4UHPB

Crystal structure of the pyocin ap41 dnase-immunity complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
MDIKNNLSDYTESEFLEIIEEFFKNKSGLKGSELEKRMDKLVKHFEEVTSHPRKSGVIFHPKPGFETPEGIVKEVKEWRAANGLPGFKAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Ultra-High Affinity Protein-Protein Complexes of Pyocins S2 and Ap41 and Their Cognate Immunity Proteins from Pseudomonas Aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
molecule keywords LARGE COMPONENT OF PYOCIN AP41
total genus 31
structure length 90
sequence length 90
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 4uhpB00
2WPTA 2NO8A 3U43A 2GZIA 2K0DX 2JBGA 2VLNA 2JAZA 1EMVA 4F37A 3GJNA 2VLQA 1CEIA 2K5XA 2VLPA 2GYKA 1IMQA 2JB0A 1AYIA 2ERHA 7CEIA 1MZ8A 1BXIA 1E0HA 2GZFA 1IMPA 1FR2A 1UJZA 4UHPB 2GZEA 3GKLC 4QKOA 2GZJA 2VLOA 5EW5E 1GXHA 1ZNVA 1UNKA 1GXGA 2GZGA
chains in the Genus database with same CATH superfamily
4PXHB 3CE7A 1M90Q 2K2QA 3U43A 1ACPA 3CMEP 2Z46A 2MF4A 3DS1A 3DS5A 3CC2P 3G1IA 2L9FA 1DNYA 5JPAA 5F2OA 5I4TG 2JAZA 4U0CA 3CC4P 1VQNP 3LMOA 2MD9A 4DG9A 2DNWA 3CC7P 2GZFA 5F2KA 1HQBA 3EJDA 3G71P 2M8LA 3CMAP 2FVAA 4CA3A 2KW2A 1YHQP 1L0IA 2MVUA 3H47A 1K73Q 2KOOA 1BXIA 2MR8A 1X3OA 3GZLA 1A8OA 2FADA 4H2WC 3VRLC 2ROQA 4XFYA 2VLQA 2EG5A 3CD6P 1Z6MA 1K30A 1Q82Q 1VQ5P 2ERHA 2L4BA 3B4QA 4U0AA 3DTJA 2EHSA 4COCA 2FACA 4XROA 4GR2A 1GXGA 3M1MA 3RG2A 2QA4P 2NO8A 5BS2A 4BPFA 1QVGO 2JB0A 2AFEA 2JYLA 1VHNA 4R0MA 1EIAA 2VLOA 2FVEA 2LIWA 4HKGA 5EW5E 3GZMA 1K8AQ 1Q7YQ 4XFZA 3OW2O 2E1MA 4PH1A 3GJNA 1VQMP 1IMQA 1D1DA 2FVFA 5HGMA 4IZ6A 2GDXA 4UHPB 2GZEA 1KC8Q 2AF8A 2JU2A 2L0QA 3G1GA 4QKOA 2CGQA 5CZDB 3DS4A 3RG6C 1E6JP 3I55P 1Q86Q 2K0DX 1NQ4A 2EIAA 2PEMA 2AFDA 1YJNP 2N6ZA 2KGEA 1M74A 3G26A 2ONTA 1T8KA 1AF8A 5HGNA 2VSQA 2CQ8A 3E2DA 1Q81Q 2GZGA 4H2YC 3DPHA 2QEXP 1ZMBA 7CEIA 4M0IA 2FAEA 2KWLA 2BUOA 2KGCA 2LPKA 3DS3A 2CG5B 4NEOA 2JBGA 1JJ2O 3CCUP 3HYBA 3CCRP 2MVVA 3CCQP 1M6NA 3HZQA 3G21A 3G28A 2N98A 2K93A 2FQ0A 1KQSO 1F80D 3GKLC 4MRTC 1YJWP 2N5HA 2PEIA 1S72P 2EHTA 1ZNVA 3I56P 3LRYA 4U0FA 3DS2A 1QRJA 3B5IA 1KLPA 2P9XA 5HGOA 2L22A 2CWOA 2CNRA 2Z44A 1UJZA 1RNIA 2M5RA 2PEKA 3H0DA 1VQ7P 5DCKA 1YIJP 2PEJA 4H2XC 4BPHA 2LF4A 1DV5A 3H4EA 3NTEA 2XT1A 2QNWA 2LL8A 1BAJA 3EJBA 1MZ8A 1L0HA 1HY8A 4BPGA 5HVCA 2JGPA 5HGLA 4U0DA 2EFJA 2KODA 2DGYA 2OTLP 3CCSP 4PWVB 1YITP 1NJIQ 2PY8A 1VQOP 2AVAA 5HV8A 2K0XA 3CCJP 3G6EP 4IPYA 1K9MQ 2KG6A 1KD1Q 2XV6A 1IMPA 1IUQA 3CCMP 2JYGA 2XZ0D 1GXHA 3EJEA 3P05A 3G29A 4U0BA 2PEQA 2WPTA 2KGAA 2GZIA 3CXCO 1VKUA 2LOLA 1CEIA 2VLPA 2GYKA 2KGDA 3CPWO 2XZ1C 2XXMA 3MGEA 