2KOSA

Nmr solution structures of octanoyl-acp from streptomyces coelicolor fatty acid synthase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
b'AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport protein
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kosA00
2FADA 2CQ8A 2KGCA 3EJEA 2JU1A 2MR8A 2FQ2A 2KG8A 2K93A 4BPFA 2DNWA 2K0XA 1VKUA 2FVAA 4BPGA 1HQBA 2LIWA 5KP8B 3RG2A 2KOQA 2KW2A 2N5IA 3GZLA 2MVVA 4IZ6A 2LMLA 2XZ1C 4NEOA 2LTEA 2FAEA 2L9FA 2N5HA 2N98A 2KG6A 4BPHA 2LOLA 3LMOA 2KGDA 5HVCA 5KP6B 2JU2A 2MY5A 2L0QA 2KGEA 2CNRA 5KP7B 2CGQA 2LPKA 1T8KA 2AVAA 2N6ZA 4MRTC 5EJDA 2X2BA 2LL8A 4H2YC 2EHTA 4HKGA 1DV5A 2AFEA 2FHSC 2L22A 2KWLA 2M5RA 2MVUA 2KORA 2FQ1A 2N6YA 3EJDA 3NY7B 1F80D 2LIUA 2ROQA 1OR5A 2AF8A 4H2WC 2FQ0A 1ACPA 2LKIA 3EJBA 2KOPA 3CE7A 3GZMA 2K2QA 2K92A 2K0YA 2AFDA 4DG9A 1AF8A 2GDXA 4PWVB 2KOOA 2FVEA 2JGPA 2MF4A 2N50A 4H2XC 2VSQA 2KR5A 2KG9A 2FVFA 5HV8A 2MD9A 1L0IA 2K94A 2FACA 2CG5B 1L0HA 1X3OA 2KGAA 2KOSA 2GDWA 1NQ4A 2MR7A 2L4BA 2XZ0D 2PNGA 5CZDB 2JQ4A 2QNWA 1KLPA 1DNYA 4R0MA 4PXHB 4CA3A 2EHSA 2GDYA 1HY8A
chains in the Genus database with same CATH superfamily
2FADA 2KGCA 5EW5E 2OTJP 1M90Q 4BPFA 1Q82Q 3HYBA 4BPGA 1UJZA 5DCKA 3G6EP 2KOQA 2N5IA 2PY8A 2JB0A 2N5HA 3DPHA 1FR2A 2KG6A 1BAJA 5HGLA 1K9MQ 2M8LA 2KGEA 3GJNA 1YI2P 2LPKA 4M0IA 1T8KA 2AVAA 1K30A 2LL8A 5I4TG 4QKOA 3P05A 1A43A 1EIAA 1A8OA 1DV5A 2PEQA 3CCJP 4U0FA 2ONTA 3CXCO 3CPWO 3H0DA 2XV6A 3EJDA 1KC8Q 3NTEA 1ZNVA 1RNIA 3OW2O 3E2DA 3GZMA 2K2QA 4XRQA 2K0YA 2E1MA 1M74A 2VLQA 3RG6C 5BS2A 3CC7P 4PH0A 5JPAA 1QRJA 2QEXP 3G29A 1MZ8A 3G0VA 3G4SP 2JBGA 4H2XC 1K73Q 3CMEP 2MD9A 2LF4A 2K94A 3I56P 1X3OA 2KOSA 1D1DA 2PNGA 2KODA 1M6EX 2JQ4A 5F2KA 1YIJP 4WYMA 2QNWA 4IPYA 3CCQP 4UHPB 2EHSA 1QVFO 2CQ8A 2ERHA 3EJEA 2Z44A 2JU1A 3M1MA 2DNWA 2QA4P 3HZQA 1HQBA 2NO8A 5F2NA 3I55P 1VQ9P 2OTLP 2LIWA 1ZMBA 2GZIA 1YJNP 1VQ8P 2MVVA 3CC4P 2L9FA 2N98A 3G21A 4QNBA 4U0EA 2WPTA 4U0AA 5HVCA 2M8NA 2GYKA 2CNRA 5KP7B 5EJDA 5F2OA 2M8PA 2X2BA 4H2YC 2EHTA 2JYLA 2Z46A 1N8RQ 2VLPA 