2XZ1C

The structure of the 2:2 (fully occupied) complex between stearoyl acyl carrier protein desaturase from ricinus communis (castor bean) and acyl carrier protein.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
82
structure length
81
Chain Sequence
AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Remote Control of Regioselectivity in Acyl-Acyl Carrier Protein-Desaturases.
pubmed doi rcsb
source organism Ricinus communis
molecule tags Oxidoreductase/lipid binding protein
molecule keywords ACYL-[ACYL-CARRIER-PROTEIN] DESATURASE, CHLOROPLASTIC
total genus 20
structure length 81
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2xz1C00
1NQ4A 2LL8A 4H2YC 2MY5A 5KP8B 2CGQA 2EHTA 2MR8A 2FVFA 3CE7A 2FQ0A 2KW2A 2KWLA 2FADA 2CQ8A 4HKGA 2FVEA 2N6ZA 2L9FA 2KG8A 2M5RA 2JU2A 2FHSC 2FVAA 2KGEA 3GZMA 1DNYA 2FQ2A 2X2BA 2MVUA 1L0HA 2N5IA 2JGPA 2L4BA 4PWVB 3GZLA 2AF8A 1VKUA 2LKIA 2GDWA 2ROQA 2KOSA 5KP6B 2KGAA 5CZDB 2MVVA 2KOOA 3EJEA 2XZ0D 2FQ1A 4BPHA 2KGCA 2QNWA 2MD9A 2LIWA 2EHSA 2DNWA 2LTEA 2K0XA 3EJDA 2KOPA 4H2WC 1HY8A 2K92A 2KG6A 5EJDA 2MR7A 2N50A 2LMLA 5HV8A 1KLPA 4BPGA 3EJBA 1L0IA 2FAEA 5KP7B 2CG5B 4PXHB 1ACPA 1DV5A 2L0QA 2JQ4A 2N6YA 4CA3A 4NEOA 1AF8A 2JU1A 2FACA 2N5HA 2XZ1C 2LIUA 2KG9A 2GDYA 2LPKA 3NY7B 4BPFA 1HQBA 2K93A 2N98A 2KORA 2K2QA 1T8KA 1OR5A 2CNRA 5HVCA 2AFDA 2AFEA 4MRTC 4DG9A 4R0MA 2KOQA 1X3OA 3LMOA 2LOLA 3RG2A 4IZ6A 1F80D 2GDXA 2KR5A 2MF4A 2PNGA 2K94A 2AVAA 2VSQA 2KGDA 4H2XC 2K0YA 2L22A
chains in the Genus database with same CATH superfamily
2EG5A 1KQSO 1NQ4A 1YJWP 2QA4P 3WBHA 2CGQA 2MR8A 2FVFA 1BAJA 1M6EX 2FADA 2JYLA 1VQ7P 2M5RA 2PEMA 3CPWO 1YHQP 3CCMP 4U0DA 3GZMA 2FQ2A 3CCLP 3CC4P 2L4BA 1VQ6P 2AF8A 1VKUA 2KOSA 5CZDB 3NTEA 2MVVA 2KOOA 5JPAA 2EFJA 2MD9A 1RO0A 2LF4A 3DTJA 1RO2A 3G0VA 2LIWA 4U0AA 5BS1A 2EHSA 1KD1Q 2DNWA 2E1MA 2PEJA 2PEOA 3CMAP 2KOPA 5EJDA 1MZ8A 3MGEA 2LMLA 5HV8A 3CCJP 2PENA 4BPGA 2GYKA 2FAEA 5KP7B 3CC2P 3DS3A 2CG5B 2PEQA 1ACPA 3Q20A 2L0QA 3I55P 2N6YA 4XFZA 3DPHA 2M8LA 1UNKA 1AF8A 2JU1A 2FACA 5DCKA 2LIUA 2NO8A 2OTLP 1HQBA 1ZNVA 4U0EA 2PY8A 3B5IA 5HVCA 1YITP 