2XZ1C

The structure of the 2:2 (fully occupied) complex between stearoyl acyl carrier protein desaturase from ricinus communis (castor bean) and acyl carrier protein.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
81
Chain Sequence
AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL-[ACYL-CARRIER-PROTEIN] DESATURASE, CHLOROPLASTIC
publication title Remote Control of Regioselectivity in Acyl-Acyl Carrier Protein-Desaturases.
pubmed doi rcsb
source organism Ricinus communis
molecule tags Oxidoreductase/lipid binding protein
total genus 20
structure length 81
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2xz1C00
4NEOA 5HV8A 2LMLA 3EJDA 2N6YA 2FVAA 2KWLA 2MVUA 2FVEA 5KP6B 2EHSA 2ROQA 4H2WC 1OR5A 4HKGA 1T8KA 2L4BA 1ACPA 2MF4A 1DV5A 2FVFA 2DNWA 1F80D 2CGQA 2JU1A 2AF8A 1VKUA 2XZ1C 3EJBA 4R0MA 5HVCA 2FQ2A 1L0HA 2MY5A 2CG5B 4BPGA 2FHSC 2L0QA 2MR8A 2K92A 2KGDA 2N6ZA 2X2BA 3LMOA 2LIWA 4BPFA 2MD9A 3GZMA 2KW2A 2KG6A 2QNWA 2N5IA 5KP8B 2CQ8A 2N50A 4H2XC 2LIUA 2K94A 2MVVA 2AFEA 2AVAA 2AFDA 2FACA 1X3OA 2KR5A 3EJEA 3RG2A 2GDYA 2MR7A 2PNGA 2LPKA 2FAEA 2XZ0D 1L0IA 5CZDB 2K0YA 2K2QA 2K0XA 4DG9A 2KOSA 2M5RA 2N5HA 2FADA 2JGPA 2LL8A 3CE7A 1HQBA 2LOLA 2KGEA 2GDWA 2KG9A 2CNRA 4CA3A 2FQ0A 2KGAA 1NQ4A 2EHTA 1DNYA 1HY8A 4PXHB 3NY7B 2L9FA 2L22A 3GZLA 2KGCA 1KLPA 4PWVB 2KG8A 2LTEA 5EJDA 2N98A 2KOOA 2VSQA 4IZ6A 2FQ1A 2K93A 2KOQA 2KORA 2KOPA 2LKIA 1AF8A 4BPHA 2JQ4A 4H2YC 5KP7B 2JU2A 4MRTC 2GDXA
chains in the Genus database with same CATH superfamily
2FVEA 5KP6B 1IMPA 2EHSA 3G4SP 3DS4A 1S72P 5BS1A 2DNWA 1F80D 2Z46A 2XZ1C 3B5IA 4QKOA 2Z44A 1EIAA 2PEJA 1YJWP 2CG5B 1M74A 2BUOA 2CWOA 3OW2O 1UNKA 2KGDA 4XROA 2LIWA 4BPFA 2VLOA 1IUQA 3G29A 1VQOP 4WYMA 2PEMA 5F2KA 1VQPP 1FR2A 2N50A 4PH0A 5I4TG 3EJEA 2AFDA 2KR5A 2PEOA 1N8RQ 4U0DA 4U0AA 2ERHA 3G71P 2FAEA 3CMAP 3G0VA 1W2BO 4DG9A 3DS3A 2NO8A 1JJ2O 2K0DX 1CEIA 7CEIA 1QVGO 2LOLA 2GDWA 2KGEA 1YHQP 2EG5A 1NQ4A 2EHTA 3DS0A 3NY7B 2EIAA 3DS5A 1KLPA 3CCSP 2KG8A 5EJDA 2VSQA 4IZ6A 2KOPA 1AF8A 1KD1Q 2BHVA 4BPHA 2OTLP 4U0BA 1MZ8A 2GDXA 5HV8A 3M1MA 1YJNP 2GYKA 2MVUA 2ONTA 