2XZ1C

The structure of the 2:2 (fully occupied) complex between stearoyl acyl carrier protein desaturase from ricinus communis (castor bean) and acyl carrier protein.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
81
Chain Sequence
AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/lipid binding protein
molecule keywords ACYL-[ACYL-CARRIER-PROTEIN] DESATURASE, CHLOROPLASTIC
publication title Remote Control of Regioselectivity in Acyl-Acyl Carrier Protein-Desaturases.
pubmed doi rcsb
source organism Ricinus communis
total genus 20
structure length 81
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2xz1C00
2KOSA 2LOLA 4H2WC 2EHTA 2EHSA 2M5RA 5KP6B 2N5HA 2MR7A 2DNWA 4H2YC 2KG8A 1T8KA 2L9FA 2JU1A 2CQ8A 2ROQA 2LTEA 4BPHA 5HVCA 2K94A 2L4BA 2N6ZA 5KP7B 1OR5A 2N5IA 2AFEA 1X3OA 2JU2A 3NY7B 1F80D 2XZ0D 2FQ2A 1DV5A 2FQ1A 5EJDA 1DNYA 1NQ4A 2K0XA 4NEOA 1HY8A 2KR5A 2KGCA 3RG2A 1AF8A 2AVAA 4MRTC 4PWVB 1L0HA 1HQBA 2GDXA 3EJBA 2QNWA 4HKGA 2GDWA 2K93A 2JGPA 3EJEA 4BPGA 2FVEA 2K0YA 2KGAA 2LIUA 3GZMA 4BPFA 4DG9A 2N6YA 2MVVA 2LMLA 2N98A 4CA3A 2FACA 1KLPA 2LKIA 2K2QA 2MY5A 5KP8B 3CE7A 5CZDB 2CNRA 2LIWA 2LL8A 2MD9A 2FVAA 2X2BA 1ACPA 2MR8A 2FQ0A 5HV8A 2KORA 2KGEA 2N50A 2KW2A 1L0IA 2VSQA 4R0MA 2AFDA 2KGDA 4H2XC 2KOOA 2FAEA 2FADA 2KWLA 4IZ6A 3GZLA 2L22A 2K92A 2JQ4A 2CG5B 2KG6A 2MF4A 2CGQA 3LMOA 2FHSC 2FVFA 2KOQA 2PNGA 2L0QA 2LPKA 2KG9A 2AF8A 3EJDA 2GDYA 2KOPA 2MVUA 4PXHB 2XZ1C 1VKUA
chains in the Genus database with same CATH superfamily
4WYMA 2KOSA 2EHTA 1EIAA 3HZQA 2M5RA 3CD6P 1EOQA 3G1GA 2M8NA 2N5HA 2ERHA 1BXIA 1T8KA 2XV6A 1N8RQ 3G0VA 3CCRP 2CQ8A 3OW2O 2JYLA 1YJWP 1VQLP 2L4BA 5EW5E 2XXMA 2JU2A 2OTLP 2FQ2A 5F2OA 1K9MQ 1DNYA 1NQ4A 4F37A 7CEIA 1YJNP 1VQ6P 1M6EX 2KGCA 1M1KQ 4U0BA 4MRTC 1K8AQ 1L0HA 2GZFA 5F2KA 2GDXA 1VQ4P 3EJEA 4BPGA 1Q81Q 1YITP 3CC7P 2N6YA 2MVVA 2LMLA 4CA3A 2FACA 2LKIA 2MY5A 3CE7A 2Z45A 2LIWA 1YHQP 1A43A 4U0AA 4XROA 3CCMP 3H0DA 3B4QA 5HV8A 2PEKA 1L0IA 2AFDA 1K73Q 3DS2A 3CMAP 2FADA 2KWLA 2CG5B 2PEQA 4XRQA 2KG6A 2BUOA 4U0CA 3G28A 2CGQA 1VQKP 1ZNVA 2KOQA 2KG9A 1KC8Q 2MVUA 1M6NA 