4UHPB

Crystal structure of the pyocin ap41 dnase-immunity complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
MDIKNNLSDYTESEFLEIIEEFFKNKSGLKGSELEKRMDKLVKHFEEVTSHPRKSGVIFHPKPGFETPEGIVKEVKEWRAANGLPGFKAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LARGE COMPONENT OF PYOCIN AP41
publication title Structures of the Ultra-High Affinity Protein-Protein Complexes of Pyocins S2 and Ap41 and Their Cognate Immunity Proteins from Pseudomonas Aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
total genus 31
structure length 90
sequence length 90
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 4uhpB00
2VLOA 1BXIA 2JB0A 2ERHA 2GZGA 1GXGA 2GZIA 1GXHA 1CEIA 1UNKA 7CEIA 1E0HA 3GJNA 4UHPB 5EW5E 2GZFA 1ZNVA 2NO8A 3U43A 4QKOA 4F37A 2VLNA 2GYKA 2K0DX 2VLQA 2K5XA 2JAZA 2VLPA 1UJZA 1MZ8A 2GZEA 1IMPA 1AYIA 1FR2A 2WPTA 3GKLC 1EMVA 2GZJA 1IMQA 2JBGA
chains in the Genus database with same CATH superfamily
2FACA 3G29A 2JB0A 1A8OA 3B4QA 2FVEA 2MVVA 2BHVA 3MGEA 5JPAA 3CCLP 3HZQA 1QVGO 2VLQA 3DS5A 3CXCO 1QRJA 4U0AA 2LL8A 2M8NA 4XFYA 2KW2A 2Z45A 1T8KA 1KC8Q 2CNRA 3VRLC 5CZDB 4M0IA 3E2DA 1ZMBA 5HGNA 2L0QA 2KOOA 4NEOA 3CMAP 4WYMA 2N5IA 2L22A 2K0XA 4BPHA 4COPA 2PEJA 2LF4A 2K0DX 2FQ1A 2L9FA 3CMEP 2JAZA 3G1GA 1YJNP 2WPTA 3CCEP 1K8AQ 2GZJA 1M74A 3P05A 1VQKP 3H4EA 1M6NA 1NJIQ 2ONTA 3RG2A 3H0DA 5F2OA 2LIUA 1RNIA 1VKUA 1L0IA 5KP7B 1L0HA 1KD1Q 1VQNP 4GR6A 2KOSA 1S72P 1YIJP 1IMQA 3LRYA 3EJDA 1K73Q 2PEKA 3HYBA 2AFDA 2KG6A 3DPHA 2JU2A 1OR5A 2K94A 2MD9A 2PEOA 3WBHA 1EOQA 3DTJA 4QNBA 2LKIA 2K92A 3I55P 4IPYA 3G21A 2AF8A 2QEXP 1YITP 3EJBA 5HVCA 2FQ0A 1K9MQ 2M8PA 3DS3A 2N5HA 1UNKA 1VHNA 2GDYA 2EFJA 1YI2P 2KG8A 2LTEA 4U0CA 1YHQP 1VQ7P 3CCUP 1YJWP 3RG6C 2VLPA 3CPWO 1AYIA 2CWOA 3GKLC 3CCJP 2XXMA 2PEMA 2EHTA 2FAEA 1VQLP 2OTJP 2JU1A 2QA4P 2KR5A 1E0HA 5EW5E 4XFZA 3U43A 2KOPA 2L4BA 5HGOA 3Q20A 1VQMP 5KP6B 2KOQA 2P9XA 2GZEA 1Q82Q 1FR2A 2K93A 4XROA 2MY5A 2MR7A 2Z44A 3GJNA 3M1MA 2BUOA 4CA3A 1Z6MA 2M8LA 2JQ4A 1RO2A 2GDWA 2PY8A 1MZ8A 4MRTC 4R0MA 3CCSP 2N6YA 2K2QA 2KGCA 2XZ0D 1K30A 1D1DA 1QVFO 3CCRP 1GXGA 5HGMA 4PWVB 1HY8A 1DNYA 5KP8B 3DS0A 2EHSA 2KGAA 2LOLA 1EIAA 3CCQP 1Q86Q 3G26A 2KGEA 2N98A 1YJ9P 2LIWA 2JBGA 2DGYA 3G71P 5BS1A 2KODA 2MR8A 2M5RA 4UHPB 2XV6A 4BPGA 1VQ9P 2K5XA 2JO0A 2FHSC 3G0VA 1X3OA 1EMVA 2XT1A 2ROQA 3DS2A 2FADA 1HQBA 3G4SP 3CE7A 3DS1A 5HV8A 1W2BO 2PEIA 4XRQA 2FQ2A 2GZFA 4GR2A 1ZNVA 2LMLA 2NO8A 1VQ5P 1JJ2O 3G28A 2PEQA 2FVAA 3GZLA 3LMOA 5BS2A 4BPFA 4U0DA 1AF8A 1VQ4P 2N50A 1KLPA 2DNWA 1M90Q 2GZIA 1VQ8P 1KQSO 2L6EA 1A43A 3G1IA 1ACPA 5F2KA 1IMPA 1IUQA 1VQPP 