2M8NA 4HKGA 5DCKA 3WBHA 3G1GA 1VQMP 2GZFA 3E2DA 3DS2A 1A43A 1IMQA 2GZIA 3CCQP 3I55P 4IPYA 3LRYA 3EJBA 3CC2P 1ZMBA 3DPHA 1YITP 1GXGA 3CXCO 1QRJA 2MY5A 4BPGA 4XFZA 1AYIA 4XFYA 2N6ZA 2X2BA 3HYBA 4QNBA 3G21A 3GZMA 2K5XA 3MGEA 1YJ9P 1Q86Q 1YIJP 4PH1A 1Q81Q 4H2XC 4COPA 3CPWO 1VQKP 4XFXA 3G6EP 3CCLP 2MR7A 4UHPB 2PNGA 4U0CA 1VQ4P 4XRQA 2JB0A 1M6NA 2XZ0D 1L0IA 3CCRP 1EOQA 2GZJA 2K0YA 2K2QA 2K0XA 3VRLC 2FADA 2JGPA 3G26A 1BXIA 3GJNA 2OARA 4F37A 2JYGA 1M1KQ 2KG9A 4CA3A 2KGAA 3G28A 3I56P 1DNYA 1HY8A 4PXHB 5HGOA 2L22A 1K8AQ 1GXHA 5JPAA 4PWVB 2LTEA 2KOOA 5BS2A 2KOQA 1VQ6P 2XXMA 2VLPA 5KP7B 2JU2A 1RNIA 3CC4P 3H0DA 4U0FA 1Q82Q 2LMLA 2FVAA 2KWLA 4M0IA 5F2NA 1OR5A 1VQLP 2L4BA 5HGNA 3CD6P 1D1DA 1ACPA 3CCMP 1Q7YQ 2JU1A 2Z45A 2GZGA 2P9XA 3H4EA 2M8PA 4R0MA 2FQ2A 1ZNVA 1EMVA 1L0HA 1YI2P 2FHSC 2MR8A 2K92A 4COCA 2LF4A 2QA4P 2KW2A 2KG6A 2QNWA 2N5IA 5KP8B 1K73Q 2CQ8A 2GZEA 3B4QA 2MVVA 2PY8A 2AFEA 3CCUP 1X3OA 3CCJP 2EFJA 2LPKA 4GR6A 1E0HA 5EW5E 2OTJP 3CCVP 2M5RA 1Z6MA 3H47A 3GKLC 1E6JP 2QEXP 1K9MQ 1RO2A 1NJIQ 1BAJA 3P05A 1A8OA 2M8LA 2CNRA 1AUMA 2KGCA 3G1IA 2VLQA 2JO0A 2N98A 2KODA 2K93A 2KORA 2LKIA 3HZQA 1KC8Q 1UJZA 2E1MA 2JQ4A 3DTJA 3Q20A 1RO0A 2XT1A 4NEOA 3EJDA 2N6YA 1VQ8P 2ROQA 4H2WC 1T8KA 1VHNA 1KQSO 2MF4A 1DV5A 1M90Q 2FVFA 2CGQA 1M6EX 2AF8A 3U43A 1VQ5P 1VKUA 5HVCA 2L0QA 1VQNP 3LMOA 3NTEA 3CCEP 2MD9A 2PEQA 4GR2A 1VQ7P 1VQ9P 1K30A 3CMEP 2WPTA 3CC7P 2LIUA 1QVFO 2K94A 2L6EA 5F2OA 2PEKA 2AVAA 2FACA 2XV6A 3RG2A 2PENA 2GDYA 2PEIA 5CZDB 2KOSA 2VLNA 2N5HA 1GPJA 2LL8A 3CE7A 1HQBA 2FQ0A 4U0EA 2L9FA 5HGLA 3GZLA 3RG6C 5HGMA 2DGYA 2JBGA 3DS1A 2FQ1A 2JAZA 2JYLA 4H2YC 4MRTC
chains in the Genus database with same CATH topology
4NEOA 5HV8A 2LMLA 3EJDA 2N6YA 2FVAA 2KWLA 2MVUA 2FVEA 5KP6B 2EHSA 2ROQA 4H2WC 1OR5A 4HKGA 1T8KA 2L4BA 1ACPA 2MF4A 1DV5A 2FVFA 2DNWA 1F80D 2CGQA 2JU1A 2AF8A 1VKUA 2XZ1C 3EJBA 4R0MA 5HVCA 2FQ2A 1L0HA 2MY5A 2CG5B 4BPGA 2FHSC 2L0QA 2MR8A 2K92A 2KGDA 2N6ZA 2X2BA 3LMOA 2LIWA 4BPFA 2MD9A 3GZMA 2KW2A 2KG6A 2QNWA 2N5IA 5KP8B 2CQ8A 2N50A 4H2XC 2LIUA 2K94A 2MVVA 2AFEA 2AVAA 2AFDA 2FACA 1X3OA 2KR5A 3EJEA 3RG2A 