3CCLP 1KD1Q 2XZ1C 3CC2P 4H2WC 2L6EA 4QNBA 4XFYA 5HGOA 4H2YC 2DNWA 1M74A 2Z44A 3GJNA 4BPHA 3M1MA 2N6ZA 1E0HA 1S72P 2XZ0D 5EJDA 4XFXA 4NEOA 3VRLC 2XT1A 1AF8A 4PWVB 2P9XA 2BHVA 2OTJP 2EIAA 1HQBA 3EJBA 1AYIA 4PH0A 4IPYA 1QVFO 1NJIQ 2FVEA 2N98A 2JBGA 5KP8B 2K2QA 1Q82Q 3CCEP 3DPHA 2X2BA 3CXCO 1ACPA 2MR8A 2PEOA 3G1IA 3G6EP 2KORA 1EMVA 2KW2A 1VHNA 2QA4P 2VSQA 2Z46A 2FAEA 2M8LA 3CCUP 3GZLA 2MF4A 1VQOP 2EFJA 3HYBA 2PNGA 2L0QA 5BS1A 2GDYA 4PXHB 3G71P 5HGNA 2PENA 4QKOA 1Q7YQ 5KP6B 1CEIA 2OARA 2K0DX 2KG8A 1MZ8A 1VQMP 2JU1A 1JJ2O 3H47A 3DS4A 5HVCA 1K30A 4U0EA 5KP7B 1OR5A 4GR2A 2N5IA 2QEXP 2AFEA 2ONTA 3CCQP 1DV5A 2FQ1A 2K0XA 3CMEP 1HY8A 2KR5A 5JPAA 2DGYA 2AVAA 5F2NA 1E6JP 2PEJA 1VQ5P 5DCKA 2QNWA 4HKGA 1D1DA 2GDWA 2K93A 2JGPA 2KGAA 2K0YA 5BS2A 3GZMA 2PEMA 2E1MA 1YI2P 1VQPP 3NTEA 3P05A 2VLNA 5CZDB 1W2BO 1YJ9P 2CNRA 2LL8A 1QVGO 1UJZA 2FQ0A 2KGEA 2N50A 1RNIA 2JB0A 5HGLA 3CCVP 5HGMA 2KODA 4IZ6A 3H4EA 2L22A 2K92A 3CCJP 3G4SP 2K5XA 1KQSO 1Q86Q 3E2DA 3LMOA 2JYGA 1VQ9P 4COPA 2LPKA 3G21A 3U43A 1GXHA 3G26A 1UNKA 2LOLA 2GZIA 2EHSA 1GPJA 2WPTA 3I55P 1GXGA 2GZEA 2MR7A 2EG5A 3DS1A 2JAZA 2L9FA 2M8PA 3CC4P 2ROQA 1Z6MA 2LTEA 2VLQA 2K94A 3WBHA 4PH1A 1X3OA 3NY7B 1F80D 1M90Q 3DS3A 4XFZA 1AUMA 1FR2A 3DS0A 2PEIA 3RG2A 4M0IA 3CPWO 1VQNP 1ZMBA 4COCA 1IMPA 2JO0A 1QRJA 1IUQA 4UHPB 1VQ7P 2LIUA 4BPFA 4DG9A 3LRYA 2GZGA 1KLPA 3GKLC 1RO0A 5I4TG 3I56P 2MD9A 2FVAA 3Q20A 4GR6A 3RG6C 2LF4A 1IMQA 2CWOA 4R0MA 2KGDA 2NO8A 3DTJA 3MGEA 4H2XC 1A8OA 2KOOA 3G29A 2PY8A 1BAJA 4U0DA 2JQ4A 2GZJA 3DS5A 2GYKA 3CCSP 2VLOA 1RO2A 1YIJP 2FHSC 2FVFA 3EJDA 2AF8A 3B5IA 2KOPA 1VQ8P 1VKUA 4U0FA 2VLPA
chains in the Genus database with same CATH topology
2KOSA 2LOLA 4H2WC 2EHTA 2EHSA 2M5RA 5KP6B 2N5HA 2MR7A 2DNWA 4H2YC 2KG8A 1T8KA 2L9FA 2JU1A 2CQ8A 2ROQA 2LTEA 4BPHA 5HVCA 2K94A 2L4BA 2N6ZA 5KP7B 1OR5A 2N5IA 2AFEA 1X3OA 2JU2A 3NY7B 1F80D 2XZ0D 2FQ2A 1DV5A 2FQ1A 5EJDA 1DNYA 1NQ4A 2K0XA 4NEOA 1HY8A 2KR5A 2KGCA 3RG2A 1AF8A 2AVAA 4MRTC 4PWVB 1L0HA 1HQBA 2GDXA 3EJBA 2QNWA 4HKGA 2GDWA 2K93A 2JGPA 3EJEA 4BPGA 2FVEA 2K0YA 2KGAA 2LIUA 3GZMA 4BPFA 4DG9A 2N6YA 2MVVA 