2KG9A 5DCKA 4H2YC 1RO0A 2JYLA 5F2NA 2LPKA 2VSQA 1BXIA 2GZGA 3EJEA 1GXHA 5I4TG 2JYGA 3CCVP 2AFEA 1VQOP 2PNGA 5HGLA 1DV5A 1M1KQ 1E6JP 4F37A 2EG5A 3DS4A 2GYKA 3CD6P 2PENA 2KGDA 2Z46A 3I56P 1NQ4A 2VLOA 2ERHA 2KWLA 4PH0A 3H47A 3CC7P 3B5IA 2E1MA 2QNWA 4QKOA 4U0EA 2VLNA 1N8RQ 2XZ1C 2EIAA 1UJZA 1F80D 2OARA 4H2XC 3NY7B 3CC4P 2CG5B 2X2BA 1Q81Q 3NTEA 2GDXA 1GPJA 3OW2O 2JGPA 4U0BA 1Q7YQ 2MF4A 1VQ6P 5EJDA 2KORA 2AVAA 4HKGA 1CEIA 4COCA 3GZMA 7CEIA 2CGQA 3CC2P 3CCMP 4H2WC 2OTLP 3G6EP 4XFXA 2K0YA 2MVUA 4PH1A 4DG9A 4PXHB 1AUMA 4IZ6A 1M6EX 2FVFA 4U0FA 1BAJA 2CQ8A 2N6ZA
chains in the Genus database with same CATH topology
2VLOA 1BXIA 2JB0A 2ERHA 2GZGA 1GXGA 2GZIA 1GXHA 1CEIA 1UNKA 7CEIA 1E0HA 3GJNA 4UHPB 5EW5E 2GZFA 1ZNVA 2NO8A 3U43A 4QKOA 4F37A 2VLNA 2GYKA 2K0DX 2VLQA 2K5XA 2JAZA 2VLPA 1UJZA 1MZ8A 2GZEA 1IMPA 1AYIA 1FR2A 2WPTA 3GKLC 1EMVA 2GZJA 1IMQA 2JBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLO A;  1BXI A;  2JB0 A;  2ERH A;  2GZG A;  1GXG A;  2GZI A;  1GXH A;  1CEI A;  1UNK A;  7CEI A;  1E0H A;  3GJN A;  4UHP B;  5EW5 E;  2GZF A;  1ZNV A;  2NO8 A;  3U43 A;  4QKO A;  4F37 A;  2VLN A;  2GYK A;  2K0D X;  2VLQ A;  2K5X A;  2JAZ A;  2VLP A;  1UJZ A;  1MZ8 A;  2GZE A;  1IMP A;  1AYI A;  1FR2 A;  2WPT A;  3GKL C;  1EMV A;  2GZJ A;  1IMQ A;  2JBG A; 
#chains in the Genus database with same CATH topology
 2FAC A;  3G29 A;  2JB0 A;  1A8O A;  3B4Q A;  2FVE A;  2MVV A;  2BHV A;  3MGE A;  5JPA A;  3CCL P;  3HZQ A;  1QVG O;  2VLQ A;  3DS5 A;  3CXC O;  1QRJ A;  4U0A A;  2LL8 A;  2M8N A;  4XFY A;  2KW2 A;  2Z45 A;  1T8K A;  1KC8 Q;  2CNR A;  3VRL C;  5CZD B;  4M0I A;  3E2D A;  1ZMB A;  5HGN A;  2L0Q A;  2KOO A;  4NEO A;  3CMA P;  4WYM A;  2N5I A;  2L22 A;  2K0X A;  4BPH A;  4COP A;  2PEJ A;  2LF4 A;  2K0D X;  2FQ1 A;  2L9F A;  3CME P;  2JAZ A;  3G1G A;  1YJN P;  2WPT A;  3CCE P;  1K8A Q;  2GZJ A;  1M74 A;  3P05 A;  1VQK P;  3H4E A;  1M6N A;  1NJI Q;  2ONT A;  3RG2 A;  3H0D A;  5F2O A;  2LIU A;  1RNI A;  1VKU A;  1L0I A;  5KP7 B;  1L0H A;  1KD1 Q;  1VQN P;  4GR6 A;  2KOS A;  1S72 P;  1YIJ P;  1IMQ A;  3LRY A;  3EJD A;  1K73 Q;  2PEK A;  3HYB A;  2AFD A;  2KG6 A;  3DPH A;  2JU2 A;  1OR5 A;  2K94 A;  2MD9 A;  2PEO A;  3WBH A;  1EOQ A;  3DTJ A;  4QNB A;  2LKI A;  2K92 A;  3I55 P;  4IPY A;  3G21 A;  2AF8 A;  2QEX P;  1YIT P;  3EJB A;  5HVC A;  2FQ0 A;  1K9M Q;  2M8P A;  3DS3 A;  2N5H A;  1UNK A;  1VHN A;  2GDY A;  2EFJ A;  1YI2 P;  2KG8 A;  2LTE A;  4U0C A;  1YHQ P;  1VQ7 P;  3CCU P;  1YJW P;  3RG6 C;  2VLP A;  3CPW O;  1AYI A;  2CWO A;  3GKL C;  3CCJ P;  2XXM