2GDYA 2MR7A 2PNGA 2LPKA 2FAEA 2XZ0D 1L0IA 5CZDB 2K0YA 2K2QA 2K0XA 4DG9A 2KOSA 2M5RA 2N5HA 2FADA 2JGPA 2LL8A 3CE7A 1HQBA 2LOLA 2KGEA 2GDWA 2KG9A 2CNRA 4CA3A 2FQ0A 2KGAA 1NQ4A 2EHTA 1DNYA 1HY8A 4PXHB 3NY7B 2L9FA 2L22A 3GZLA 2KGCA 1KLPA 4PWVB 2KG8A 2LTEA 5EJDA 2N98A 2KOOA 2VSQA 4IZ6A 2FQ1A 2K93A 2KOQA 2KORA 2KOPA 2LKIA 1AF8A 4BPHA 2JQ4A 4H2YC 5KP7B 2JU2A 4MRTC 2GDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEO A;  5HV8 A;  2LML A;  3EJD A;  2N6Y A;  2FVA A;  2KWL A;  2MVU A;  2FVE A;  5KP6 B;  2EHS A;  2ROQ A;  4H2W C;  1OR5 A;  4HKG A;  1T8K A;  2L4B A;  1ACP A;  2MF4 A;  1DV5 A;  2FVF A;  2DNW A;  1F80 D;  2CGQ A;  2JU1 A;  2AF8 A;  1VKU A;  2XZ1 C;  3EJB A;  4R0M A;  5HVC A;  2FQ2 A;  1L0H A;  2MY5 A;  2CG5 B;  4BPG A;  2FHS C;  2L0Q A;  2MR8 A;  2K92 A;  2KGD A;  2N6Z A;  2X2B A;  3LMO A;  2LIW A;  4BPF A;  2MD9 A;  3GZM A;  2KW2 A;  2KG6 A;  2QNW A;  2N5I A;  5KP8 B;  2CQ8 A;  2N50 A;  4H2X C;  2LIU A;  2K94 A;  2MVV A;  2AFE A;  2AVA A;  2AFD A;  2FAC A;  1X3O A;  2KR5 A;  3EJE A;  3RG2 A;  2GDY A;  2MR7 A;  2PNG A;  2LPK A;  2FAE A;  2XZ0 D;  1L0I A;  5CZD B;  2K0Y A;  2K2Q A;  2K0X A;  4DG9 A;  2KOS A;  2M5R A;  2N5H A;  2FAD A;  2JGP A;  2LL8 A;  3CE7 A;  1HQB A;  2LOL A;  2KGE A;  2GDW A;  2KG9 A;  2CNR A;  4CA3 A;  2FQ0 A;  2KGA A;  1NQ4 A;  2EHT A;  1DNY A;  1HY8 A;  4PXH B;  3NY7 B;  2L9F A;  2L22 A;  3GZL A;  2KGC A;  1KLP A;  4PWV B;  2KG8 A;  2LTE A;  5EJD A;  2N98 A;  2KOO A;  2VSQ A;  4IZ6 A;  2FQ1 A;  2K93 A;  2KOQ A;  2KOR A;  2KOP A;  2LKI A;  1AF8 A;  4BPH A;  2JQ4 A;  4H2Y C;  5KP7 B;  2JU2 A;  4MRT C;  2GDX A; 
#chains in the Genus database with same CATH topology
 2FVE A;  5KP6 B;  1IMP A;  2EHS A;  3G4S P;  3DS4 A;  1S72 P;  5BS1 A;  2DNW A;  1F80 D;  2Z46 A;  2XZ1 C;  3B5I A;  4QKO A;  2Z44 A;  1EIA A;  2PEJ A;  1YJW P;  2CG5 B;  1M74 A;  2BUO A;  2CWO A;  3OW2 O;  1UNK A;  2KGD A;  4XRO A;  2LIW A;  4BPF A;  2VLO A;  1IUQ A;  3G29 A;  1VQO P;  4WYM A;  2PEM A;  5F2K A;  1VQP P;  1FR2 A;  2N50 A;  4PH0 A;  5I4T G;  3EJE A;  2AFD A;  2KR5 A;  2PEO A;  1N8R