2AVAA

Solution structure of stearoyl-acyl carrier protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of spinach acyl carrier protein with decanoate and stearate
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Biosynthetic protein
molecule keywords Acyl carrier protein I, chloroplast
total genus 19
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2005-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2avaA00
2N5IA 2FACA 1OR5A 1X3OA 4MRTC 2KGAA 4NEOA 2KW2A 2M5RA 2FVFA 2L4BA 2L9FA 2X2BA 2K2QA 2AF8A 2AVAA 1DV5A 2VSQA 5CZDB 5KP6B 2QNWA 2LPKA 2MVVA 5KP8B 5HVCA 2LIWA 2KR5A 1NQ4A 4H2WC 2FHSC 1T8KA 2L22A 4H2YC 2FAEA 1DNYA 2K0YA 2CQ8A 4H2XC 2DNWA 1L0HA 2KOPA 2KG8A 2FQ2A 2JGPA 2GDWA 2KORA 1ACPA 2JU1A 3CE7A 2XZ1C 2KWLA 2EHSA 2LOLA 4R0MA 4PWVB 4BPFA 2AFDA 2L0QA 2FQ1A 2EHTA 3GZLA 1L0IA 2N6ZA 2XZ0D 4PXHB 2CGQA 2PNGA 2KGCA 1KLPA 5KP7B 2JU2A 2KGEA 2JQ4A 1HY8A 3NY7B 4IZ6A 2MD9A 2KG9A 2CNRA 2GDYA 3EJBA 2MR7A 3GZMA 2LKIA 2N6YA 2LTEA 3RG2A 2ROQA 2GDXA 2K92A 2KG6A 2N98A 2MR8A 1F80D 2N50A 5HV8A 2K94A 5EJDA 4BPGA 2FVAA 2AFEA 1HQBA 1AF8A 2FVEA 2KGDA 2K0XA 2KOSA 3EJDA 3EJEA 1VKUA 2FADA 2K93A 2LMLA 2CG5B 4DG9A 3LMOA 2KOQA 2FQ0A 2MVUA 4HKGA 2N5HA 4BPHA 2MF4A 2KOOA 4CA3A 2MY5A 2LL8A 2LIUA
chains in the Genus database with same CATH superfamily
2N5IA 2M5RA 2FVFA 1VQMP 2K2QA 2AVAA 4XFZA 3G4SP 5CZDB 2JO0A 3HZQA 1QRJA 2XV6A 4QNBA 3WBHA 1E0HA 2MVVA 3I56P 1VQ9P 1KC8Q 3G26A 4COCA 2OTJP 3CPWO 1AUMA 1T8KA 1VQ6P 2L22A 1UNKA 3CCVP 1DNYA 1GPJA 3CC7P 2DNWA 3H4EA 2JGPA 3M1MA 2KORA 1VQPP 4M0IA 3CE7A 2Z45A 4R0MA 4COPA 5BS2A 5HGNA 1IUQA 1L0IA 1VQ8P 1Q82Q 1IMPA 4UHPB 4XFXA 2JQ4A 3NY7B 2GDYA 1YJNP 4XFYA 1AYIA 3CCSP 4WYMA 3DS1A 2N6YA 2KG6A 2MR8A 3G71P 1F80D 5BS1A 1W2BO 2JYLA 2GZFA 3DPHA 2AFEA 3B4QA 1JJ2O 1HQBA 3NTEA 3H0DA 2OTLP 3EJDA 4GR2A 1D1DA 2K93A 2LMLA 2CG5B 2FQ0A 3Q20A 3GJNA 4XRQA 4CA3A 2LL8A 3B5IA 4U0EA 1RNIA 2KGAA 4NEOA 2L9FA 2X2BA 2AF8A 1DV5A 1EIAA 2VSQA 5KP6B 3CCRP 2EFJA 2Z46A 5HGLA 3DS0A 3G28A 1VQOP 1VQLP 2LPKA 5F2OA 5HVCA 2LIWA 2QEXP 2KR5A 1NQ4A 2P9XA 2VLQA 