4U0CA 3G1GA 5BS1A 2KWLA 1Q81Q 3NY7B 1RO2A 1E6JP 1F80D 2ROQA 2VLNA 1UNKA 2PEIA 1VQ6P 3CD6P 4DG9A 2OARA 1EMVA 1K8AQ 2GDXA 2KOOA 2N50A 2KR5A 1S72P 3Q20A 4COPA 1L0IA 1M6NA 2CG5B 2BUOA 2KGAA 3DS5A 3LRYA 1VQ4P 1NQ4A 1VQ7P 1VQ5P 1GPJA 2L4BA 2JO0A 2XZ0D 1YJ9P 1KLPA 4R0MA 4PXHB 1QVGO 2GZEA 4CA3A 3VRLC 2FQ2A 2BHVA 2K93A 2K0XA 4PH1A 3GZLA 7CEIA 2LMLA 2XZ1C 2PEJA 2PENA 1YJWP 2FAEA 1VQKP 4U0DA 4BPHA 2LOLA 3LMOA 3CC2P 4XFZA 1GXHA 2EFJA 2L0QA 2MY5A 2PEMA 1KQSO 2N6ZA 4MRTC 3DS1A 4HKGA 3H4EA 2FHSC 3DS4A 1VQOP 2KORA 3H47A 1Q86Q 2FQ1A 1IMQA 2LIUA 2AF8A 1E0HA 1VQPP 4H2WC 1VHNA 1ACPA 2LKIA 3EJBA 3MGEA 2KOPA 3CE7A 2K92A 2K5XA 2AFDA 3CCEP 4XFXA 2DGYA 2VLOA 5HGMA 4PWVB 1VQLP 1AYIA 1VQNP 2FVFA 5HV8A 4COCA 2GZJA 1L0HA 2GDWA 5CZDB 2CWOA 1DNYA 4XROA 1M1KQ 1BXIA 2JYGA 3G28A 2XT1A 3U43A 2XXMA 2L6EA 2EG5A 4U0BA 1IMPA 2MR8A 2KG8A 1VKUA 2FVAA 5HGNA 5KP8B 3DS0A 3DTJA 3RG2A 2GZGA 2KW2A 1Z6MA 1YITP 4IZ6A 3CCRP 4NEOA 3CCLP 2LTEA 5HGOA 4GR6A 2KGDA 4F37A 1JJ2O 5KP6B 2JU2A 1YHQP 3B5IA 1GXGA 3CCUP 2CGQA 1Q7YQ 4XFYA 2GZFA 1IUQA 2AFEA 2L22A 2PEKA 1RO0A 3CCMP 3GKLC 3CMAP 2EIAA 3G1IA 2K0DX 2M5RA 2MVUA 3WBHA 1VQMP 3CCSP 2N6YA 1OR5A 1KD1Q 2FQ0A 1W2BO 1EOQA 3DS3A 1AF8A 2Z45A 2FVEA 2JGPA 1AUMA 2MF4A 3CCVP 2VSQA 3DS2A 2KG9A 2FACA 1CEIA 2PEOA 2P9XA 4GR2A 2JAZA 2MR7A 1NJIQ 3G71P 3B4QA 3G26A 2GDYA 1HY8A
chains in the Genus database with same CATH topology
2FADA 2CQ8A 2KGCA 3EJEA 2JU1A 2MR8A 2FQ2A 2KG8A 2K93A 4BPFA 2DNWA 2K0XA 1VKUA 2FVAA 4BPGA 1HQBA 2LIWA 5KP8B 3RG2A 2KOQA 2KW2A 2N5IA 3GZLA 2MVVA 4IZ6A 2LMLA 2XZ1C 4NEOA 2LTEA 2FAEA 2L9FA 2N5HA 2N98A 2KG6A 4BPHA 2LOLA 3LMOA 2KGDA 5HVCA 5KP6B 2JU2A 2MY5A 2L0QA 2KGEA 2CNRA 5KP7B 2CGQA 2LPKA 1T8KA 2AVAA 2N6ZA 4MRTC 5EJDA 2X2BA 2LL8A 4H2YC 2EHTA 4HKGA 1DV5A 2AFEA 2FHSC 2L22A 2KWLA 2M5RA 2MVUA 2KORA 2FQ1A 2N6YA 3EJDA 3NY7B 1F80D 2LIUA 2ROQA 1OR5A 2AF8A 4H2WC 2FQ0A 1ACPA 2LKIA 3EJBA 2KOPA 3CE7A 3GZMA 2K2QA 2K92A 2K0YA 2AFDA 4DG9A 1AF8A 2GDXA 4PWVB 2KOOA 2FVEA 2JGPA 2MF4A 2N50A 4H2XC 2VSQA 2KR5A 2KG9A 2FVFA 5HV8A 2MD9A 