2LMLA 2N98A 4CA3A 2FACA 1KLPA 2LKIA 2K2QA 2MY5A 5KP8B 3CE7A 5CZDB 2CNRA 2LIWA 2LL8A 2MD9A 2FVAA 2X2BA 1ACPA 2MR8A 2FQ0A 5HV8A 2KORA 2KGEA 2N50A 2KW2A 1L0IA 2VSQA 4R0MA 2AFDA 2KGDA 4H2XC 2KOOA 2FAEA 2FADA 2KWLA 4IZ6A 3GZLA 2L22A 2K92A 2JQ4A 2CG5B 2KG6A 2MF4A 2CGQA 3LMOA 2FHSC 2FVFA 2KOQA 2PNGA 2L0QA 2LPKA 2KG9A 2AF8A 3EJDA 2GDYA 2KOPA 2MVUA 4PXHB 2XZ1C 1VKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOS A;  2LOL A;  4H2W C;  2EHT A;  2EHS A;  2M5R A;  5KP6 B;  2N5H A;  2MR7 A;  2DNW A;  4H2Y C;  2KG8 A;  1T8K A;  2L9F A;  2JU1 A;  2CQ8 A;  2ROQ A;  2LTE A;  4BPH A;  5HVC A;  2K94 A;  2L4B A;  2N6Z A;  5KP7 B;  1OR5 A;  2N5I A;  2AFE A;  1X3O A;  2JU2 A;  3NY7 B;  1F80 D;  2XZ0 D;  2FQ2 A;  1DV5 A;  2FQ1 A;  5EJD A;  1DNY A;  1NQ4 A;  2K0X A;  4NEO A;  1HY8 A;  2KR5 A;  2KGC A;  3RG2 A;  1AF8 A;  2AVA A;  4MRT C;  4PWV B;  1L0H A;  1HQB A;  2GDX A;  3EJB A;  2QNW A;  4HKG A;  2GDW A;  2K93 A;  2JGP A;  3EJE A;  4BPG A;  2FVE A;  2K0Y A;  2KGA A;  2LIU A;  3GZM A;  4BPF A;  4DG9 A;  2N6Y A;  2MVV A;  2LML A;  2N98 A;  4CA3 A;  2FAC A;  1KLP A;  2LKI A;  2K2Q A;  2MY5 A;  5KP8 B;  3CE7 A;  5CZD B;  2CNR A;  2LIW A;  2LL8 A;  2MD9 A;  2FVA A;  2X2B A;  1ACP A;  2MR8 A;  2FQ0 A;  5HV8 A;  2KOR A;  2KGE A;  2N50 A;  2KW2 A;  1L0I A;  2VSQ A;  4R0M A;  2AFD A;  2KGD A;  4H2X C;  2KOO A;  2FAE A;  2FAD A;  2KWL A;  4IZ6 A;  3GZL A;  2L22 A;  2K92 A;  2JQ4 A;  2CG5 B;  2KG6 A;  2MF4 A;  2CGQ A;  3LMO A;  2FHS C;  2FVF A;  2KOQ A;  2PNG A;  2L0Q A;  2LPK A;  2KG9 A;  2AF8 A;  3EJD A;  2GDY A;  2KOP A;  2MVU A;  4PXH B;  2XZ1 C;  1VKU A; 
#chains in the Genus database with same CATH topology
 4WYM A;  2KOS A;  2EHT A;  1EIA A;  3HZQ A;  2M5R A;  3CD6 P;  1EOQ A;  3G1G A;  2M8N A;  2N5H A;  2ERH A;  1BXI A;  1T8K A;  2XV6 A;  1N8R Q;  3G0V A;  3CCR P;  2CQ8 A;  3OW2 O;  2JYL A;  1YJW P;  1VQL P;  2L4B A;  5EW5 E;  2XXM A;  2JU2 A;  2OTL P;  2FQ2 A;  5F2O A;  1K9M Q;  1DNY A;  1NQ4 A;  4F37 A;  7CEI A;  1YJN P;  1VQ6 P;  1M6E X;  2KGC A;  1M1K Q;  4U0B A;  4MRT C;  1K8A Q;  1L0H A;  2GZF