1IMPA 3CCVP 2GZEA 2PNGA 2L6EA 2K94A 1YI2P 2AVAA 2VSQA 2KGDA 3CD6P 1E6JP 3P05A 5KP8B 2EHTA 3I56P 3CE7A 5HGNA 2FQ0A 1YIJP 2JYGA 2KW2A 2GZFA 3G1GA 2FVEA 3DS5A 1JJ2O 3HYBA 2L9FA 1N8RQ 3GKLC 2FVAA 2KGEA 1K30A 2X2BA 3VRLC 4GR2A 2JGPA 1A8OA 3GZLA 1UJZA 3G1IA 4PH1A 5F2KA 3G29A 1VQ4P 2GDWA 5KP6B 1YJNP 2FQ1A 1W2BO 2K5XA 2PEIA 1M90Q 5HGLA 1VQ5P 3G21A 1M6NA 2K0XA 3EJDA 1GXGA 1HY8A 1K9MQ 2MR7A 4XFXA 1IMQA 4WYMA 1KLPA 1NJIQ 3EJBA 1L0IA 3H4EA 1QVFO 1DV5A 1VHNA 4U0FA 2JQ4A 5HGMA 2BHVA 1VQ9P 2N5HA 2KG9A 3G6EP 2LPKA 1QVGO 3DS0A 4U0CA 2KORA 1K8AQ 1VQOP 2AFDA 2Z44A 4R0MA 1VQLP 3CC7P 2GZGA 2LOLA 2DGYA 1M74A 2P9XA 3GJNA 3RG2A 4XROA 4XFYA 4COCA 4PWVB 2L22A 2JBGA 4UHPB 2LL8A 4H2YC 5F2OA 1Q86Q 2GZJA 3H47A 5HGOA 1CEIA 1KC8Q 3CCEP 2M8NA 4HKGA 2N6ZA 2KG8A 1RNIA 3E2DA 1ZMBA 1L0HA 2N5IA 1VQNP 1Z6MA 4XRQA 2XT1A 2KODA 2EIAA 4IPYA 2KGAA 2JAZA 4BPHA 2KGCA 2GZIA 1VQ8P 2LTEA 1Q82Q 3DS4A 2K92A 2KG6A 2Z45A 1K73Q 2N50A 1VQMP 1A43A 4PXHB 1VQKP 3G26A 4CA3A 3OW2O 3CCUP 3G71P 2XZ1C 1EIAA 3NY7B 4BPFA 2K93A 2N98A 2VLOA 1OR5A 1YJ9P 5I4TG 3G4SP 4DG9A 2KOQA 1X3OA 1AYIA 3U43A 4IZ6A 2MF4A 2Z46A 2VLNA 4H2XC 2K0YA 1S72P 2XXMA 1QRJA 3RG6C 2MY5A 2KWLA 2CQ8A 4U0BA 2K0DX 1EOQA 2JU2A 2FHSC 2ONTA 2XV6A 2PEKA 2OARA 1DNYA 7CEIA 3CCQP 3CCRP 2MVUA 4QNBA 3M1MA 3HZQA 2LKIA 2ERHA 2ROQA 3B4QA 1VQPP 4QKOA 3CMEP 4COPA 1E0HA 2JO0A 3EJEA 2XZ0D 2QNWA 2QEXP 2VLPA 5F2NA 1M1KQ 2BUOA 5EW5E 3G28A 3CXCO 4H2WC 4F37A 3CCSP 1BXIA 5BS2A 4GR6A 1IUQA 1EMVA 2CWOA 2M8PA 3DS1A 4NEOA 4M0IA 1AUMA 2VLQA 3LRYA 2GDYA 1FR2A 3DS2A 1Q7YQ 1GPJA 4PH0A 2K2QA 1T8KA 2CNRA 2WPTA 2AFEA 4MRTC 1GXHA 1Q81Q 3LMOA 1F80D 2JB0A 2GDXA 2KR5A 1D1DA 3H0DA 2OTJP
chains in the Genus database with same CATH topology
1NQ4A 2LL8A 4H2YC 2MY5A 5KP8B 2CGQA 2EHTA 2MR8A 2FVFA 3CE7A 2FQ0A 2KW2A 2KWLA 2FADA 2CQ8A 4HKGA 2FVEA 2N6ZA 2L9FA 2KG8A 2M5RA 2JU2A 2FHSC 2FVAA 2KGEA 3GZMA 1DNYA 2FQ2A 2X2BA 2MVUA 1L0HA 2N5IA 2JGPA 2L4BA 4PWVB 3GZLA 2AF8A 1VKUA 2LKIA 2GDWA 2ROQA 2KOSA 5KP6B 2KGAA 5CZDB 2MVVA 2KOOA 3EJEA 2XZ0D 2FQ1A 4BPHA 2KGCA 2QNWA 2MD9A 2LIWA 2EHSA 2DNWA 2LTEA 2K0XA 3EJDA 2KOPA 4H2WC 1HY8A 2K92A 2KG6A 