2KOSA

Nmr solution structures of octanoyl-acp from streptomyces coelicolor fatty acid synthase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Acyl carrier protein
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kosA00
2KR5A 2MR8A 2FQ0A 1X3OA 2CGQA 4DG9A 2AVAA 2MY5A 2KG9A 5KP7B 2DNWA 2K92A 5CZDB 1OR5A 1HQBA 2FVEA 3EJEA 4H2XC 2N5HA 1AF8A 2X2BA 4HKGA 4BPHA 2L9FA 1DNYA 2VSQA 4PWVB 2GDWA 2KW2A 3NY7B 2K0YA 2LIUA 4R0MA 1L0HA 4H2YC 2FVAA 2JU1A 5HVCA 2L4BA 5HV8A 1DV5A 1L0IA 2AFEA 2FADA 2KG8A 2MR7A 2ROQA 2AF8A 4BPGA 2LTEA 4CA3A 2LPKA 2FHSC 2LKIA 2CQ8A 2K93A 1VKUA 2KGCA 2CNRA 2CG5B 2KOSA 3GZLA 2XZ0D 2N6ZA 2K2QA 2JGPA 2LIWA 2LL8A 2JQ4A 2L0QA 4IZ6A 2MD9A 3LMOA 5EJDA 4BPFA 3GZMA 2QNWA 2K94A 2PNGA 2KOOA 2KOQA 3EJBA 4H2WC 2FACA 2FQ2A 5KP6B 2LMLA 3CE7A 4PXHB 2KWLA 2AFDA 2KOPA 2JU2A 2KG6A 1T8KA 3EJDA 2FAEA 2EHSA 5KP8B 1KLPA 1ACPA 2KGAA 1NQ4A 2FVFA 1HY8A 2EHTA 3RG2A 2N98A 2FQ1A 2KGEA 2N50A 2XZ1C 2KORA 2KGDA 2L22A 4MRTC 2K0XA 2MVUA 2MF4A 2GDYA 2GDXA 2N6YA 2N5IA 4NEOA 2LOLA 2M5RA 1F80D 2MVVA
chains in the Genus database with same CATH superfamily
1VQ8P 1VQLP 1K73Q 4PH0A 2PEIA 2MY5A 2DNWA 4U0BA 3G21A 3G28A 1EIAA 2PEMA 4H2XC 3B4QA 1VHNA 1DNYA 2VSQA 3NY7B 2LIUA 4R0MA 3B5IA 5HV8A 2AFEA 4XRQA 4XFYA 1RO0A 3CXCO 5DCKA 2FHSC 1YIJP 5BS1A 1EOQA 2N6ZA 2LIWA 2L0QA 4IZ6A 3LMOA 2VLOA 5EJDA 1YJ9P 2JYGA 4QNBA 4XFXA 1Q81Q 3EJBA 5KP6B 2PEQA 3EJDA 2FVFA 2EHTA 3G29A 2N98A 2N50A 1IMQA 2KGDA 2NO8A 3CC2P 1D1DA 1S72P 4U0DA 3OW2O 4NEOA 2QA4P 3H4EA 2M5RA 1QVGO 1W2BO 2DGYA 3DS3A 2KR5A 3DS5A 3CCVP 2MR8A 1GXHA 1X3OA 2CGQA 4DG9A 4GR2A 1K30A 5HGOA 2CWOA 2K92A 1JJ2O 3CCMP 4WYMA 3CCUP 1EMVA 1VQ7P 1AF8A 4HKGA 3NTEA 2L9FA 2K0DX 1VQOP 4XROA 1N8RQ 1L0HA 1GXGA 2JU1A 3GKLC 1Q7YQ 4GR6A 2L4BA 5BS2A 1L0IA 1ZMBA 5HGLA 2AF8A 2LTEA 1CEIA 2LPKA 4U0EA 5F2NA 1M90Q 2CG5B 2KOSA 3GZLA 3CCQP 2MD9A 2VLPA 4BPFA 2JAZA 2K94A 3CPWO 2EIAA 3CC7P 2KOOA 2PEJA 2VLNA 4U0CA 2JB0A 4H2WC 2FACA 2LMLA 3CCEP 1E6JP 1BXIA 4PXHB 2AFDA 3CC4P 2ERHA 1M6NA 2GZIA 2Z45A 5KP8B 2FAEA 4COCA 