1L0IA 2K94A 2FACA 2CG5B 1L0HA 1X3OA 2KGAA 2KOSA 2GDWA 1NQ4A 2MR7A 2L4BA 2XZ0D 2PNGA 5CZDB 2JQ4A 2QNWA 1KLPA 1DNYA 4R0MA 4PXHB 4CA3A 2EHSA 2GDYA 1HY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAD A;  2CQ8 A;  2KGC A;  3EJE A;  2JU1 A;  2MR8 A;  2FQ2 A;  2KG8 A;  2K93 A;  4BPF A;  2DNW A;  2K0X A;  1VKU A;  2FVA A;  4BPG A;  1HQB A;  2LIW A;  5KP8 B;  3RG2 A;  2KOQ A;  2KW2 A;  2N5I A;  3GZL A;  2MVV A;  4IZ6 A;  2LML A;  2XZ1 C;  4NEO A;  2LTE A;  2FAE A;  2L9F A;  2N5H A;  2N98 A;  2KG6 A;  4BPH A;  2LOL A;  3LMO A;  2KGD A;  5HVC A;  5KP6 B;  2JU2 A;  2MY5 A;  2L0Q A;  2KGE A;  2CNR A;  5KP7 B;  2CGQ A;  2LPK A;  1T8K A;  2AVA A;  2N6Z A;  4MRT C;  5EJD A;  2X2B A;  2LL8 A;  4H2Y C;  2EHT A;  4HKG A;  1DV5 A;  2AFE A;  2FHS C;  2L22 A;  2KWL A;  2M5R A;  2MVU A;  2KOR A;  2FQ1 A;  2N6Y A;  3EJD A;  3NY7 B;  1F80 D;  2LIU A;  2ROQ A;  1OR5 A;  2AF8 A;  4H2W C;  2FQ0 A;  1ACP A;  2LKI A;  3EJB A;  2KOP A;  3CE7 A;  3GZM A;  2K2Q A;  2K92 A;  2K0Y A;  2AFD A;  4DG9 A;  1AF8 A;  2GDX A;  4PWV B;  2KOO A;  2FVE A;  2JGP A;  2MF4 A;  2N50 A;  4H2X C;  2VSQ A;  2KR5 A;  2KG9 A;  2FVF A;  5HV8 A;  2MD9 A;  1L0I A;  2K94 A;  2FAC A;  2CG5 B;  1L0H A;  1X3O A;  2KGA A;  2KOS A;  2GDW A;  1NQ4 A;  2MR7 A;  2L4B A;  2XZ0 D;  2PNG A;  5CZD B;  2JQ4 A;  2QNW A;  1KLP A;  1DNY A;  4R0M A;  4PXH B;  4CA3 A;  2EHS A;  2GDY A;  1HY8 A; 
#chains in the Genus database with same CATH topology
 2FAD A;  2KGC A;  5EW5 E;  2OTJ P;  1M90 Q;  4BPF A;  1Q82 Q;  3HYB A;  4BPG A;  1UJZ A;  5DCK A;  3G6E P;  2KOQ A;  2N5I A;  2PY8 A;  2JB0 A;  2N5H A;  3DPH A;  1FR2 A;  2KG6 A;  1BAJ A;  5HGL A;  1K9M Q;  2M8L A;  2KGE A;  3GJN A;  1YI2 P;  2LPK A;  4M0I A;  1T8K A;  2AVA A;  1K30 A;  2LL8 A;  5I4T G;  4QKO A;  3P05 A;  1A43 A;  1EIA A;  1A8O A;  1DV5 A;  2PEQ A;  3CCJ P;  4U0F A;  2ONT A;  3CXC O;  3CPW O;  3H0D A;  2XV6 A;  3EJD A;  1KC8 Q;  3NTE A;  1ZNV A;  1RNI A;  3OW2 O;  3E2D A;  3GZM A;  2K2Q A;  4XRQ A;  2K0Y A;  2E1M A;  