5EJDA 2MR7A 2N50A 2LMLA 5HV8A 1KLPA 4BPGA 3EJBA 1L0IA 2FAEA 5KP7B 2CG5B 4PXHB 1ACPA 1DV5A 2L0QA 2JQ4A 2N6YA 4CA3A 4NEOA 1AF8A 2JU1A 2FACA 2N5HA 2XZ1C 2LIUA 2KG9A 2GDYA 2LPKA 3NY7B 4BPFA 1HQBA 2K93A 2N98A 2KORA 2K2QA 1T8KA 1OR5A 2CNRA 5HVCA 2AFDA 2AFEA 4MRTC 4DG9A 4R0MA 2KOQA 1X3OA 3LMOA 2LOLA 3RG2A 4IZ6A 1F80D 2GDXA 2KR5A 2MF4A 2PNGA 2K94A 2AVAA 2VSQA 2KGDA 4H2XC 2K0YA 2L22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NQ4 A;  2LL8 A;  4H2Y C;  2MY5 A;  5KP8 B;  2CGQ A;  2EHT A;  2MR8 A;  2FVF A;  3CE7 A;  2FQ0 A;  2KW2 A;  2KWL A;  2FAD A;  2CQ8 A;  4HKG A;  2FVE A;  2N6Z A;  2L9F A;  2KG8 A;  2M5R A;  2JU2 A;  2FHS C;  2FVA A;  2KGE A;  3GZM A;  1DNY A;  2FQ2 A;  2X2B A;  2MVU A;  1L0H A;  2N5I A;  2JGP A;  2L4B A;  4PWV B;  3GZL A;  2AF8 A;  1VKU A;  2LKI A;  2GDW A;  2ROQ A;  2KOS A;  5KP6 B;  2KGA A;  5CZD B;  2MVV A;  2KOO A;  3EJE A;  2XZ0 D;  2FQ1 A;  4BPH A;  2KGC A;  2QNW A;  2MD9 A;  2LIW A;  2EHS A;  2DNW A;  2LTE A;  2K0X A;  3EJD A;  2KOP A;  4H2W C;  1HY8 A;  2K92 A;  2KG6 A;  5EJD A;  2MR7 A;  2N50 A;  2LML A;  5HV8 A;  1KLP A;  4BPG A;  3EJB A;  1L0I A;  2FAE A;  5KP7 B;  2CG5 B;  4PXH B;  1ACP A;  1DV5 A;  2L0Q A;  2JQ4 A;  2N6Y A;  4CA3 A;  4NEO A;  1AF8 A;  2JU1 A;  2FAC A;  2N5H A;  2XZ1 C;  2LIU A;  2KG9 A;  2GDY A;  2LPK A;  3NY7 B;  4BPF A;  1HQB A;  2K93 A;  2N98 A;  2KOR A;  2K2Q A;  1T8K A;  1OR5 A;  2CNR A;  5HVC A;  2AFD A;  2AFE A;  4MRT C;  4DG9 A;  4R0M A;  2KOQ A;  1X3O A;  3LMO A;  2LOL A;  3RG2 A;  4IZ6 A;  1F80 D;  2GDX A;  2KR5 A;  2MF4 A;  2PNG A;  2K94 A;  2AVA A;  2VSQ A;  2KGD A;  4H2X C;  2K0Y A;  2L22 A; 
#chains in the Genus database with same CATH topology
 2EG5 A;  1KQS O;  1NQ4 A;  1YJW P;  2QA4 P;  3WBH A;  2CGQ A;  2MR8 A;  2FVF A;  1BAJ A;  1M6E X;  2FAD A;  2JYL A;  1VQ7 P;  2M5R A;  2PEM A;  3CPW O;  1YHQ P;  3CCM P;  4U0D A;  3GZM A;  2FQ2 A;  3CCL P;  3CC4 P;  2L4B A;  1VQ6 P;  2AF8 A;  1VKU A;  2KOS A;  5CZD B;  3NTE A;  2MVV A;  2KOO A;  5JPA A;  2EFJ A;  2MD9 A;  1RO0 A;  2LF4 A;  3DTJ A;  1RO2 A;  3G0V A;  2LIW A;  4U0A A;  5BS1 