4UHPB

Crystal structure of the pyocin ap41 dnase-immunity complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
b'MDIKNNLSDYTESEFLEIIEEFFKNKSGLKGSELEKRMDKLVKHFEEVTSHPRKSGVIFHPKPGFETPEGIVKEVKEWRAANGLPGFKAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LARGE COMPONENT OF PYOCIN AP41
publication title Structures of the Ultra-High Affinity Protein-Protein Complexes of Pyocins S2 and Ap41 and Their Cognate Immunity Proteins from Pseudomonas Aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
total genus 31
structure length 90
sequence length 90
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 4uhpB00
1GXHA 7CEIA 1BXIA 1FR2A 2ERHA 2K5XA 1IMQA 1MZ8A 1UNKA 2VLQA 2JBGA 2NO8A 2VLNA 4UHPB 2JAZA 2VLPA 1CEIA 1UJZA 2WPTA 5EW5E 1IMPA 1GXGA 4F37A 3GKLC 2JB0A 1ZNVA 1EMVA 2VLOA 2GYKA 4QKOA 2GZGA 2GZJA 3U43A 2GZEA 1AYIA 1E0HA 2K0DX 2GZFA 3GJNA 2GZIA
chains in the Genus database with same CATH superfamily
2MR7A 1VQ8P 2N5HA 1K8AQ 1RO2A 2FVEA 1K30A 2VLPA 2PEQA 1M90Q 4H2XC 2L0QA 3B5IA 2KG9A 2KWLA 2QEXP 2MF4A 4BPFA 3I56P 1L0HA 1Q82Q 2PEIA 4COCA 3G26A 1FR2A 1KD1Q 1YI2P 4XROA 1VQPP 3G1IA 2Z45A 4BPGA 1NJIQ 1S72P 3RG6C 2Z46A 4CA3A 2EFJA 2MR8A 2P9XA 1GPJA 2M5RA 3DS4A 2K2QA 2FHSC 2GDXA 3DPHA 4PXHB 1W2BO 2K0YA 2KODA 2N5IA 5F2OA 2CQ8A 2KG8A 3G28A 1CEIA 2CG5B 3CMAP 2JYGA 3DS5A 1VKUA 2KR5A 4MRTC 2OTJP 1E0HA 2FQ1A 2KW2A 2PNGA 5HGNA 3EJDA 2JU1A 1AUMA 4IZ6A 2VLNA 2BUOA 2QA4P 2JAZA 2KORA 2K0XA 2WPTA 2PY8A 4U0CA 2KOQA 1EMVA 3CCEP 2FQ0A 5KP7B 1AF8A 1VQNP 2FVFA 4PH1A 1RO0A 4XFXA 1T8KA 1QVFO 1NQ4A 4BPHA 5HVCA 2OTLP 4GR6A 4H2WC 3VRLC 1KLPA 1K9MQ 2N98A 1VQLP 3G71P 2JB0A 3CCUP 1EIAA 3CE7A 5KP6B 2BHVA 3GJNA 4M0IA 3CXCO 2E1MA 4R0MA 2VLQA 2AFDA 1QRJA 3G1GA 3G4SP 1Q81Q 2XV6A 1IMPA 2K94A 2LOLA 2KOOA 3CC2P 3CCMP 3H47A 1JJ2O 2PEOA 2XZ1C 2N6ZA 2L4BA 2FACA 2FVAA 1D1DA 4H2YC 1ZMBA 3G29A 1F80D 1VQOP 1Z6MA 2MY5A 3LRYA 3H0DA 2PEJA 4PWVB 1VQ7P 2KOPA 2LIWA 1N8RQ 5BS2A 3RG2A 1E6JP 2AFEA 2X2BA 2MD9A 2K93A 3DS2A 2EIAA 1YIJP 2Z44A 2JQ4A 1AYIA 1ACPA 1EOQA 1BAJA 2FAEA 1HY8A 3NY7B 3Q20A 2M8NA 1M6NA 1YJ9P 3LMOA 4GR2A 1OR5A 1KC8Q 3HYBA 1MZ8A 1VQ6P 5CZDB 4WYMA 1RNIA 2AF8A 3CMEP 2K92A 1Q86Q 4QNBA 2GDYA 3GZMA 1X3OA 2EHSA 2KGAA 2KOSA 5HGLA 4U0BA 2VLOA 4NEOA 2AVAA 3DTJA 2GZEA 2M8LA 2ROQA 1GXHA 1BXIA 2LPKA 1VQ9P 3DS1A 4UHPB 4COPA 2KGDA 1HQBA 1VQKP 3DS3A 2KGCA 1ZNVA 3DS0A 3G6EP 3CCSP 2MVVA 3EJBA 1A8OA 3I55P 2LMLA 1A43A 1IUQA 4DG9A 2JO0A 4F37A 2N50A 2KGEA 3CPWO 1YJNP 2GZJA 2L6EA 1K73Q 3P05A 2CWOA 2VSQA 2EHTA 2FADA 5I4TG 2LIUA 3NTEA 5DCKA 1IMQA 1UNKA 3G21A 1VQ5P 1DNYA 2PEKA 3HZQA 4XFYA 2LKIA 