2GZJA 2N50A 2PNGA 5EJDA 1GPJA 1AUMA 3CCVP 2K0YA 2KG9A 5BS1A 3WBHA 1W2BO 2KOSA 2K5XA 3G0VA 2GDYA 2L6EA 1RO0A 5F2NA 2KR5A 1FR2A 1N8RQ 3DS0A 1YJ9P 2FQ2A 1VQLP 3NY7B 2FHSC 2LKIA 2LIUA 2N5IA 2M8NA 1VQ8P 4XRQA 2OTJP 3G4SP 4QNBA 2BHVA 1VQPP 2KG8A 2MR7A 2JO0A 1QVFO 1EOQA 1AYIA 1VQ6P 1A43A 2LMLA 5KP6B 1OR5A 1VQ4P 4WYMA 2MY5A 2K94A 5KP7B 2OARA 2JQ4A 1YI2P 4PH0A 1VQ9P 2JU1A 2VLNA 1EMVA 4F37A 2X2BA 2M8PA 2K92A 2FQ1A 2LTEA 1M6EX 2KOPA 2KOQA 2GDWA 2KORA 1VQKP 4U0EA 2Z45A 4XFXA 4GR6A 2PENA 3CCLP 1RO2A 1E0HA 5KP8B 4COPA 3CCEP 2PEOA 2N6YA 3Q20A 1M1KQ 1UNKA
chains in the Genus database with same CATH topology
2WPTA 2NO8A 3U43A 2GZIA 2K0DX 2JBGA 2VLNA 2JAZA 1EMVA 4F37A 3GJNA 2VLQA 1CEIA 2K5XA 2VLPA 2GYKA 1IMQA 2JB0A 1AYIA 2ERHA 7CEIA 1MZ8A 1BXIA 1E0HA 2GZFA 1IMPA 1FR2A 1UJZA 4UHPB 2GZEA 3GKLC 4QKOA 2GZJA 2VLOA 5EW5E 1GXHA 1ZNVA 1UNKA 1GXGA 2GZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPT A;  2NO8 A;  3U43 A;  2GZI A;  2K0D X;  2JBG A;  2VLN A;  2JAZ A;  1EMV A;  4F37 A;  3GJN A;  2VLQ A;  1CEI A;  2K5X A;  2VLP A;  2GYK A;  1IMQ A;  2JB0 A;  1AYI A;  2ERH A;  7CEI A;  1MZ8 A;  1BXI A;  1E0H A;  2GZF A;  1IMP A;  1FR2 A;  1UJZ A;  4UHP B;  2GZE A;  3GKL C;  4QKO A;  2GZJ A;  2VLO A;  5EW5 E;  1GXH A;  1ZNV A;  1UNK A;  1GXG A;  2GZG A; 
#chains in the Genus database with same CATH topology
 4PXH B;  3CE7 A;  1M90 Q;  2K2Q A;  3U43 A;  1ACP A;  3CME P;  2Z46 A;  2MF4 A;  3DS1 A;  3DS5 A;  3CC2 P;  3G1I A;  2L9F A;  1DNY A;  5JPA A;  5F2O A;  5I4T G;  2JAZ A;  4U0C A;  3CC4 P;  1VQN P;  3LMO A;  2MD9 A;  4DG9 A;  2DNW A;  3CC7 P;  2GZF A;  5F2K A;  1HQB A;  3EJD A;  3G71 P;  2M8L A;  3CMA P;  2FVA A;  4CA3 A;  2KW2 A;  1YHQ P;  1L0I A;  2MVU A;  3H47 A;  1K73 Q;  2KOO A;  1BXI A;  2MR8 A;  1X3O A;  3GZL A;  1A8O A;  2FAD A;  4H2W C;  3VRL C;  2ROQ A;  4XFY A;  2VLQ A;  2EG5 A;  3CD6 P;  1Z6M A;  1K30 A;  1Q82 Q;  1VQ5 P;  2ERH A;  2L4B A;  3B4Q A;  4U0A A;  3DTJ A;  2EHS A;  4COC A;  2FAC A;  4XRO A;  4GR2 A;  1GXG A;  3M1M A;  3RG2 A;  2QA4 P;  2NO8 A;  5BS2 A;  4BPF A;  1QVG O;  2JB0 A;  2AFE A;  2JYL A;  1VHN A;  4R0M A;  1EIA A;  2VLO A;  2FVE A;  2LIW A;  4HKG A;  5EW5 E;  3GZM A;  1K8A Q;  1Q7Y Q;  4XFZ A;  3OW2 O;  2E1M A;  4PH1 A;  3GJN A;  1VQM P;  1IMQ A;  1D1D A;  2FVF A;  5HGM A;  4IZ6 A;  2GDX A;  4UHP B;  2GZE A;  1KC8 Q;  2AF8 A;  2JU2 A;  2L0Q A;  3G1G A;  4QKO A;  2CGQ A;  5CZD B;  3DS4 A;  3RG6 C;  1E6J P;  3I55 P;  1Q86 Q;  2K0D X;  1NQ4 A;  2EIA A;  2PEM A;  2AFD A;  1YJN P;  2N6Z A;  2KGE A;  1M74 A;  3G26 A;  2ONT A;  