1KLPA 2JO0A 2KGAA 1RNIA 3G1IA 2FQ1A 4M0IA 3G6EP 1IMPA 3CMEP 3Q20A 2K0XA 1AUMA 1VQKP 3CCJP 3P05A 2N6YA 2N5IA 1VQ6P 2LF4A 3G0VA 1AYIA 2JYLA 3HZQA 2M8PA 2XV6A 2P9XA 2K5XA 1Q82Q 1OR5A 3DTJA 1M1KQ 1HQBA 2FVEA 3EJEA 3CCLP 4XFZA 2X2BA 2Z44A 4BPHA 3DS2A 2GDWA 2M8NA 1A8OA 1QRJA 3H47A 1K8AQ 3CCRP 3DS4A 3E2DA 1K9MQ 2OARA 2WPTA 2FADA 2ROQA 5F2OA 4UHPB 3I56P 1Z6MA 4CA3A 2L6EA 3G4SP 1NJIQ 2BUOA 2CQ8A 2K93A 1VQPP 2KGCA 2CNRA 2EG5A 1YHQP 1KQSO 2JGPA 2XXMA 2LL8A 1VQ5P 5HGMA 1Q86Q 5EW5E 1IUQA 4U0AA 3GJNA 2PEKA 2KOQA 1RO2A 2JBGA 2FQ2A 3CE7A 2KOPA 2JU2A 3G71P 2KG6A 1T8KA 1ACPA 5HGNA 3DPHA 3RG2A 1HY8A 2QEXP 2KGEA 1MZ8A 2XZ1C 2KORA 3RG6C 5I4TG 2MF4A 4U0FA 2GDYA 2GDXA 3H0DA 1UJZA 1F80D 1YI2P 1YJWP 2MVVA 4QKOA 2FQ0A 2ONTA 1VQ4P 5JPAA 1A43A 2VLQA 2KODA 2OTLP 3HYBA 2AVAA 2KG9A 2EFJA 5KP7B 3MGEA 3DS0A 5CZDB 1YITP 2GZGA 1VQMP 1M74A 2N5HA 2E1MA 2GZEA 4PH1A 1VQNP 2BHVA 4COPA 3G26A 4PWVB 2KW2A 2K0YA 3DS1A 4H2YC 2FVAA 5HVCA 1DV5A 2GYKA 1KD1Q 2KG8A 3WBHA 2MR7A 1QVFO 4BPGA 4IPYA 2XT1A 2LKIA 2PENA 1VKUA 2Z46A 2PEOA 3CCSP 1FR2A 2XZ0D 2K2QA 3CD6P 2JQ4A 3CMAP 3G1GA 3M1MA 3GZMA 2QNWA 3I55P 1ZNVA 1KC8Q 2PNGA 1M6EX 7CEIA 2KWLA 2M8LA 2PY8A 2GZFA 3LRYA 2EHSA 5F2KA 2OTJP 1NQ4A 4F37A 1UNKA 1E0HA 2L22A 4MRTC 3VRLC 2MVUA 1VQ9P 3U43A 1YJNP 2GZJA 1BAJA 2LOLA 1GPJA
chains in the Genus database with same CATH topology
2KR5A 2MR8A 2FQ0A 1X3OA 2CGQA 4DG9A 2AVAA 2MY5A 2KG9A 5KP7B 2DNWA 2K92A 5CZDB 1OR5A 1HQBA 2FVEA 3EJEA 4H2XC 2N5HA 1AF8A 2X2BA 4HKGA 4BPHA 2L9FA 1DNYA 2VSQA 4PWVB 2GDWA 2KW2A 3NY7B 2K0YA 2LIUA 4R0MA 1L0HA 4H2YC 2FVAA 2JU1A 5HVCA 2L4BA 5HV8A 1DV5A 1L0IA 2AFEA 2FADA 2KG8A 2MR7A 2ROQA 2AF8A 4BPGA 2LTEA 4CA3A 2LPKA 2FHSC 2LKIA 2CQ8A 2K93A 1VKUA 2KGCA 2CNRA 2CG5B 2KOSA 3GZLA 2XZ0D 2N6ZA 2K2QA 2JGPA 2LIWA 2LL8A 2JQ4A 2L0QA 4IZ6A 2MD9A 3LMOA 5EJDA 4BPFA 3GZMA 2QNWA 2K94A 2PNGA 2KOOA 2KOQA 3EJBA 4H2WC 2FACA 2FQ2A 5KP6B 2LMLA 3CE7A 4PXHB 2KWLA 2AFDA 2KOPA 2JU2A 2KG6A 1T8KA 3EJDA 2FAEA 2EHSA 5KP8B 1KLPA 1ACPA 2KGAA 1NQ4A 2FVFA 1HY8A 2EHTA 3RG2A 2N98A 