A;  5F2K A;  2GDX A;  1VQ4 P;  3EJE A;  4BPG A;  1Q81 Q;  1YIT P;  3CC7 P;  2N6Y A;  2MVV A;  2LML A;  4CA3 A;  2FAC A;  2LKI A;  2MY5 A;  3CE7 A;  2Z45 A;  2LIW A;  1YHQ P;  1A43 A;  4U0A A;  4XRO A;  3CCM P;  3H0D A;  3B4Q A;  5HV8 A;  2PEK A;  1L0I A;  2AFD A;  1K73 Q;  3DS2 A;  3CMA P;  2FAD A;  2KWL A;  2CG5 B;  2PEQ A;  4XRQ A;  2KG6 A;  2BUO A;  4U0C A;  3G28 A;  2CGQ A;  1VQK P;  1ZNV A;  2KOQ A;  2KG9 A;  1KC8 Q;  2MVU A;  1M6N A;  3CCL P;  1KD1 Q;  2XZ1 C;  3CC2 P;  4H2W C;  2L6E A;  4QNB A;  4XFY A;  5HGO A;  4H2Y C;  2DNW A;  1M74 A;  2Z44 A;  3GJN A;  4BPH A;  3M1M A;  2N6Z A;  1E0H A;  1S72 P;  2XZ0 D;  5EJD A;  4XFX A;  4NEO A;  3VRL C;  2XT1 A;  1AF8 A;  4PWV B;  2P9X A;  2BHV A;  2OTJ P;  2EIA A;  1HQB A;  3EJB A;  1AYI A;  4PH0 A;  4IPY A;  1QVF O;  1NJI Q;  2FVE A;  2N98 A;  2JBG A;  5KP8 B;  2K2Q A;  1Q82 Q;  3CCE P;  3DPH A;  2X2B A;  3CXC O;  1ACP A;  2MR8 A;  2PEO A;  3G1I A;  3G6E P;  2KOR A;  1EMV A;  2KW2 A;  1VHN A;  2QA4 P;  2VSQ A;  2Z46 A;  2FAE A;  2M8L A;  3CCU P;  3GZL A;  2MF4 A;  1VQO P;  2EFJ A;  3HYB A;  2PNG A;  2L0Q A;  5BS1 A;  2GDY A;  4PXH B;  3G71 P;  5HGN A;  2PEN A;  4QKO A;  1Q7Y Q;  5KP6 B;  1CEI A;  2OAR A;  2K0D X;  2KG8 A;  1MZ8 A;  1VQM P;  2JU1 A;  1JJ2 O;  3H47 A;  3DS4 A;  5HVC A;  1K30 A;  4U0E A;  5KP7 B;  1OR5 A;  4GR2 A;  2N5I A;  2QEX P;  2AFE A;  2ONT A;  3CCQ P;  1DV5 A;  2FQ1 A;  2K0X A;  3CME P;  1HY8 A;  2KR5 A;  5JPA A;  2DGY A;  2AVA A;  5F2N A;  1E6J P;  2PEJ A;  1VQ5 P;  5DCK A;  2QNW A;  4HKG A;  1D1D A;  2GDW A;  2K93 A;  2JGP A;  2KGA A;  2K0Y A;  5BS2 A;  3GZM A;  2PEM A;  2E1M A;  1YI2 P;  1VQP P;  3NTE A;  3P05 A;  2VLN A;  5CZD B;  1W2B O;  1YJ9 P;  2CNR A;  2LL8 A;  1QVG O;  1UJZ A;  2FQ0 A;  2KGE A;  2N50 A;  1RNI A;  2JB0 A;  5HGL A;  3CCV P;  5HGM A;  2KOD A;  4IZ6 A;  3H4E A;  2L22 A;  2K92 A;  3CCJ P;  3G4S P;  2K5X A;  1KQS O;  1Q86 Q;  3E2D A;  3LMO A;  2JYG A;  1VQ9 P;  4COP A;  2LPK A;  3G21 A;  3U43 A;  1GXH A;  3G26 A;  1UNK A;  2LOL A;  2GZI A;  2EHS A;  1GPJ A;  2WPT A;  3I55 P;  1GXG A;  2GZE