1M74 A;  2VLQ A;  3RG6 C;  5BS2 A;  3CC7 P;  4PH0 A;  5JPA A;  1QRJ A;  2QEX P;  3G29 A;  1MZ8 A;  3G0V A;  3G4S P;  2JBG A;  4H2X C;  1K73 Q;  3CME P;  2MD9 A;  2LF4 A;  2K94 A;  3I56 P;  1X3O A;  2KOS A;  1D1D A;  2PNG A;  2KOD A;  1M6E X;  2JQ4 A;  5F2K A;  1YIJ P;  4WYM A;  2QNW A;  4IPY A;  3CCQ P;  4UHP B;  2EHS A;  1QVF O;  2CQ8 A;  2ERH A;  3EJE A;  2Z44 A;  2JU1 A;  3M1M A;  2DNW A;  2QA4 P;  3HZQ A;  1HQB A;  2NO8 A;  5F2N A;  3I55 P;  1VQ9 P;  2OTL P;  2LIW A;  1ZMB A;  2GZI A;  1YJN P;  1VQ8 P;  2MVV A;  3CC4 P;  2L9F A;  2N98 A;  3G21 A;  4QNB A;  4U0E A;  2WPT A;  4U0A A;  5HVC A;  2M8N A;  2GYK A;  2CNR A;  5KP7 B;  5EJD A;  5F2O A;  2M8P A;  2X2B A;  4H2Y C;  2EHT A;  2JYL A;  2Z46 A;  1N8R Q;  2VLP A;  4U0C A;  3G1G A;  5BS1 A;  2KWL A;  1Q81 Q;  3NY7 B;  1RO2 A;  1E6J P;  1F80 D;  2ROQ A;  2VLN A;  1UNK A;  2PEI A;  1VQ6 P;  3CD6 P;  4DG9 A;  2OAR A;  1EMV A;  1K8A Q;  2GDX A;  2KOO A;  2N50 A;  2KR5 A;  1S72 P;  3Q20 A;  4COP A;  1L0I A;  1M6N A;  2CG5 B;  2BUO A;  2KGA A;  3DS5 A;  3LRY A;  1VQ4 P;  1NQ4 A;  1VQ7 P;  1VQ5 P;  1GPJ A;  2L4B A;  2JO0 A;  2XZ0 D;  1YJ9 P;  1KLP A;  4R0M A;  4PXH B;  1QVG O;  2GZE A;  4CA3 A;  3VRL C;  2FQ2 A;  2BHV A;  2K93 A;  2K0X A;  4PH1 A;  3GZL A;  7CEI A;  2LML A;  2XZ1 C;  2PEJ A;  2PEN A;  1YJW P;  2FAE A;  1VQK P;  4U0D A;  4BPH A;  2LOL A;  3LMO A;  3CC2 P;  4XFZ A;  1GXH A;  2EFJ A;  2L0Q A;  2MY5 A;  2PEM A;  1KQS O;  2N6Z A;  4MRT C;  3DS1 A;  4HKG A;  3H4E A;  2FHS C;  3DS4 A;  1VQO P;  2KOR A;  3H47 A;  1Q86 Q;  2FQ1 A;  1IMQ A;  2LIU A;  2AF8 A;  1E0H A;  1VQP P;  4H2W C;  1VHN A;  1ACP A;  2LKI A;  3EJB A;  3MGE A;  2KOP A;  3CE7 A;  2K92 A;  2K5X A;  2AFD A;  3CCE P;  4XFX A;  2DGY A;  2VLO A;  5HGM A;  4PWV B;  1VQL P;  1AYI A;  1VQN P;  2FVF A;  5HV8 A;  4COC A;  2GZJ A;  1L0H A;  2GDW A;  5CZD B;  2CWO A;  1DNY A;  4XRO A;  1M1K Q;  1BXI A;  2JYG A;  3G28 A;  2XT1 A;  3U43 A;  2XXM A;  2L6E A;  2EG5 A;  4U0B A;  1IMP A;  2MR8 A;  2KG8 A;  1VKU