3G21A 2JAZA 2PEQA 2PEOA 1KD1Q 2K5XA 2PEMA 4U0DA 2K0YA 2BUOA 2CQ8A 2ONTA 3OW2O 1BAJA 1QVFO 5F2NA 2LOLA 3DTJA 3DS3A 4PWVB 4BPFA 2QA4P 1RO0A 2AFDA 1YI2P 5EW5E 2NO8A 1IMQA 2PNGA 2KGCA 1Z6MA 1VQ4P 1KLPA 2JU2A 1K8AQ 1HY8A 2MD9A 4XROA 5HGOA 2GYKA 2CNRA 3EJBA 3VRLC 2LTEA 2ROQA 3G29A 2GZEA 2N98A 5HV8A 5EJDA 4BPGA 1M6NA 3U43A 2KOSA 2DGYA 2FADA 2XT1A 1VQKP 2KOQA 3CCEP 2N5HA 2MF4A 3CCQP 1QVGO 4GR6A 4U0AA 2PEKA 2MY5A 3RG6C 2FACA 2M8NA 3CD6P 1OR5A 3CCLP 2BHVA 1ZNVA 2VLPA 2KW2A 2L4BA 1K73Q 5JPAA 2E1MA 3CCMP 2VLNA 1M90Q 2QNWA 2XXMA 1M6EX 1E6JP 5DCKA 2Z44A 2PEIA 2WPTA 1M1KQ 2LF4A 1M74A 2GZGA 1N8RQ 2FHSC 3CMEP 4H2YC 2FAEA 5HGMA 3CC2P 1L0HA 2KOPA 2FQ2A 3DS4A 4U0FA 1ACPA 1YJWP 2JU1A 2PENA 2XZ1C 2M8PA 2EHSA 3LRYA 2FQ1A 2VLOA 1FR2A 2N6ZA 2XZ0D 4PXHB 2CGQA 3P05A 2EIAA 2KG9A 2MR7A 5F2KA 2JBGA 2K94A 2FVAA 2M8LA 7CEIA 1YITP 3HYBA 4QKOA 1EOQA 1K9MQ 3G6EP 3EJEA 1GXHA 2GZIA 4U0BA 2KODA 3LMOA 4HKGA 2MVUA 4BPHA 2OARA 3DS5A 2LIUA 3I55P 1S72P 3CXCO 1X3OA 4MRTC 1Q7YQ 2JB0A 1K30A 2GZJA 3G1IA 1VHNA 2K0DX 1YIJP 1A43A 3CCUP 3CMAP 5KP8B 3GKLC 1MZ8A 1UJZA 4H2WC 1RO2A 1VQ5P 4PH0A 1VQNP 1Q81Q 4H2XC 2PEJA 2KG8A 2GDWA 2PY8A 3CCJP 2KWLA 3E2DA 1A8OA 2L0QA 1KQSO 2EHTA 3GZLA 1BXIA 2CWOA 2EG5A 5KP7B 2KGEA 4IZ6A 3H47A 2ERHA 3MGEA 4F37A 3GZMA 2LKIA 5I4TG 3RG2A 1NJIQ 2GDXA 2K92A 2N50A 3G0VA 3CC4P 1CEIA 1YHQP 1GXGA 1AF8A 2FVEA 2L6EA 2KGDA 2K0XA 1ZMBA 1VKUA 4PH1A 3DS2A 4DG9A 1VQ7P 2JYGA 4U0CA 3G1GA 2KOOA 1Q86Q 4IPYA 1EMVA 1YJ9P
chains in the Genus database with same CATH topology
2N5IA 2FACA 1OR5A 1X3OA 4MRTC 2KGAA 4NEOA 2KW2A 2M5RA 2FVFA 2L4BA 2L9FA 2X2BA 2K2QA 2AF8A 2AVAA 1DV5A 2VSQA 5CZDB 5KP6B 2QNWA 2LPKA 2MVVA 5KP8B 5HVCA 2LIWA 2KR5A 1NQ4A 4H2WC 2FHSC 1T8KA 2L22A 4H2YC 2FAEA 1DNYA 2K0YA 2CQ8A 4H2XC 2DNWA 1L0HA 2KOPA 2KG8A 2FQ2A 2JGPA 2GDWA 2KORA 1ACPA 2JU1A 3CE7A 2XZ1C 2KWLA 2EHSA 2LOLA 4R0MA 4PWVB 4BPFA 2AFDA 2L0QA 2FQ1A 2EHTA 3GZLA 1L0IA 2N6ZA 2XZ0D 4PXHB 2CGQA 2PNGA 2KGCA 1KLPA 5KP7B 2JU2A 2KGEA 2JQ4A 1HY8A 3NY7B 4IZ6A 2MD9A 2KG9A 2CNRA 2GDYA 3EJBA 2MR7A 3GZMA 2LKIA 2N6YA 2LTEA 3RG2A 2ROQA 