4UHPB

Crystal structure of the pyocin ap41 dnase-immunity complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
MDIKNNLSDYTESEFLEIIEEFFKNKSGLKGSELEKRMDKLVKHFEEVTSHPRKSGVIFHPKPGFETPEGIVKEVKEWRAANGLPGFKAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Ultra-High Affinity Protein-Protein Complexes of Pyocins S2 and Ap41 and Their Cognate Immunity Proteins from Pseudomonas Aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
molecule keywords LARGE COMPONENT OF PYOCIN AP41
total genus 31
structure length 90
sequence length 90
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 4uhpB00
3GJNA 1IMQA 4F37A 2VLOA 1GXHA 1UJZA 1IMPA 2VLQA 1CEIA 3U43A 1MZ8A 2JB0A 2JAZA 2GZFA 2JBGA 1ZNVA 4UHPB 1E0HA 2GZEA 2K5XA 2GZGA 2VLPA 2WPTA 7CEIA 2NO8A 1BXIA 2GZIA 2GZJA 2VLNA 1EMVA 2GYKA 3GKLC 4QKOA 1GXGA 2ERHA 1UNKA 1FR2A 2K0DX 5EW5E 1AYIA
chains in the Genus database with same CATH superfamily
1GPJA 4XFYA 3I55P 1S72P 1YJWP 3GZMA 2GZFA 2GZEA 1K8AQ 1VQLP 1ZMBA 1VQOP 2GYKA 4U0DA 1UNKA 4U0BA 4CA3A 2FQ2A 1M6NA 1HQBA 2E1MA 4QNBA 1KQSO 4IPYA 2KW2A 3LRYA 2ROQA 1E0HA 2EG5A 4XFZA 2AFDA 2LF4A 3G21A 4M0IA 1YI2P 4H2WC 3GKLC 2KG9A 5BS2A 1VQKP 5HGNA 3DS5A 1Z6MA 2PEIA 2KOPA 4H2XC 5DCKA 4PWVB 3M1MA 3CCVP 4HKGA 3CCMP 5KP6B 2PNGA 2WPTA 5HVCA 3CC4P 5KP8B 1OR5A 2VLNA 2FVAA 2N50A 2L22A 5EW5E 2KODA 2AVAA 4PH0A 1BAJA 1EOQA 2XT1A 2XZ0D 1MZ8A 2JB0A 3H47A 2QNWA 4UHPB 2GZGA 5F2NA 1AUMA 3G29A 1BXIA 3G6EP 1VQ7P 4BPGA 3RG2A 2N5HA 2ERHA 2K0YA 2MR8A 2DNWA 3HZQA 2PEQA 3P05A 2K94A 2KGAA 7CEIA 1QVGO 5BS1A 3DS4A 2FQ1A 2FACA 2MD9A 2KR5A 2M5RA 1VQNP 4H2YC 1AYIA 4F37A 2LTEA 3G71P 3CE7A 4IZ6A 1Q7YQ 2JAZA 2OTJP 2FVEA 2QA4P 1A8OA 2OTLP 3LMOA 1X3OA 4QKOA 5HGMA 3HYBA 1FR2A 3G26A 3G0VA 2K92A 3GJNA 2PEMA 2JYGA 3CC2P 2CNRA 1VQ4P 2L6EA 3G4SP 4PH1A 3RG6C 3E2DA 1HY8A 3CC7P 3CCRP 1EMVA 2LPKA 3GZLA 2Z46A 4GR2A 1DV5A 2GDWA 1KLPA 2VLOA 3CPWO 3DTJA 1VQMP 4U0EA 5F2KA 5KP7B 2KGDA 4R0MA 2NO8A 2L9FA 3B5IA 3OW2O 3CCJP 2CQ8A 3VRLC 2JU2A 3I56P 1GXGA 1RNIA 3CCUP 3H4EA 2EHTA 1DNYA 2GDYA 2QEXP 3EJBA 2L0QA 2CWOA 2AF8A 2CG5B 2KGCA 2FHSC 2M8LA 2P9XA 2GZIA 3MGEA 1RO2A 2KOOA 2XXMA 1EIAA 3H0DA 3DS0A 1VQ8P 3EJDA 3EJEA 2N98A 2PY8A 3CCQP 3CMEP 1YJ9P 1M1KQ 2ONTA 2KWLA 1VQ9P 2LKIA 2KG6A 2K5XA 1N8RQ 2MVUA 2XV6A 2GZJA 2LL8A 3WBHA 4COCA 1L0IA 2GDXA 2PEOA 4U0AA 2N6YA 2OARA 5F2OA 1YITP 2K93A 2MY5A 1VHNA 1VKUA 1A43A 3U43A 2FAEA 2JBGA 3DS2A 2N5IA 4XROA 2MVVA 1F80D 2FVFA 1NQ4A 3G28A 2BHVA 3B4QA 2LMLA 4WYMA 1YIJP 1IMQA 2JGPA 4U0FA 2Z44A 1YHQP 1CEIA 4DG9A 1L0HA 2AFEA 2PENA 4PXHB 1ZNVA 2EFJA 5I4TG 1IUQA 5HGOA 2PEKA 2MR7A 