4UHPB

Crystal structure of the pyocin ap41 dnase-immunity complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
MDIKNNLSDYTESEFLEIIEEFFKNKSGLKGSELEKRMDKLVKHFEEVTSHPRKSGVIFHPKPGFETPEGIVKEVKEWRAANGLPGFKAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords LARGE COMPONENT OF PYOCIN AP41
publication title Structures of the Ultra-High Affinity Protein-Protein Complexes of Pyocins S2 and Ap41 and Their Cognate Immunity Proteins from Pseudomonas Aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
total genus 31
structure length 90
sequence length 90
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 4uhpB00
1BXIA 2GZIA 2K0DX 2GZFA 2VLPA 4UHPB 2JAZA 1IMPA 2WPTA 5EW5E 1ZNVA 1IMQA 2ERHA 2JB0A 4QKOA 3GJNA 2GZJA 1GXGA 2VLOA 2GYKA 3U43A 1CEIA 1UNKA 7CEIA 2VLNA 2GZEA 2NO8A 2K5XA 2VLQA 1E0HA 2JBGA 4F37A 3GKLC 1FR2A 2GZGA 1GXHA 1AYIA 1UJZA 1EMVA 1MZ8A
chains in the Genus database with same CATH superfamily
3B4QA 1NQ4A 4GR2A 1RNIA 2X2BA 2KR5A 2BUOA 1E0HA 1VQOP 1VQ9P 3G1GA 2LIUA 5HGOA 1OR5A 1W2BO 1F80D 1GXHA 2AVAA 2PEKA 2FVEA 1VQ6P 1YIJP 2AFDA 2JGPA 3CCJP 5HGNA 4NEOA 1CEIA 1UNKA 2KODA 2MVVA 2K5XA 2CWOA 3B5IA 3EJDA 3CC7P 1VQ7P 5KP8B 3CCSP 1YI2P 1AYIA 2LTEA 2K0YA 2K92A 4COPA 3CMAP 2PEQA 1T8KA 3VRLC 3H4EA 2XT1A 1VQ4P 2MVUA 2LMLA 2GZJA 2VLOA 2KOQA 3GZMA 4WYMA 1Q81Q 4F37A 1KQSO 1VQNP 2XZ0D 2MR7A 2OTJP 1M6EX 5BS2A 1BAJA 4DG9A 2FAEA 2KOOA 4H2WC 1MZ8A 2Z44A 2DNWA 2EFJA 1K73Q 2PEJA 1X3OA 2CNRA 2KGDA 2CQ8A 3H0DA 1RO2A 2N5IA 3G1IA 1VQ8P 3GKLC 1KD1Q 2FVFA 1YITP 3G26A 1DV5A 2JYLA 3G71P 1KLPA 5KP7B 4PH0A 2MD9A 2GZFA 2M8NA 4XROA 5EJDA 1VQKP 3CCUP 3GJNA 5BS1A 2PEMA 1AUMA 3CCMP 3LMOA 3EJBA 1QVGO 2MY5A 4U0AA 2KG8A 2KW2A 3CCEP 4IZ6A 1NJIQ 3H47A 2FQ0A 2AF8A 3NTEA 1D1DA 1M90Q 3DS2A 2VLNA 3CPWO 4CA3A 2QEXP 2GDWA 1N8RQ 2LPKA 3I55P 4PXHB 5DCKA 3DPHA 1IMPA 2PEOA 2ERHA 3U43A 2NO8A 1EOQA 2OTLP 4PWVB 4U0FA 2N50A 1Q86Q 2L6EA 3NY7B 2K94A 3CCVP 2L0QA 1IMQA 2GYKA 4XRQA 1YHQP 2FACA 2QA4P 1JJ2O 3DTJA 2M8LA 2XV6A 1K9MQ 4U0BA 2GDXA 3G29A 2K0DX 2N5HA 1L0IA 2AFEA 2M5RA 3G21A 3CE7A 2OARA 2LIWA 4QKOA 1GXGA 7CEIA 2KG9A 4U0CA 3DS0A 2KGCA 3HZQA 1YJNP 2XZ1C 2EG5A 2PEIA 2QNWA 5CZDB 2JAZA 3DS4A 1ZMBA 2DGYA 2JU1A 3I56P 4PH1A 3CCQP 5KP6B 2LOLA 3LRYA 3G6EP 2GZEA 1Q7YQ 2FQ1A 2JBGA 2P9XA 2KGEA 3G4SP 1DNYA 4COCA 2KGAA 2FHSC 4R0MA 3CXCO 2FQ2A 2PY8A 2CG5B 2MF4A 3DS5A 2EIAA 2M8PA 4BPHA 2GZIA 2N6YA 2K93A 2JU2A 4HKGA 1QRJA 3CC4P 2VLPA 2LKIA 3GZLA 5F2KA 2L9FA 4XFXA 1A43A 3CCRP 4MRTC 2MR8A 4M0IA 2L4BA 1VQLP 1GPJA 1ACPA 1A8OA 2CGQA 2ROQA 4XFZA 1UJZA 4H2XC 3MGEA 4BPGA 2KORA 1KC8Q 5F2NA 5HGLA 2KWLA 