A;  2PEM A;  2EHT A;  2FAE A;  1VQL P;  2OTJ P;  2JU1 A;  2QA4 P;  2KR5 A;  1E0H A;  5EW5 E;  4XFZ A;  3U43 A;  2KOP A;  2L4B A;  5HGO A;  3Q20 A;  1VQM P;  5KP6 B;  2KOQ A;  2P9X A;  2GZE A;  1Q82 Q;  1FR2 A;  2K93 A;  4XRO A;  2MY5 A;  2MR7 A;  2Z44 A;  3GJN A;  3M1M A;  2BUO A;  4CA3 A;  1Z6M A;  2M8L A;  2JQ4 A;  1RO2 A;  2GDW A;  2PY8 A;  1MZ8 A;  4MRT C;  4R0M A;  3CCS P;  2N6Y A;  2K2Q A;  2KGC A;  2XZ0 D;  1K30 A;  1D1D A;  1QVF O;  3CCR P;  1GXG A;  5HGM A;  4PWV B;  1HY8 A;  1DNY A;  5KP8 B;  3DS0 A;  2EHS A;  2KGA A;  2LOL A;  1EIA A;  3CCQ P;  1Q86 Q;  3G26 A;  2KGE A;  2N98 A;  1YJ9 P;  2LIW A;  2JBG A;  2DGY A;  3G71 P;  5BS1 A;  2KOD A;  2MR8 A;  2M5R A;  4UHP B;  2XV6 A;  4BPG A;  1VQ9 P;  2K5X A;  2JO0 A;  2FHS C;  3G0V A;  1X3O A;  1EMV A;  2XT1 A;  2ROQ A;  3DS2 A;  2FAD A;  1HQB A;  3G4S P;  3CE7 A;  3DS1 A;  5HV8 A;  1W2B O;  2PEI A;  4XRQ A;  2FQ2 A;  2GZF A;  4GR2 A;  1ZNV A;  2LML A;  2NO8 A;  1VQ5 P;  1JJ2 O;  3G28 A;  2PEQ A;  2FVA A;  3GZL A;  3LMO A;  5BS2 A;  4BPF A;  4U0D A;  1AF8 A;  1VQ4 P;  2N50 A;  1KLP A;  2DNW A;  1M90 Q;  2GZI A;  1VQ8 P;  1KQS O;  2L6E A;  1A43 A;  3G1I A;  1ACP A;  5F2K A;  1IMP A;  1IUQ A;  1VQP P;  2KG9 A;  5DCK A;  4H2Y C;  1RO0 A;  2JYL A;  5F2N A;  2LPK A;  2VSQ A;  1BXI A;  2GZG A;  3EJE A;  1GXH A;  5I4T G;  2JYG A;  3CCV P;  2AFE A;  1VQO P;  2PNG A;  5HGL A;  1DV5 A;  1M1K Q;  1E6J P;  4F37 A;  2EG5 A;  3DS4 A;  2GYK A;  3CD6 P;  2PEN A;  2KGD A;  2Z46 A;  3I56 P;  1NQ4 A;  2VLO A;  2ERH A;  2KWL A;  4PH0 A;  3H47 A;  3CC7 P;  3B5I A;  2E1M A;  2QNW A;  4QKO A;  4U0E A;  2VLN A;  1N8R Q;  2XZ1 C;  2EIA A;  1UJZ A;  1F80 D;  2OAR A;  4H2X C;  3NY7 B;  3CC4 P;  2CG5 B;  2X2B A;  1Q81 Q;  3NTE A;  2GDX A;  1GPJ A;  3OW2 O;  2JGP A;  4U0B A;  1Q7Y Q;  2MF4 A;  1VQ6 P;  5EJD A;  2KOR A;  2AVA A;  4HKG A;  1CEI A;  4COC A;  3GZM A;  7CEI A;  2CGQ A;  3CC2 P;  3CCM P;  4H2W C;  2OTL P;  3G6E P;  4XFX A;  2K0Y A;  2MVU A;  4PH1 A;  4DG9 A;  4PXH B;  1AUM A;  4IZ6 A;  1M6E X;  2FVF A;  4U0F A;  1BAJ A;  2CQ8 A;  2N6Z A; 
#chains in the Genus database with same CATH homology
 2VLO A;  1BXI A;  2JB0 A;  2ERH A;  2GZG A;  1GXG A;  2GZI A;  1GXH A;  1CEI A;  1UNK A;  7CEI A;  1E0H A;  3GJN A;  4UHP B;  5EW5 E;  2GZF A;  1ZNV A;  2NO8 A;  3U43 A;  4QKO A;  4F37 A;  2VLN A;  2GYK A;  2K0D X;  2VLQ A;  2K5X A;  2JAZ A;  2VLP A;  1UJZ A;  1MZ8 A;  2GZE A;  1IMP A;  1AYI A;  1FR2 A;  2WPT A;  3GKL C;  1EMV A;  2GZJ A;  1IMQ A;  2JBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...