Q;  4U0D A;  4U0A A;  2ERH A;  3G71 P;  2FAE A;  3CMA P;  3G0V A;  1W2B O;  4DG9 A;  3DS3 A;  2NO8 A;  1JJ2 O;  2K0D X;  1CEI A;  7CEI A;  1QVG O;  2LOL A;  2GDW A;  2KGE A;  1YHQ P;  2EG5 A;  1NQ4 A;  2EHT A;  3DS0 A;  3NY7 B;  2EIA A;  3DS5 A;  1KLP A;  3CCS P;  2KG8 A;  5EJD A;  2VSQ A;  4IZ6 A;  2KOP A;  1AF8 A;  1KD1 Q;  2BHV A;  4BPH A;  2OTL P;  4U0B A;  1MZ8 A;  2GDX A;  5HV8 A;  3M1M A;  1YJN P;  2GYK A;  2MVU A;  2ONT A;  2M8N A;  4HKG A;  5DCK A;  3WBH A;  3G1G A;  1VQM P;  2GZF A;  3E2D A;  3DS2 A;  1A43 A;  1IMQ A;  2GZI A;  3CCQ P;  3I55 P;  4IPY A;  3LRY A;  3EJB A;  3CC2 P;  1ZMB A;  3DPH A;  1YIT P;  1GXG A;  3CXC O;  1QRJ A;  2MY5 A;  4BPG A;  4XFZ A;  1AYI A;  4XFY A;  2N6Z A;  2X2B A;  3HYB A;  4QNB A;  3G21 A;  3GZM A;  2K5X A;  3MGE A;  1YJ9 P;  1Q86 Q;  1YIJ P;  4PH1 A;  1Q81 Q;  4H2X C;  4COP A;  3CPW O;  1VQK P;  4XFX A;  3G6E P;  3CCL P;  2MR7 A;  4UHP B;  2PNG A;  4U0C A;  1VQ4 P;  4XRQ A;  2JB0 A;  1M6N A;  2XZ0 D;  1L0I A;  3CCR P;  1EOQ A;  2GZJ A;  2K0Y A;  2K2Q A;  2K0X A;  3VRL C;  2FAD A;  2JGP A;  3G26 A;  1BXI A;  3GJN A;  2OAR A;  4F37 A;  2JYG A;  1M1K Q;  2KG9 A;  4CA3 A;  2KGA A;  3G28 A;  3I56 P;  1DNY A;  1HY8 A;  4PXH B;  5HGO A;  2L22 A;  1K8A Q;  1GXH A;  5JPA A;  4PWV B;  2LTE A;  2KOO A;  5BS2 A;  2KOQ A;  1VQ6 P;  2XXM A;  2VLP A;  5KP7 B;  2JU2 A;  1RNI A;  3CC4 P;  3H0D A;  4U0F A;  1Q82 Q;  2LML A;  2FVA A;  2KWL A;  4M0I A;  5F2N A;  1OR5 A;  1VQL P;  2L4B A;  5HGN A;  3CD6 P;  1D1D A;  1ACP A;  3CCM P;  1Q7Y Q;  2JU1 A;  2Z45 A;  2GZG A;  2P9X A;  3H4E A;  2M8P A;  4R0M A;  2FQ2 A;  1ZNV A;  1EMV A;  1L0H A;  1YI2 P;  2FHS C;  2MR8 A;  2K92 A;  4COC A;  2LF4 A;  2QA4 P;  2KW2 A;  2KG6 A;  2QNW A;  2N5I A;  5KP8 B;  1K73 Q;  2CQ8 A;  2GZE A;  3B4Q A;  2MVV A;  2PY8 A;  2AFE A;  3CCU P;  1X3O A;  3CCJ P;  2EFJ A;  2LPK A;  4GR6 A;  1E0H A;  5EW5 E;  2OTJ P;  3CCV P;  2M5R A;  1Z6M A;  3H47 A;  3GKL C;  1E6J P;  2QEX P;  1K9M Q;  1RO2 A;  1NJI Q;  1BAJ A;  3P05 A;  1A8O A;  2M8L A;  2CNR A;  1AUM A;  2KGC A;  3G1I A;  2VLQ A;  2JO0 