2FQ1A 2KGEA 2N50A 2XZ1C 2KORA 2KGDA 2L22A 4MRTC 2K0XA 2MVUA 2MF4A 2GDYA 2GDXA 2N6YA 2N5IA 4NEOA 2LOLA 2M5RA 1F80D 2MVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR5 A;  2MR8 A;  2FQ0 A;  1X3O A;  2CGQ A;  4DG9 A;  2AVA A;  2MY5 A;  2KG9 A;  5KP7 B;  2DNW A;  2K92 A;  5CZD B;  1OR5 A;  1HQB A;  2FVE A;  3EJE A;  4H2X C;  2N5H A;  1AF8 A;  2X2B A;  4HKG A;  4BPH A;  2L9F A;  1DNY A;  2VSQ A;  4PWV B;  2GDW A;  2KW2 A;  3NY7 B;  2K0Y A;  2LIU A;  4R0M A;  1L0H A;  4H2Y C;  2FVA A;  2JU1 A;  5HVC A;  2L4B A;  5HV8 A;  1DV5 A;  1L0I A;  2AFE A;  2FAD A;  2KG8 A;  2MR7 A;  2ROQ A;  2AF8 A;  4BPG A;  2LTE A;  4CA3 A;  2LPK A;  2FHS C;  2LKI A;  2CQ8 A;  2K93 A;  1VKU A;  2KGC A;  2CNR A;  2CG5 B;  2KOS A;  3GZL A;  2XZ0 D;  2N6Z A;  2K2Q A;  2JGP A;  2LIW A;  2LL8 A;  2JQ4 A;  2L0Q A;  4IZ6 A;  2MD9 A;  3LMO A;  5EJD A;  4BPF A;  3GZM A;  2QNW A;  2K94 A;  2PNG A;  2KOO A;  2KOQ A;  3EJB A;  4H2W C;  2FAC A;  2FQ2 A;  5KP6 B;  2LML A;  3CE7 A;  4PXH B;  2KWL A;  2AFD A;  2KOP A;  2JU2 A;  2KG6 A;  1T8K A;  3EJD A;  2FAE A;  2EHS A;  5KP8 B;  1KLP A;  1ACP A;  2KGA A;  1NQ4 A;  2FVF A;  1HY8 A;  2EHT A;  3RG2 A;  2N98 A;  2FQ1 A;  2KGE A;  2N50 A;  2XZ1 C;  2KOR A;  2KGD A;  2L22 A;  4MRT C;  2K0X A;  2MVU A;  2MF4 A;  2GDY A;  2GDX A;  2N6Y A;  2N5I A;  4NEO A;  2LOL A;  2M5R A;  1F80 D;  2MVV A; 
#chains in the Genus database with same CATH topology
 1VQ8 P;  1VQL P;  1K73 Q;  4PH0 A;  2PEI A;  2MY5 A;  2DNW A;  4U0B A;  3G21 A;  3G28 A;  1EIA A;  2PEM A;  4H2X C;  3B4Q A;  1VHN A;  1DNY A;  2VSQ A;  3NY7 B;  2LIU A;  4R0M A;  3B5I A;  5HV8 A;  2AFE A;  4XRQ A;  4XFY A;  1RO0 A;  3CXC O;  5DCK A;  2FHS C;  1YIJ P;  5BS1 A;  1EOQ A;  2N6Z A;  2LIW A;  2L0Q A;  4IZ6 A;  3LMO A;  2VLO A;  5EJD A;  1YJ9 P;  2JYG A;  4QNB A;  4XFX A;  1Q81 Q;  3EJB A;  5KP6 B;  2PEQ A;  3EJD A;  2FVF A;  2EHT A;  3G29 A;  2N98 A;  2N50 A;  1IMQ A;  2KGD A;  2NO8 A;  3CC2 P;  1D1D A;  1S72 P;  4U0D A;  3OW2 O;  4NEO A;  2QA4 