A;  2XZ0 D;  2KG8 A;  2LKI A;  5HVC A;  2N5H A;  2L0Q A;  4H2X C;  2FVA A;  1AF8 A;  3GZL A;  2FAD A;  4HKG A;  1DV5 A;  2KOQ A;  1DNY A;  4R0M A;  2GDY A;  2PNG A;  2L22 A;  2CQ8 A;  2KWL A;  2GDW A;  1L0I A;  2LML A;  4NEO A;  5HV8 A;  2FVE A;  2K93 A;  2FQ0 A;  4MRT C;  2MVU A;  2FAC A;  2L4B A;  2LIW A;  2K0X A;  2KOR A;  5KP8 B;  5KP6 B;  2MR7 A;  2K0Y A;  3RG2 A;  2MY5 A;  3LMO A;  2X2B A;  3CE7 A;  2K92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...