A;  2N98 A;  2KOD A;  2K93 A;  2KOR A;  2LKI A;  3HZQ A;  1KC8 Q;  1UJZ A;  2E1M A;  2JQ4 A;  3DTJ A;  3Q20 A;  1RO0 A;  2XT1 A;  4NEO A;  3EJD A;  2N6Y A;  1VQ8 P;  2ROQ A;  4H2W C;  1T8K A;  1VHN A;  1KQS O;  2MF4 A;  1DV5 A;  1M90 Q;  2FVF A;  2CGQ A;  1M6E X;  2AF8 A;  3U43 A;  1VQ5 P;  1VKU A;  5HVC A;  2L0Q A;  1VQN P;  3LMO A;  3NTE A;  3CCE P;  2MD9 A;  2PEQ A;  4GR2 A;  1VQ7 P;  1VQ9 P;  1K30 A;  3CME P;  2WPT A;  3CC7 P;  2LIU A;  1QVF O;  2K94 A;  2L6E A;  5F2O A;  2PEK A;  2AVA A;  2FAC A;  2XV6 A;  3RG2 A;  2PEN A;  2GDY A;  2PEI A;  5CZD B;  2KOS A;  2VLN A;  2N5H A;  1GPJ A;  2LL8 A;  3CE7 A;  1HQB A;  2FQ0 A;  4U0E A;  2L9F A;  5HGL A;  3GZL A;  3RG6 C;  5HGM A;  2DGY A;  2JBG A;  3DS1 A;  2FQ1 A;  2JAZ A;  2JYL A;  4H2Y C;  4MRT C; 
#chains in the Genus database with same CATH homology
 4NEO A;  5HV8 A;  2LML A;  3EJD A;  2N6Y A;  2FVA A;  2KWL A;  2MVU A;  2FVE A;  5KP6 B;  2EHS A;  2ROQ A;  4H2W C;  1OR5 A;  4HKG A;  1T8K A;  2L4B A;  1ACP A;  2MF4 A;  1DV5 A;  2FVF A;  2DNW A;  1F80 D;  2CGQ A;  2JU1 A;  2AF8 A;  1VKU A;  2XZ1 C;  3EJB A;  4R0M A;  5HVC A;  2FQ2 A;  1L0H A;  2MY5 A;  2CG5 B;  4BPG A;  2FHS C;  2L0Q A;  2MR8 A;  2K92 A;  2KGD A;  2N6Z A;  2X2B A;  3LMO A;  2LIW A;  4BPF A;  2MD9 A;  3GZM A;  2KW2 A;  2KG6 A;  2QNW A;  2N5I A;  5KP8 B;  2CQ8 A;  2N50 A;  4H2X C;  2LIU A;  2K94 A;  2MVV A;  2AFE A;  2AVA A;  2AFD A;  2FAC A;  1X3O A;  2KR5 A;  3EJE A;  3RG2 A;  2GDY A;  2MR7 A;  2PNG A;  2LPK A;  2FAE A;  2XZ0 D;  1L0I A;  5CZD B;  2K0Y A;  2K2Q A;  2K0X A;  4DG9 A;  2KOS A;  2M5R A;  2N5H A;  2FAD A;  2JGP A;  2LL8 A;  3CE7 A;  1HQB A;  2LOL A;  2KGE A;  2GDW A;  2KG9 A;  2CNR A;  4CA3 A;  2FQ0 A;  2KGA A;  1NQ4 A;  2EHT A;  1DNY A;  1HY8 A;  4PXH B;  3NY7 B;  2L9F A;  2L22 A;  3GZL A;  2KGC A;  1KLP A;  4PWV B;  2KG8 A;  2LTE A;  5EJD A;  2N98 A;  2KOO A;  2VSQ A;  4IZ6 A;  2FQ1 A;  2K93 A;  2KOQ A;  2KOR A;  2KOP A;  2LKI A;  1AF8 A;  4BPH A;  2JQ4 A;  4H2Y C;  5KP7 B;  2JU2 A;  4MRT C;  2GDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...