5EJDA 2Z45A 2CGQA 2LIWA 2N6ZA 4MRTC 3CCLP 1Q82Q 5CZDB 1NJIQ 4GR6A 2KOSA 2M8NA 1JJ2O 1W2BO 5HGLA 1KC8Q 1ACPA 1VQ6P 3CCSP 1QRJA 4U0CA 4BPHA 2K2QA 1E6JP 2VLQA 1D1DA 2KG8A 3NY7B 2JU1A 5JPAA 3DS3A 5HV8A 1Q81Q 3DPHA 2FQ0A 3Q20A 3CXCO 2K0DX 2LOLA 2JQ4A 2EIAA 3G1IA 3NTEA 2K0XA 2KOQA 3CD6P 3DS1A 2MF4A 2VLPA 1K9MQ 2LIUA 2JO0A 2VSQA 1RO0A 1YJNP 1Q86Q 2M8PA 2KORA 1T8KA 3G1GA 1M6EX 4NEOA 2X2BA 1K30A 2L4BA 1M90Q 1GXHA 1VQ5P 1UJZA 1IMPA 2BUOA 4BPFA 2JYLA 4XRQA 4COPA 2EHSA 1KD1Q 2DGYA 3CCEP 1VQPP 2KGEA 2FADA 1QVFO 1AF8A 2PEJA 2XZ1C 3CMAP 1M74A 4XFXA 1K73Q
chains in the Genus database with same CATH topology
3GJNA 1IMQA 4F37A 2VLOA 1GXHA 1UJZA 1IMPA 2VLQA 1CEIA 3U43A 1MZ8A 2JB0A 2JAZA 2GZFA 2JBGA 1ZNVA 4UHPB 1E0HA 2GZEA 2K5XA 2GZGA 2VLPA 2WPTA 7CEIA 2NO8A 1BXIA 2GZIA 2GZJA 2VLNA 1EMVA 2GYKA 3GKLC 4QKOA 1GXGA 2ERHA 1UNKA 1FR2A 2K0DX 5EW5E 1AYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GJN A;  1IMQ A;  4F37 A;  2VLO A;  1GXH A;  1UJZ A;  1IMP A;  2VLQ A;  1CEI A;  3U43 A;  1MZ8 A;  2JB0 A;  2JAZ A;  2GZF A;  2JBG A;  1ZNV A;  4UHP B;  1E0H A;  2GZE A;  2K5X A;  2GZG A;  2VLP A;  2WPT A;  7CEI A;  2NO8 A;  1BXI A;  2GZI A;  2GZJ A;  2VLN A;  1EMV A;  2GYK A;  3GKL C;  4QKO A;  1GXG A;  2ERH A;  1UNK A;  1FR2 A;  2K0D X;  5EW5 E;  1AYI A; 
#chains in the Genus database with same CATH topology
 1GPJ A;  4XFY A;  3I55 P;  1S72 P;  1YJW P;  3GZM A;  2GZF A;  2GZE A;  1K8A Q;  1VQL P;  1ZMB A;  1VQO P;  2GYK A;  4U0D A;  1UNK A;  4U0B A;  4CA3 A;  2FQ2 A;  1M6N A;  1HQB A;  2E1M A;  4QNB A;  1KQS O;  4IPY A;  2KW2 A;  3LRY A;  2ROQ A;  1E0H A;  2EG5 A;  4XFZ A;  2AFD A;  2LF4 A;  3G21 A;  4M0I A;  1YI2 P;  4H2W C;  3GKL C;  2KG9 A;  5BS2 A;  1VQK P;  5HGN A;  3DS5 A;  1Z6M A;  2PEI A;  2KOP A;  4H2X C;  5DCK A;  4PWV B;  3M1M A;  3CCV P;  4HKG A;  3CCM P;  5KP6 B;  2PNG A;  2WPT A;  5HVC A;  3CC4 P;  5KP8 B;  1OR5 A;  2VLN A;  2FVA A;  2N50 A;  2L22 A;  5EW5 E;  2KOD A;  2AVA A;  4PH0 A;  1BAJ A;  1EOQ A;  2XT1 A;  2XZ0 D;  1MZ8 A;  2JB0 A;  3H47 A;  2QNW A;  4UHP B;  2GZG A;  5F2N A;  1AUM A;  3G29 A;  1BXI A;  3G6E P;  1VQ7 P;  4BPG A;  3RG2 A;  2N5H A;  2ERH A;  2K0Y A;  2MR8 A;  2DNW A;  3HZQ A;  2PEQ A;  3P05 A;  2K94 A;  2KGA A;  7CEI A;  1QVG O;  5BS1 A;  3DS4 A;  2FQ1 A;  2FAC A;  2MD9 A;  2KR5 A;  2M5R A;  1VQN P;  4H2Y C;  1AYI A;  4F37 A;  2LTE A;  3G71 P;  3CE7 A;  4IZ6 A;  1Q7Y Q;  2JAZ A;  2OTJ P;  2FVE A;  2QA4 P;  1A8O A;  2OTL P;  3LMO A;  1X3O A;  4QKO A;  5HGM A;  3HYB A;  1FR2 A;  3G26 A;  3G0V A;  2K92 A;  3GJN A;  2PEM A;  