A;  2FVA A;  5HGN A;  5KP8 B;  3DS0 A;  3DTJ A;  3RG2 A;  2GZG A;  2KW2 A;  1Z6M A;  1YIT P;  4IZ6 A;  3CCR P;  4NEO A;  3CCL P;  2LTE A;  5HGO A;  4GR6 A;  2KGD A;  4F37 A;  1JJ2 O;  5KP6 B;  2JU2 A;  1YHQ P;  3B5I A;  1GXG A;  3CCU P;  2CGQ A;  1Q7Y Q;  4XFY A;  2GZF A;  1IUQ A;  2AFE A;  2L22 A;  2PEK A;  1RO0 A;  3CCM P;  3GKL C;  3CMA P;  2EIA A;  3G1I A;  2K0D X;  2M5R A;  2MVU A;  3WBH A;  1VQM P;  3CCS P;  2N6Y A;  1OR5 A;  1KD1 Q;  2FQ0 A;  1W2B O;  1EOQ A;  3DS3 A;  1AF8 A;  2Z45 A;  2FVE A;  2JGP A;  1AUM A;  2MF4 A;  3CCV P;  2VSQ A;  3DS2 A;  2KG9 A;  2FAC A;  1CEI A;  2PEO A;  2P9X A;  4GR2 A;  2JAZ A;  2MR7 A;  1NJI Q;  3G71 P;  3B4Q A;  3G26 A;  2GDY A;  1HY8 A; 
#chains in the Genus database with same CATH homology
 2FAD A;  2CQ8 A;  2KGC A;  3EJE A;  2JU1 A;  2MR8 A;  2FQ2 A;  2KG8 A;  2K93 A;  4BPF A;  2DNW A;  2K0X A;  1VKU A;  2FVA A;  4BPG A;  1HQB A;  2LIW A;  5KP8 B;  3RG2 A;  2KOQ A;  2KW2 A;  2N5I A;  3GZL A;  2MVV A;  4IZ6 A;  2LML A;  2XZ1 C;  4NEO A;  2LTE A;  2FAE A;  2L9F A;  2N5H A;  2N98 A;  2KG6 A;  4BPH A;  2LOL A;  3LMO A;  2KGD A;  5HVC A;  5KP6 B;  2JU2 A;  2MY5 A;  2L0Q A;  2KGE A;  2CNR A;  5KP7 B;  2CGQ A;  2LPK A;  1T8K A;  2AVA A;  2N6Z A;  4MRT C;  5EJD A;  2X2B A;  2LL8 A;  4H2Y C;  2EHT A;  4HKG A;  1DV5 A;  2AFE A;  2FHS C;  2L22 A;  2KWL A;  2M5R A;  2MVU A;  2KOR A;  2FQ1 A;  2N6Y A;  3EJD A;  3NY7 B;  1F80 D;  2LIU A;  2ROQ A;  1OR5 A;  2AF8 A;  4H2W C;  2FQ0 A;  1ACP A;  2LKI A;  3EJB A;  2KOP A;  3CE7 A;  3GZM A;  2K2Q A;  2K92 A;  2K0Y A;  2AFD A;  4DG9 A;  1AF8 A;  2GDX A;  4PWV B;  2KOO A;  2FVE A;  2JGP A;  2MF4 A;  2N50 A;  4H2X C;  2VSQ A;  2KR5 A;  2KG9 A;  2FVF A;  5HV8 A;  2MD9 A;  1L0I A;  2K94 A;  2FAC A;  2CG5 B;  1L0H A;  1X3O A;  2KGA A;  2KOS A;  2GDW A;  1NQ4 A;  2MR7 A;  2L4B A;  2XZ0 D;  2PNG A;  5CZD B;  2JQ4 A;  2QNW A;  1KLP A;  1DNY A;  4R0M A;  4PXH B;  4CA3 A;  2EHS A;  2GDY A;  1HY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...