P;  3H4E A;  2M5R A;  1QVG O;  1W2B O;  2DGY A;  3DS3 A;  2KR5 A;  3DS5 A;  3CCV P;  2MR8 A;  1GXH A;  1X3O A;  2CGQ A;  4DG9 A;  4GR2 A;  1K30 A;  5HGO A;  2CWO A;  2K92 A;  1JJ2 O;  3CCM P;  4WYM A;  3CCU P;  1EMV A;  1VQ7 P;  1AF8 A;  4HKG A;  3NTE A;  2L9F A;  2K0D X;  1VQO P;  4XRO A;  1N8R Q;  1L0H A;  1GXG A;  2JU1 A;  3GKL C;  1Q7Y Q;  4GR6 A;  2L4B A;  5BS2 A;  1L0I A;  1ZMB A;  5HGL A;  2AF8 A;  2LTE A;  1CEI A;  2LPK A;  4U0E A;  5F2N A;  1M90 Q;  2CG5 B;  2KOS A;  3GZL A;  3CCQ P;  2MD9 A;  2VLP A;  4BPF A;  2JAZ A;  2K94 A;  3CPW O;  2EIA A;  3CC7 P;  2KOO A;  2PEJ A;  2VLN A;  4U0C A;  2JB0 A;  4H2W C;  2FAC A;  2LML A;  3CCE P;  1E6J P;  1BXI A;  4PXH B;  2AFD A;  3CC4 P;  2ERH A;  1M6N A;  2GZI A;  2Z45 A;  5KP8 B;  2FAE A;  4COC A;  1KLP A;  2JO0 A;  2KGA A;  1RNI A;  3G1I A;  2FQ1 A;  4M0I A;  3G6E P;  1IMP A;  3CME P;  3Q20 A;  2K0X A;  1AUM A;  1VQK P;  3CCJ P;  3P05 A;  2N6Y A;  2N5I A;  1VQ6 P;  2LF4 A;  3G0V A;  1AYI A;  2JYL A;  3HZQ A;  2M8P A;  2XV6 A;  2P9X A;  2K5X A;  1Q82 Q;  1OR5 A;  3DTJ A;  1M1K Q;  1HQB A;  2FVE A;  3EJE A;  3CCL P;  4XFZ A;  2X2B A;  2Z44 A;  4BPH A;  3DS2 A;  2GDW A;  2M8N A;  1A8O A;  1QRJ A;  3H47 A;  1K8A Q;  3CCR P;  3DS4 A;  3E2D A;  1K9M Q;  2OAR A;  2WPT A;  2FAD A;  2ROQ A;  5F2O A;  4UHP B;  3I56 P;  1Z6M A;  4CA3 A;  2L6E A;  3G4S P;  1NJI Q;  2BUO A;  2CQ8 A;  2K93 A;  1VQP P;  2KGC A;  2CNR A;  2EG5 A;  1YHQ P;  1KQS O;  2JGP A;  2XXM A;  2LL8 A;  1VQ5 P;  5HGM A;  1Q86 Q;  5EW5 E;  1IUQ A;  4U0A A;  3GJN A;  2PEK A;  2KOQ A;  1RO2 A;  2JBG A;  2FQ2 A;  3CE7 A;  2KOP A;  2JU2 A;  3G71 P;  2KG6 A;  1T8K A;  1ACP A;  5HGN A;  3DPH A;  3RG2 A;  1HY8 A;  2QEX P;  2KGE A;  1MZ8 A;  2XZ1 C;  2KOR A;  3RG6 C;  5I4T G;  2MF4 A;  4U0F A;  2GDY A;  2GDX A;  3H0D A;  1UJZ A;  1F80 D;  1YI2 P;  1YJW P;  2MVV A;  4QKO A;  2FQ0 A;  2ONT A;  1VQ4 P;  5JPA A;  1A43 A;  2VLQ A;  2KOD A;  2OTL P;  3HYB A;  2AVA A;  2KG9 A;  2EFJ A;  5KP7 B;  3MGE A;  3DS0 