1K30A 2K2QA 1IUQA 4GR6A 2JO0A 1QVFO 3RG6C 4IPYA 1FR2A 2XXMA 3EJEA 2KOPA 3WBHA 1BXIA 1Q82Q 2L22A 2WPTA 1ZNVA 2JQ4A 2VSQA 5HGMA 4H2YC 2GDYA 2LF4A 2Z45A 2EHTA 3CC2P 3HYBA 1YJ9P 3RG2A 4BPFA 2KOSA 2LL8A 2Z46A 5HV8A 1M74A 1VQPP 2FVAA 2K0XA 5F2OA 1M1KQ 1VQMP 3CMEP 1HY8A 2N98A 4U0DA 4QNBA 3E2DA 3Q20A 1EIAA 5EW5E 1VHNA 1M6NA 1E6JP 2KG6A 5JPAA 1K8AQ 2FADA 3DS1A 2E1MA 2EHSA 3M1MA 3G28A 1S72P 2PNGA 3CD6P 2VLQA 2ONTA 1YJWP 2N6ZA 1HQBA 2JYGA 3P05A 1AF8A 1RO0A 2PENA 4UHPB 1L0HA 3G0VA 2JB0A 5HVCA 3CCLP 1VQ5P 3DS3A 4XFYA 2BHVA 3OW2O 2GZGA 5I4TG 1EMVA 1Z6MA 1VKUA 4U0EA
chains in the Genus database with same CATH topology
1BXIA 2GZIA 2K0DX 2GZFA 2VLPA 4UHPB 2JAZA 1IMPA 2WPTA 5EW5E 1ZNVA 1IMQA 2ERHA 2JB0A 4QKOA 3GJNA 2GZJA 1GXGA 2VLOA 2GYKA 3U43A 1CEIA 1UNKA 7CEIA 2VLNA 2GZEA 2NO8A 2K5XA 2VLQA 1E0HA 2JBGA 4F37A 3GKLC 1FR2A 2GZGA 1GXHA 1AYIA 1UJZA 1EMVA 1MZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BXI A;  2GZI A;  2K0D X;  2GZF A;  2VLP A;  4UHP B;  2JAZ A;  1IMP A;  2WPT A;  5EW5 E;  1ZNV A;  1IMQ A;  2ERH A;  2JB0 A;  4QKO A;  3GJN A;  2GZJ A;  1GXG A;  2VLO A;  2GYK A;  3U43 A;  1CEI A;  1UNK A;  7CEI A;  2VLN A;  2GZE A;  2NO8 A;  2K5X A;  2VLQ A;  1E0H A;  2JBG A;  4F37 A;  3GKL C;  1FR2 A;  2GZG A;  1GXH A;  1AYI A;  1UJZ A;  1EMV A;  1MZ8 A; 
#chains in the Genus database with same CATH topology
 3B4Q A;  1NQ4 A;  4GR2 A;  1RNI A;  2X2B A;  2KR5 A;  2BUO A;  1E0H A;  1VQO P;  1VQ9 P;  3G1G A;  2LIU A;  5HGO A;  1OR5 A;  1W2B O;  1F80 D;  1GXH A;  2AVA A;  2PEK A;  2FVE A;  1VQ6 P;  1YIJ P;  2AFD A;  2JGP A;  3CCJ P;  5HGN A;  4NEO A;  1CEI A;  1UNK A;  2KOD A;  2MVV A;  2K5X A;  2CWO A;  3B5I A;  3EJD A;  3CC7 P;  1VQ7 P;  5KP8 B;  3CCS P;  1YI2 P;  1AYI A;  2LTE A;  2K0Y A;  2K92 A;  4COP A;  3CMA P;  2PEQ A;  1T8K A;  3VRL C;  3H4E A;  2XT1 A;  1VQ4 P;  2MVU A;  2LML A;  2GZJ A;  2VLO A;  2KOQ A;  3GZM A;  4WYM A;  1Q81 Q;  4F37 A;  1KQS O;  1VQN P;  2XZ0 D;  2MR7 A;  2OTJ P;  1M6E X;  5BS2 A;  1BAJ A;  4DG9 A;  2FAE A;  2KOO A;  4H2W C;  1MZ8 A;  2Z44 A;  2DNW A;  2EFJ A;  1K73 Q;  2PEJ A;  1X3O A;  2CNR A;  2KGD A;  2CQ8 A;  3H0D A;  1RO2 A;  2N5I A;  3G1I A;  1VQ8 P;  3GKL C;  1KD1 Q;  2FVF A;  1YIT P;  3G26 A;  1DV5 A;  2JYL A;  3G71 P;  1KLP A;  5KP7 B;  4PH0 A;  2MD9 A;  2GZF A;  2M8N A;  4XRO A;  5EJD A;  1VQK P;  3CCU P;  3GJN A;  5BS1 A;  2PEM A;  1AUM A;  3CCM P;  3LMO A;  3EJB A;  1QVG O;  2MY5 A;  4U0A A;  2KG8 A;  2KW2 A;  3CCE P;  4IZ6 A;  1NJI Q;  3H47 A;  2FQ0 A;  2AF8 A;  3NTE A;  1D1D A;  1M90 Q;  3DS2 A;  2VLN A;  