2JYG A;  3CC2 P;  2CNR A;  1VQ4 P;  2L6E A;  3G4S P;  4PH1 A;  3RG6 C;  3E2D A;  1HY8 A;  3CC7 P;  3CCR P;  1EMV A;  2LPK A;  3GZL A;  2Z46 A;  4GR2 A;  1DV5 A;  2GDW A;  1KLP A;  2VLO A;  3CPW O;  3DTJ A;  1VQM P;  4U0E A;  5F2K A;  5KP7 B;  2KGD A;  4R0M A;  2NO8 A;  2L9F A;  3B5I A;  3OW2 O;  3CCJ P;  2CQ8 A;  3VRL C;  2JU2 A;  3I56 P;  1GXG A;  1RNI A;  3CCU P;  3H4E A;  2EHT A;  1DNY A;  2GDY A;  2QEX P;  3EJB A;  2L0Q A;  2CWO A;  2AF8 A;  2CG5 B;  2KGC A;  2FHS C;  2M8L A;  2P9X A;  2GZI A;  3MGE A;  1RO2 A;  2KOO A;  2XXM A;  1EIA A;  3H0D A;  3DS0 A;  1VQ8 P;  3EJD A;  3EJE A;  2N98 A;  2PY8 A;  3CCQ P;  3CME P;  1YJ9 P;  1M1K Q;  2ONT A;  2KWL A;  1VQ9 P;  2LKI A;  2KG6 A;  2K5X A;  1N8R Q;  2MVU A;  2XV6 A;  2GZJ A;  2LL8 A;  3WBH A;  4COC A;  1L0I A;  2GDX A;  2PEO A;  4U0A A;  2N6Y A;  2OAR A;  5F2O A;  1YIT P;  2K93 A;  2MY5 A;  1VHN A;  1VKU A;  1A43 A;  3U43 A;  2FAE A;  2JBG A;  3DS2 A;  2N5I A;  4XRO A;  2MVV A;  1F80 D;  2FVF A;  1NQ4 A;  3G28 A;  2BHV A;  3B4Q A;  2LML A;  4WYM A;  1YIJ P;  1IMQ A;  2JGP A;  4U0F A;  2Z44 A;  1YHQ P;  1CEI A;  4DG9 A;  1L0H A;  2AFE A;  2PEN A;  4PXH B;  1ZNV A;  2EFJ A;  5I4T G;  1IUQ A;  5HGO A;  2PEK A;  2MR7 A;  5EJD A;  2Z45 A;  2CGQ A;  2LIW A;  2N6Z A;  4MRT C;  3CCL P;  1Q82 Q;  5CZD B;  1NJI Q;  4GR6 A;  2KOS A;  2M8N A;  1JJ2 O;  1W2B O;  5HGL A;  1KC8 Q;  1ACP A;  1VQ6 P;  3CCS P;  1QRJ A;  4U0C A;  4BPH A;  2K2Q A;  1E6J P;  2VLQ A;  1D1D A;  2KG8 A;  3NY7 B;  2JU1 A;  5JPA A;  3DS3 A;  5HV8 A;  1Q81 Q;  3DPH A;  2FQ0 A;  3Q20 A;  3CXC O;  2K0D X;  2LOL A;  2JQ4 A;  2EIA A;  3G1I A;  3NTE A;  2K0X A;  2KOQ A;  3CD6 P;  3DS1 A;  2MF4 A;  2VLP A;  1K9M Q;  2LIU A;  2JO0 A;  2VSQ A;  1RO0 A;  1YJN P;  1Q86 Q;  2M8P A;  2KOR A;  1T8K A;  3G1G A;  1M6E X;  4NEO A;  2X2B A;  1K30 A;  2L4B A;  1M90 Q;  1GXH A;  1VQ5 P;  1UJZ A;  1IMP A;  2BUO A;  4BPF A;  2JYL A;  4XRQ A;  4COP A;  2EHS A;  1KD1 Q;  2DGY A;  3CCE P;  1VQP P;  2KGE A;  2FAD A;  1QVF O;  1AF8 A;  2PEJ A;  2XZ1 C;  3CMA P;  1M74 A;  4XFX A;  1K73 Q; 
#chains in the Genus database with same CATH homology
 3GJN A;  1IMQ A;  4F37 A;  2VLO A;  1GXH A;  1UJZ A;  1IMP A;  2VLQ A;  1CEI A;  3U43 A;  1MZ8 A;  2JB0 A;  2JAZ A;  2GZF A;  2JBG A;  1ZNV A;  4UHP B;  1E0H A;  2GZE A;  2K5X A;  2GZG A;  2VLP A;  2WPT A;  7CEI A;  2NO8 A;  1BXI A;  2GZI A;  2GZJ A;  2VLN A;  1EMV A;  2GYK A;  3GKL C;  4QKO A;  1GXG A;  2ERH A;  1UNK A;  1FR2 A;  2K0D X;  5EW5 E;  1AYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...