5F2KA 1VQMP 5EJDA 3CCVP 4QKOA 2FQ2A 4XRQA 5HV8A 2CNRA 4IPYA 1DV5A 3CC4P 2LF4A 2NO8A 5HGMA 2PEMA 2MVUA 5JPAA 2CGQA 2XZ0D 1L0IA 2L9FA 3MGEA 3CCJP 3CC7P 1M6EX 1KQSO 2GZGA 1YHQP 1QVGO 5KP8B 2XXMA 3WBHA 2JYLA 4HKGA 3M1MA 4U0AA 5HGOA 5F2NA 2LTEA 3B4QA 2PENA 1M1KQ 3EJEA 2DNWA 3CCLP 3U43A 4U0DA 4PH0A 3OW2O 2K5XA 2ERHA 3CCRP 4U0EA 1M74A 2EG5A 2ONTA 1YJWP 1UJZA 5EW5E 2XT1A 2LL8A 2OARA 3GKLC 2L22A 4XFZA 2GYKA 2K0DX 3E2DA 2GZFA 3G0VA 2GZIA 7CEIA 1Q7YQ 5BS1A 3CCQP 1YITP 3H4EA 2DGYA 1VQ4P 2N6YA 2JBGA 2JU2A 2KG6A 3CD6P 2QNWA 1GXGA 1VHNA 3GZLA 2GDWA 4U0FA 2M8PA 2JGPA
chains in the Genus database with same CATH topology
1GXHA 7CEIA 1BXIA 1FR2A 2ERHA 2K5XA 1IMQA 1MZ8A 1UNKA 2VLQA 2JBGA 2NO8A 2VLNA 4UHPB 2JAZA 2VLPA 1CEIA 1UJZA 2WPTA 5EW5E 1IMPA 1GXGA 4F37A 3GKLC 2JB0A 1ZNVA 1EMVA 2VLOA 2GYKA 4QKOA 2GZGA 2GZJA 3U43A 2GZEA 1AYIA 1E0HA 2K0DX 2GZFA 3GJNA 2GZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXH A;  7CEI A;  1BXI A;  1FR2 A;  2ERH A;  2K5X A;  1IMQ A;  1MZ8 A;  1UNK A;  2VLQ A;  2JBG A;  2NO8 A;  2VLN A;  4UHP B;  2JAZ A;  2VLP A;  1CEI A;  1UJZ A;  2WPT A;  5EW5 E;  1IMP A;  1GXG A;  4F37 A;  3GKL C;  2JB0 A;  1ZNV A;  1EMV A;  2VLO A;  2GYK A;  4QKO A;  2GZG A;  2GZJ A;  3U43 A;  2GZE A;  1AYI A;  1E0H A;  2K0D X;  2GZF A;  3GJN A;  2GZI A; 
#chains in the Genus database with same CATH topology
 2MR7 A;  1VQ8 P;  2N5H A;  1K8A Q;  1RO2 A;  2FVE A;  1K30 A;  2VLP A;  2PEQ A;  1M90 Q;  4H2X C;  2L0Q A;  3B5I A;  2KG9 A;  2KWL A;  2QEX P;  2MF4 A;  4BPF A;  3I56 P;  1L0H A;  1Q82 Q;  2PEI A;  4COC A;  3G26 A;  1FR2 A;  1KD1 Q;  1YI2 P;  4XRO A;  1VQP P;  3G1I A;  2Z45 A;  4BPG A;  1NJI Q;  1S72 P;  3RG6 C;  2Z46 A;  4CA3 A;  2EFJ A;  2MR8 A;  2P9X A;  1GPJ A;  2M5R A;  3DS4 A;  2K2Q A;  2FHS C;  2GDX A;  3DPH A;  4PXH B;  1W2B O;  2K0Y A;  2KOD A;  2N5I A;  5F2O A;  2CQ8 A;  2KG8 A;  3G28 A;  1CEI A;  2CG5 B;  3CMA P;  2JYG A;  3DS5 A;  1VKU A;  2KR5 A;  4MRT C;  2OTJ P;  1E0H A;  2FQ1 A;  2KW2 A;  2PNG A;  5HGN A;  3EJD A;  2JU1 A;  1AUM A;  4IZ6 A;  2VLN A;  2BUO A;  2QA4 P;  2JAZ A;  2KOR A;  2K0X A;  2WPT A;  2PY8 A;  4U0C A;  2KOQ A;  1EMV A;  3CCE P;  2FQ0 A;  5KP7 B;  1AF8 A;  1VQN P;  2FVF A;  4PH1 A;  1RO0 A;  4XFX A;  1T8K A;  1QVF O;  1NQ4 A;  4BPH A;  5HVC A;  2OTL P;  4GR6 A;  4H2W C;  3VRL C;  1KLP A;  1K9M Q;  2N98 A;  1VQL P;  3G71 P;  2JB0 A;  3CCU P;  1EIA A;  3CE7 A;  5KP6 B;  2BHV A;  3GJN A;  4M0I A;  3CXC O;  2E1M A;  4R0M A;  2VLQ A;  2AFD A;  1QRJ A;  3G1G A;  3G4S P;  1Q81 Q;  2XV6 A;  1IMP A;  2K94 A;  2LOL A;  2KOO