3CPW O;  4CA3 A;  2QEX P;  2GDW A;  1N8R Q;  2LPK A;  3I55 P;  4PXH B;  5DCK A;  3DPH A;  1IMP A;  2PEO A;  2ERH A;  3U43 A;  2NO8 A;  1EOQ A;  2OTL P;  4PWV B;  4U0F A;  2N50 A;  1Q86 Q;  2L6E A;  3NY7 B;  2K94 A;  3CCV P;  2L0Q A;  1IMQ A;  2GYK A;  4XRQ A;  1YHQ P;  2FAC A;  2QA4 P;  1JJ2 O;  3DTJ A;  2M8L A;  2XV6 A;  1K9M Q;  4U0B A;  2GDX A;  3G29 A;  2K0D X;  2N5H A;  1L0I A;  2AFE A;  2M5R A;  3G21 A;  3CE7 A;  2OAR A;  2LIW A;  4QKO A;  1GXG A;  7CEI A;  2KG9 A;  4U0C A;  3DS0 A;  2KGC A;  3HZQ A;  1YJN P;  2XZ1 C;  2EG5 A;  2PEI A;  2QNW A;  5CZD B;  2JAZ A;  3DS4 A;  1ZMB A;  2DGY A;  2JU1 A;  3I56 P;  4PH1 A;  3CCQ P;  5KP6 B;  2LOL A;  3LRY A;  3G6E P;  2GZE A;  1Q7Y Q;  2FQ1 A;  2JBG A;  2P9X A;  2KGE A;  3G4S P;  1DNY A;  4COC A;  2KGA A;  2FHS C;  4R0M A;  3CXC O;  2FQ2 A;  2PY8 A;  2CG5 B;  2MF4 A;  3DS5 A;  2EIA A;  2M8P A;  4BPH A;  2GZI A;  2N6Y A;  2K93 A;  2JU2 A;  4HKG A;  1QRJ A;  3CC4 P;  2VLP A;  2LKI A;  3GZL A;  5F2K A;  2L9F A;  4XFX A;  1A43 A;  3CCR P;  4MRT C;  2MR8 A;  4M0I A;  2L4B A;  1VQL P;  1GPJ A;  1ACP A;  1A8O A;  2CGQ A;  2ROQ A;  4XFZ A;  1UJZ A;  4H2X C;  3MGE A;  4BPG A;  2KOR A;  1KC8 Q;  5F2N A;  5HGL A;  2KWL A;  1K30 A;  2K2Q A;  1IUQ A;  4GR6 A;  2JO0 A;  1QVF O;  3RG6 C;  4IPY A;  1FR2 A;  2XXM A;  3EJE A;  2KOP A;  3WBH A;  1BXI A;  1Q82 Q;  2L22 A;  2WPT A;  1ZNV A;  2JQ4 A;  2VSQ A;  5HGM A;  4H2Y C;  2GDY A;  2LF4 A;  2Z45 A;  2EHT A;  3CC2 P;  3HYB A;  1YJ9 P;  3RG2 A;  4BPF A;  2KOS A;  2LL8 A;  2Z46 A;  5HV8 A;  1M74 A;  1VQP P;  2FVA A;  2K0X A;  5F2O A;  1M1K Q;  1VQM P;  3CME P;  1HY8 A;  2N98 A;  4U0D A;  4QNB A;  3E2D A;  3Q20 A;  1EIA A;  5EW5 E;  1VHN A;  1M6N A;  1E6J P;  2KG6 A;  5JPA A;  1K8A Q;  2FAD A;  3DS1 A;  2E1M A;  2EHS A;  3M1M A;  3G28 A;  1S72 P;  2PNG A;  3CD6 P;  2VLQ A;  2ONT A;  1YJW P;  2N6Z A;  1HQB A;  2JYG A;  3P05 A;  1AF8 A;  1RO0 A;  2PEN A;  4UHP B;  1L0H A;  3G0V A;  2JB0 A;  5HVC A;  3CCL P;  1VQ5 P;  3DS3 A;  4XFY A;  2BHV A;  3OW2 O;  2GZG A;  5I4T G;  1EMV A;  1Z6M A;  1VKU A;  4U0E A; 
#chains in the Genus database with same CATH homology
 1BXI A;  2GZI A;  2K0D X;  2GZF A;  2VLP A;  4UHP B;  2JAZ A;  1IMP A;  2WPT A;  5EW5 E;  1ZNV A;  1IMQ A;  2ERH A;  2JB0 A;  4QKO A;  3GJN A;  2GZJ A;  1GXG A;  2VLO A;  2GYK A;  3U43 A;  1CEI A;  1UNK A;  7CEI A;  2VLN A;  2GZE A;  2NO8 A;  2K5X A;  2VLQ A;  1E0H A;  2JBG A;  4F37 A;  3GKL C;  1FR2 A;  2GZG A;  1GXH A;  1AYI A;  1UJZ A;  1EMV A;  1MZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...