A;  2EHS A;  1KD1 Q;  2DNW A;  2E1M A;  2PEJ A;  2PEO A;  3CMA P;  2KOP A;  5EJD A;  1MZ8 A;  3MGE A;  2LML A;  5HV8 A;  3CCJ P;  2PEN A;  4BPG A;  2GYK A;  2FAE A;  5KP7 B;  3CC2 P;  3DS3 A;  2CG5 B;  2PEQ A;  1ACP A;  3Q20 A;  2L0Q A;  3I55 P;  2N6Y A;  4XFZ A;  3DPH A;  2M8L A;  1UNK A;  1AF8 A;  2JU1 A;  2FAC A;  5DCK A;  2LIU A;  2NO8 A;  2OTL P;  1HQB A;  1ZNV A;  4U0E A;  2PY8 A;  3B5I A;  5HVC A;  1YIT P;  1IMP A;  3CCV P;  2GZE A;  2PNG A;  2L6E A;  2K94 A;  1YI2 P;  2AVA A;  2VSQ A;  2KGD A;  3CD6 P;  1E6J P;  3P05 A;  5KP8 B;  2EHT A;  3I56 P;  3CE7 A;  5HGN A;  2FQ0 A;  1YIJ P;  2JYG A;  2KW2 A;  2GZF A;  3G1G A;  2FVE A;  3DS5 A;  1JJ2 O;  3HYB A;  2L9F A;  1N8R Q;  3GKL C;  2FVA A;  2KGE A;  1K30 A;  2X2B A;  3VRL C;  4GR2 A;  2JGP A;  1A8O A;  3GZL A;  1UJZ A;  3G1I A;  4PH1 A;  5F2K A;  3G29 A;  1VQ4 P;  2GDW A;  5KP6 B;  1YJN P;  2FQ1 A;  1W2B O;  2K5X A;  2PEI A;  1M90 Q;  5HGL A;  1VQ5 P;  3G21 A;  1M6N A;  2K0X A;  3EJD A;  1GXG A;  1HY8 A;  1K9M Q;  2MR7 A;  4XFX A;  1IMQ A;  4WYM A;  1KLP A;  1NJI Q;  3EJB A;  1L0I A;  3H4E A;  1QVF O;  1DV5 A;  1VHN A;  4U0F A;  2JQ4 A;  5HGM A;  2BHV A;  1VQ9 P;  2N5H A;  2KG9 A;  3G6E P;  2LPK A;  1QVG O;  3DS0 A;  4U0C A;  2KOR A;  1K8A Q;  1VQO P;  2AFD A;  2Z44 A;  4R0M A;  1VQL P;  3CC7 P;  2GZG A;  2LOL A;  2DGY A;  1M74 A;  2P9X A;  3GJN A;  3RG2 A;  4XRO A;  4XFY A;  4COC A;  4PWV B;  2L22 A;  2JBG A;  4UHP B;  2LL8 A;  4H2Y C;  5F2O A;  1Q86 Q;  2GZJ A;  3H47 A;  5HGO A;  1CEI A;  1KC8 Q;  3CCE P;  2M8N A;  4HKG A;  2N6Z A;  2KG8 A;  1RNI A;  3E2D A;  1ZMB A;  1L0H A;  2N5I A;  1VQN P;  1Z6M A;  4XRQ A;  2XT1 A;  2KOD A;  2EIA A;  4IPY A;  2KGA A;  2JAZ A;  4BPH A;  2KGC A;  2GZI A;  1VQ8 P;  2LTE A;  1Q82 Q;  3DS4 A;  2K92 A;  2KG6 A;  2Z45 A;  1K73 Q;  2N50 A;  1VQM P;  1A43 A;  4PXH B;  1VQK P;  3G26 A;  4CA3 A;  3OW2 O;  3CCU P;  3G71 P;  2XZ1 C;  1EIA A;  3NY7 B;  4BPF A;  2K93 A;  2N98 A;  2VLO A;  1OR5 A;  1YJ9 P;  5I4T G;  3G4S P;  4DG9 A;  2KOQ A;  1X3O A;  1AYI A;  3U43 A;  4IZ6 A;  2MF4 A;  2Z46 A;  2VLN A;  