1T8K A;  1AF8 A;  5HGN A;  2VSQ A;  2CQ8 A;  3E2D A;  1Q81 Q;  2GZG A;  4H2Y C;  3DPH A;  2QEX P;  1ZMB A;  7CEI A;  4M0I A;  2FAE A;  2KWL A;  2BUO A;  2KGC A;  2LPK A;  3DS3 A;  2CG5 B;  4NEO A;  2JBG A;  1JJ2 O;  3CCU P;  3HYB A;  3CCR P;  2MVV A;  3CCQ P;  1M6N A;  3HZQ A;  3G21 A;  3G28 A;  2N98 A;  2K93 A;  2FQ0 A;  1KQS O;  1F80 D;  3GKL C;  4MRT C;  1YJW P;  2N5H A;  2PEI A;  1S72 P;  2EHT A;  1ZNV A;  3I56 P;  3LRY A;  4U0F A;  3DS2 A;  1QRJ A;  3B5I A;  1KLP A;  2P9X A;  5HGO A;  2L22 A;  2CWO A;  2CNR A;  2Z44 A;  1UJZ A;  1RNI A;  2M5R A;  2PEK A;  3H0D A;  1VQ7 P;  5DCK A;  1YIJ P;  2PEJ A;  4H2X C;  4BPH A;  2LF4 A;  1DV5 A;  3H4E A;  3NTE A;  2XT1 A;  2QNW A;  2LL8 A;  1BAJ A;  3EJB A;  1MZ8 A;  1L0H A;  1HY8 A;  4BPG A;  5HVC A;  2JGP A;  5HGL A;  4U0D A;  2EFJ A;  2KOD A;  2DGY A;  2OTL P;  3CCS P;  4PWV B;  1YIT P;  1NJI Q;  2PY8 A;  1VQO P;  2AVA A;  5HV8 A;  2K0X A;  3CCJ P;  3G6E P;  4IPY A;  1K9M Q;  2KG6 A;  1KD1 Q;  2XV6 A;  1IMP A;  1IUQ A;  3CCM P;  2JYG A;  2XZ0 D;  1GXH A;  3EJE A;  3P05 A;  3G29 A;  4U0B A;  2PEQ A;  2WPT A;  2KGA A;  2GZI A;  3CXC O;  1VKU A;  2LOL A;  1CEI A;  2VLP A;  2GYK A;  2KGD A;  3CPW O;  2XZ1 C;  2XXM A;  3MGE A;  2GZJ A;  2N50 A;  2PNG A;  5EJD A;  1GPJ A;  1AUM A;  3CCV P;  2K0Y A;  2KG9 A;  5BS1 A;  3WBH A;  1W2B O;  2KOS A;  2K5X A;  3G0V A;  2GDY A;  2L6E A;  1RO0 A;  5F2N A;  2KR5 A;  1FR2 A;  1N8R Q;  3DS0 A;  1YJ9 P;  2FQ2 A;  1VQL P;  3NY7 B;  2FHS C;  2LKI A;  2LIU A;  2N5I A;  2M8N A;  1VQ8 P;  4XRQ A;  2OTJ P;  3G4S P;  4QNB A;  2BHV A;  1VQP P;  2KG8 A;  2MR7 A;  2JO0 A;  1QVF O;  1EOQ A;  1AYI A;  1VQ6 P;  1A43 A;  2LML A;  5KP6 B;  1OR5 A;  1VQ4 P;  4WYM A;  2MY5 A;  2K94 A;  5KP7 B;  2OAR A;  2JQ4 A;  1YI2 P;  4PH0 A;  1VQ9 P;  2JU1 A;  2VLN A;  1EMV A;  4F37 A;  2X2B A;  2M8P A;  2K92 A;  2FQ1 A;  2LTE A;  1M6E X;  2KOP A;  2KOQ A;  2GDW A;  2KOR A;  1VQK P;  4U0E A;  2Z45 A;  4XFX A;  4GR6 A;  2PEN A;  3CCL P;  1RO2 A;  1E0H A;  5KP8 B;  4COP A;  3CCE P;  2PEO A;  2N6Y A;  3Q20 A;  1M1K Q;  1UNK A; 
#chains in the Genus database with same CATH homology
 2WPT A;  2NO8 A;  3U43 A;  2GZI A;  2K0D X;  2JBG A;  2VLN A;  2JAZ A;  1EMV A;  4F37 A;  3GJN A;  2VLQ A;  1CEI A;  2K5X A;  2VLP A;  2GYK A;  1IMQ A;  2JB0 A;  1AYI A;  2ERH A;  7CEI A;  1MZ8 A;  1BXI A;  1E0H A;  2GZF A;  1IMP A;  1FR2 A;  1UJZ A;  4UHP B;  2GZE A;  3GKL C;  4QKO A;  2GZJ A;  2VLO A;  5EW5 E;  1GXH A;  1ZNV A;  1UNK A;  1GXG A;  2GZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...