A;  5CZD B;  1YIT P;  2GZG A;  1VQM P;  1M74 A;  2N5H A;  2E1M A;  2GZE A;  4PH1 A;  1VQN P;  2BHV A;  4COP A;  3G26 A;  4PWV B;  2KW2 A;  2K0Y A;  3DS1 A;  4H2Y C;  2FVA A;  5HVC A;  1DV5 A;  2GYK A;  1KD1 Q;  2KG8 A;  3WBH A;  2MR7 A;  1QVF O;  4BPG A;  4IPY A;  2XT1 A;  2LKI A;  2PEN A;  1VKU A;  2Z46 A;  2PEO A;  3CCS P;  1FR2 A;  2XZ0 D;  2K2Q A;  3CD6 P;  2JQ4 A;  3CMA P;  3G1G A;  3M1M A;  3GZM A;  2QNW A;  3I55 P;  1ZNV A;  1KC8 Q;  2PNG A;  1M6E X;  7CEI A;  2KWL A;  2M8L A;  2PY8 A;  2GZF A;  3LRY A;  2EHS A;  5F2K A;  2OTJ P;  1NQ4 A;  4F37 A;  1UNK A;  1E0H A;  2L22 A;  4MRT C;  3VRL C;  2MVU A;  1VQ9 P;  3U43 A;  1YJN P;  2GZJ A;  1BAJ A;  2LOL A;  1GPJ A; 
#chains in the Genus database with same CATH homology
 2KR5 A;  2MR8 A;  2FQ0 A;  1X3O A;  2CGQ A;  4DG9 A;  2AVA A;  2MY5 A;  2KG9 A;  5KP7 B;  2DNW A;  2K92 A;  5CZD B;  1OR5 A;  1HQB A;  2FVE A;  3EJE A;  4H2X C;  2N5H A;  1AF8 A;  2X2B A;  4HKG A;  4BPH A;  2L9F A;  1DNY A;  2VSQ A;  4PWV B;  2GDW A;  2KW2 A;  3NY7 B;  2K0Y A;  2LIU A;  4R0M A;  1L0H A;  4H2Y C;  2FVA A;  2JU1 A;  5HVC A;  2L4B A;  5HV8 A;  1DV5 A;  1L0I A;  2AFE A;  2FAD A;  2KG8 A;  2MR7 A;  2ROQ A;  2AF8 A;  4BPG A;  2LTE A;  4CA3 A;  2LPK A;  2FHS C;  2LKI A;  2CQ8 A;  2K93 A;  1VKU A;  2KGC A;  2CNR A;  2CG5 B;  2KOS A;  3GZL A;  2XZ0 D;  2N6Z A;  2K2Q A;  2JGP A;  2LIW A;  2LL8 A;  2JQ4 A;  2L0Q A;  4IZ6 A;  2MD9 A;  3LMO A;  5EJD A;  4BPF A;  3GZM A;  2QNW A;  2K94 A;  2PNG A;  2KOO A;  2KOQ A;  3EJB A;  4H2W C;  2FAC A;  2FQ2 A;  5KP6 B;  2LML A;  3CE7 A;  4PXH B;  2KWL A;  2AFD A;  2KOP A;  2JU2 A;  2KG6 A;  1T8K A;  3EJD A;  2FAE A;  2EHS A;  5KP8 B;  1KLP A;  1ACP A;  2KGA A;  1NQ4 A;  2FVF A;  1HY8 A;  2EHT A;  3RG2 A;  2N98 A;  2FQ1 A;  2KGE A;  2N50 A;  2XZ1 C;  2KOR A;  2KGD A;  2L22 A;  4MRT C;  2K0X A;  2MVU A;  2MF4 A;  2GDY A;  2GDX A;  2N6Y A;  2N5I A;  4NEO A;  2LOL A;  2M5R A;  1F80 D;  2MVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...