4H2X C;  2K0Y A;  1S72 P;  2XXM A;  1QRJ A;  3RG6 C;  2MY5 A;  2KWL A;  2CQ8 A;  4U0B A;  2K0D X;  1EOQ A;  2JU2 A;  2FHS C;  2ONT A;  2XV6 A;  2PEK A;  2OAR A;  1DNY A;  7CEI A;  3CCQ P;  3CCR P;  2MVU A;  4QNB A;  3M1M A;  3HZQ A;  2LKI A;  2ERH A;  2ROQ A;  3B4Q A;  1VQP P;  4QKO A;  3CME P;  4COP A;  1E0H A;  2JO0 A;  3EJE A;  2XZ0 D;  2QNW A;  2QEX P;  2VLP A;  5F2N A;  1M1K Q;  2BUO A;  5EW5 E;  3G28 A;  3CXC O;  4H2W C;  4F37 A;  3CCS P;  1BXI A;  5BS2 A;  4GR6 A;  1IUQ A;  1EMV A;  2CWO A;  2M8P A;  3DS1 A;  4NEO A;  4M0I A;  1AUM A;  2VLQ A;  3LRY A;  2GDY A;  1FR2 A;  3DS2 A;  1Q7Y Q;  1GPJ A;  4PH0 A;  2K2Q A;  1T8K A;  2CNR A;  2WPT A;  2AFE A;  4MRT C;  1GXH A;  1Q81 Q;  3LMO A;  1F80 D;  2JB0 A;  2GDX A;  2KR5 A;  1D1D A;  3H0D A;  2OTJ P; 
#chains in the Genus database with same CATH homology
 1NQ4 A;  2LL8 A;  4H2Y C;  2MY5 A;  5KP8 B;  2CGQ A;  2EHT A;  2MR8 A;  2FVF A;  3CE7 A;  2FQ0 A;  2KW2 A;  2KWL A;  2FAD A;  2CQ8 A;  4HKG A;  2FVE A;  2N6Z A;  2L9F A;  2KG8 A;  2M5R A;  2JU2 A;  2FHS C;  2FVA A;  2KGE A;  3GZM A;  1DNY A;  2FQ2 A;  2X2B A;  2MVU A;  1L0H A;  2N5I A;  2JGP A;  2L4B A;  4PWV B;  3GZL A;  2AF8 A;  1VKU A;  2LKI A;  2GDW A;  2ROQ A;  2KOS A;  5KP6 B;  2KGA A;  5CZD B;  2MVV A;  2KOO A;  3EJE A;  2XZ0 D;  2FQ1 A;  4BPH A;  2KGC A;  2QNW A;  2MD9 A;  2LIW A;  2EHS A;  2DNW A;  2LTE A;  2K0X A;  3EJD A;  2KOP A;  4H2W C;  1HY8 A;  2K92 A;  2KG6 A;  5EJD A;  2MR7 A;  2N50 A;  2LML A;  5HV8 A;  1KLP A;  4BPG A;  3EJB A;  1L0I A;  2FAE A;  5KP7 B;  2CG5 B;  4PXH B;  1ACP A;  1DV5 A;  2L0Q A;  2JQ4 A;  2N6Y A;  4CA3 A;  4NEO A;  1AF8 A;  2JU1 A;  2FAC A;  2N5H A;  2XZ1 C;  2LIU A;  2KG9 A;  2GDY A;  2LPK A;  3NY7 B;  4BPF A;  1HQB A;  2K93 A;  2N98 A;  2KOR A;  2K2Q A;  1T8K A;  1OR5 A;  2CNR A;  5HVC A;  2AFD A;  2AFE A;  4MRT C;  4DG9 A;  4R0M A;  2KOQ A;  1X3O A;  3LMO A;  2LOL A;  3RG2 A;  4IZ6 A;  1F80 D;  2GDX A;  2KR5 A;  2MF4 A;  2PNG A;  2K94 A;  2AVA A;  2VSQ A;  2KGD A;  4H2X C;  2K0Y A;  2L22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...