A;  3CC2 P;  3CCM P;  3H47 A;  1JJ2 O;  2PEO A;  2XZ1 C;  2N6Z A;  2L4B A;  2FAC A;  2FVA A;  1D1D A;  4H2Y C;  1ZMB A;  3G29 A;  1F80 D;  1VQO P;  1Z6M A;  2MY5 A;  3LRY A;  3H0D A;  2PEJ A;  4PWV B;  1VQ7 P;  2KOP A;  2LIW A;  1N8R Q;  5BS2 A;  3RG2 A;  1E6J P;  2AFE A;  2X2B A;  2MD9 A;  2K93 A;  3DS2 A;  2EIA A;  1YIJ P;  2Z44 A;  2JQ4 A;  1AYI A;  1ACP A;  1EOQ A;  1BAJ A;  2FAE A;  1HY8 A;  3NY7 B;  3Q20 A;  2M8N A;  1M6N A;  1YJ9 P;  3LMO A;  4GR2 A;  1OR5 A;  1KC8 Q;  3HYB A;  1MZ8 A;  1VQ6 P;  5CZD B;  4WYM A;  1RNI A;  2AF8 A;  3CME P;  2K92 A;  1Q86 Q;  4QNB A;  2GDY A;  3GZM A;  1X3O A;  2EHS A;  2KGA A;  2KOS A;  5HGL A;  4U0B A;  2VLO A;  4NEO A;  2AVA A;  3DTJ A;  2GZE A;  2M8L A;  2ROQ A;  1GXH A;  1BXI A;  2LPK A;  1VQ9 P;  3DS1 A;  4UHP B;  4COP A;  2KGD A;  1HQB A;  1VQK P;  3DS3 A;  2KGC A;  1ZNV A;  3DS0 A;  3G6E P;  3CCS P;  2MVV A;  3EJB A;  1A8O A;  3I55 P;  2LML A;  1A43 A;  1IUQ A;  4DG9 A;  2JO0 A;  4F37 A;  2N50 A;  2KGE A;  3CPW O;  1YJN P;  2GZJ A;  2L6E A;  1K73 Q;  3P05 A;  2CWO A;  2VSQ A;  2EHT A;  2FAD A;  5I4T G;  2LIU A;  3NTE A;  5DCK A;  1IMQ A;  1UNK A;  3G21 A;  1VQ5 P;  1DNY A;  2PEK A;  3HZQ A;  4XFY A;  2LKI A;  5F2K A;  1VQM P;  5EJD A;  3CCV P;  4QKO A;  2FQ2 A;  4XRQ A;  5HV8 A;  2CNR A;  4IPY A;  1DV5 A;  3CC4 P;  2LF4 A;  2NO8 A;  5HGM A;  2PEM A;  2MVU A;  5JPA A;  2CGQ A;  2XZ0 D;  1L0I A;  2L9F A;  3MGE A;  3CCJ P;  3CC7 P;  1M6E X;  1KQS O;  2GZG A;  1YHQ P;  1QVG O;  5KP8 B;  2XXM A;  3WBH A;  2JYL A;  4HKG A;  3M1M A;  4U0A A;  5HGO A;  5F2N A;  2LTE A;  3B4Q A;  2PEN A;  1M1K Q;  3EJE A;  2DNW A;  3CCL P;  3U43 A;  4U0D A;  4PH0 A;  3OW2 O;  2K5X A;  2ERH A;  3CCR P;  4U0E A;  1M74 A;  2EG5 A;  2ONT A;  1YJW P;  1UJZ A;  5EW5 E;  2XT1 A;  2LL8 A;  2OAR A;  3GKL C;  2L22 A;  4XFZ A;  2GYK A;  2K0D X;  3E2D A;  2GZF A;  3G0V A;  2GZI A;  7CEI A;  1Q7Y Q;  5BS1 A;  3CCQ P;  1YIT P;  3H4E A;  2DGY A;  1VQ4 P;  2N6Y A;  2JBG A;  2JU2 A;  2KG6 A;  3CD6 P;  2QNW A;  1GXG A;  1VHN A;  3GZL A;  2GDW A;  4U0F A;  2M8P A;  2JGP A; 
#chains in the Genus database with same CATH homology
 1GXH A;  7CEI A;  1BXI A;  1FR2 A;  2ERH A;  2K5X A;  1IMQ A;  1MZ8 A;  1UNK A;  2VLQ A;  2JBG A;  2NO8 A;  2VLN A;  4UHP B;  2JAZ A;  2VLP A;  1CEI A;  1UJZ A;  2WPT A;  5EW5 E;  1IMP A;  1GXG A;  4F37 A;  3GKL C;  2JB0 A;  1ZNV A;  1EMV A;  2VLO A;  2GYK A;  4QKO A;  2GZG A;  2GZJ A;  3U43 A;  2GZE A;  1AYI A;  1E0H A;  2K0D X;  2GZF A;  3GJN A;  2GZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...