A;  2MR7 A;  2EG5 A;  3DS1 A;  2JAZ A;  2L9F A;  2M8P A;  3CC4 P;  2ROQ A;  1Z6M A;  2LTE A;  2VLQ A;  2K94 A;  3WBH A;  4PH1 A;  1X3O A;  3NY7 B;  1F80 D;  1M90 Q;  3DS3 A;  4XFZ A;  1AUM A;  1FR2 A;  3DS0 A;  2PEI A;  3RG2 A;  4M0I A;  3CPW O;  1VQN P;  1ZMB A;  4COC A;  1IMP A;  2JO0 A;  1QRJ A;  1IUQ A;  4UHP B;  1VQ7 P;  2LIU A;  4BPF A;  4DG9 A;  3LRY A;  2GZG A;  1KLP A;  3GKL C;  1RO0 A;  5I4T G;  3I56 P;  2MD9 A;  2FVA A;  3Q20 A;  4GR6 A;  3RG6 C;  2LF4 A;  1IMQ A;  2CWO A;  4R0M A;  2KGD A;  2NO8 A;  3DTJ A;  3MGE A;  4H2X C;  1A8O A;  2KOO A;  3G29 A;  2PY8 A;  1BAJ A;  4U0D A;  2JQ4 A;  2GZJ A;  3DS5 A;  2GYK A;  3CCS P;  2VLO A;  1RO2 A;  1YIJ P;  2FHS C;  2FVF A;  3EJD A;  2AF8 A;  3B5I A;  2KOP A;  1VQ8 P;  1VKU A;  4U0F A;  2VLP A; 
#chains in the Genus database with same CATH homology
 2KOS A;  2LOL A;  4H2W C;  2EHT A;  2EHS A;  2M5R A;  5KP6 B;  2N5H A;  2MR7 A;  2DNW A;  4H2Y C;  2KG8 A;  1T8K A;  2L9F A;  2JU1 A;  2CQ8 A;  2ROQ A;  2LTE A;  4BPH A;  5HVC A;  2K94 A;  2L4B A;  2N6Z A;  5KP7 B;  1OR5 A;  2N5I A;  2AFE A;  1X3O A;  2JU2 A;  3NY7 B;  1F80 D;  2XZ0 D;  2FQ2 A;  1DV5 A;  2FQ1 A;  5EJD A;  1DNY A;  1NQ4 A;  2K0X A;  4NEO A;  1HY8 A;  2KR5 A;  2KGC A;  3RG2 A;  1AF8 A;  2AVA A;  4MRT C;  4PWV B;  1L0H A;  1HQB A;  2GDX A;  3EJB A;  2QNW A;  4HKG A;  2GDW A;  2K93 A;  2JGP A;  3EJE A;  4BPG A;  2FVE A;  2K0Y A;  2KGA A;  2LIU A;  3GZM A;  4BPF A;  4DG9 A;  2N6Y A;  2MVV A;  2LML A;  2N98 A;  4CA3 A;  2FAC A;  1KLP A;  2LKI A;  2K2Q A;  2MY5 A;  5KP8 B;  3CE7 A;  5CZD B;  2CNR A;  2LIW A;  2LL8 A;  2MD9 A;  2FVA A;  2X2B A;  1ACP A;  2MR8 A;  2FQ0 A;  5HV8 A;  2KOR A;  2KGE A;  2N50 A;  2KW2 A;  1L0I A;  2VSQ A;  4R0M A;  2AFD A;  2KGD A;  4H2X C;  2KOO A;  2FAE A;  2FAD A;  2KWL A;  4IZ6 A;  3GZL A;  2L22 A;  2K92 A;  2JQ4 A;  2CG5 B;  2KG6 A;  2MF4 A;  2CGQ A;  3LMO A;  2FHS C;  2FVF A;  2KOQ A;  2PNG A;  2L0Q A;  2LPK A;  2KG9 A;  2AF8 A;  3EJD A;  2GDY A;  2KOP A;  2MVU A;  4PXH B;  2XZ1 C;  1VKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...