2GDXA 2K92A 2KG6A 2N98A 2MR8A 1F80D 2N50A 5HV8A 2K94A 5EJDA 4BPGA 2FVAA 2AFEA 1HQBA 1AF8A 2FVEA 2KGDA 2K0XA 2KOSA 3EJDA 3EJEA 1VKUA 2FADA 2K93A 2LMLA 2CG5B 4DG9A 3LMOA 2KOQA 2FQ0A 2MVUA 4HKGA 2N5HA 4BPHA 2MF4A 2KOOA 4CA3A 2MY5A 2LL8A 2LIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N5I A;  2FAC A;  1OR5 A;  1X3O A;  4MRT C;  2KGA A;  4NEO A;  2KW2 A;  2M5R A;  2FVF A;  2L4B A;  2L9F A;  2X2B A;  2K2Q A;  2AF8 A;  2AVA A;  1DV5 A;  2VSQ A;  5CZD B;  5KP6 B;  2QNW A;  2LPK A;  2MVV A;  5KP8 B;  5HVC A;  2LIW A;  2KR5 A;  1NQ4 A;  4H2W C;  2FHS C;  1T8K A;  2L22 A;  4H2Y C;  2FAE A;  1DNY A;  2K0Y A;  2CQ8 A;  4H2X C;  2DNW A;  1L0H A;  2KOP A;  2KG8 A;  2FQ2 A;  2JGP A;  2GDW A;  2KOR A;  1ACP A;  2JU1 A;  3CE7 A;  2XZ1 C;  2KWL A;  2EHS A;  2LOL A;  4R0M A;  4PWV B;  4BPF A;  2AFD A;  2L0Q A;  2FQ1 A;  2EHT A;  3GZL A;  1L0I A;  2N6Z A;  2XZ0 D;  4PXH B;  2CGQ A;  2PNG A;  2KGC A;  1KLP A;  5KP7 B;  2JU2 A;  2KGE A;  2JQ4 A;  1HY8 A;  3NY7 B;  4IZ6 A;  2MD9 A;  2KG9 A;  2CNR A;  2GDY A;  3EJB A;  2MR7 A;  3GZM A;  2LKI A;  2N6Y A;  2LTE A;  3RG2 A;  2ROQ A;  2GDX A;  2K92 A;  2KG6 A;  2N98 A;  2MR8 A;  1F80 D;  2N50 A;  5HV8 A;  2K94 A;  5EJD A;  4BPG A;  2FVA A;  2AFE A;  1HQB A;  1AF8 A;  2FVE A;  2KGD A;  2K0X A;  2KOS A;  3EJD A;  3EJE A;  1VKU A;  2FAD A;  2K93 A;  2LML A;  2CG5 B;  4DG9 A;  3LMO A;  2KOQ A;  2FQ0 A;  2MVU A;  4HKG A;  2N5H A;  4BPH A;  2MF4 A;  2KOO A;  4CA3 A;  2MY5 A;  2LL8 A;  2LIU A; 
#chains in the Genus database with same CATH topology
 2N5I A;  2M5R A;  2FVF A;  1VQM P;  2K2Q A;  2AVA A;  4XFZ A;  3G4S P;  5CZD B;  2JO0 A;  3HZQ A;  1QRJ A;  2XV6 A;  4QNB A;  3WBH A;  1E0H A;  2MVV A;  3I56 P;  1VQ9 P;  1KC8 Q;  3G26 A;  4COC A;  2OTJ P;  3CPW O;  1AUM A;  1T8K A;  1VQ6 P;  2L22 A;  1UNK A;  3CCV P;  1DNY A;  1GPJ A;  3CC7 P;  2DNW A;  3H4E A;  2JGP A;  3M1M A;  2KOR A;  1VQP P;  4M0I A;  3CE7 A;  2Z45 A;  4R0M A;  4COP A;  5BS2 A;  5HGN A;  1IUQ A;  1L0I A;  1VQ8 P;  1Q82 Q;  1IMP A;  4UHP B;  4XFX A;  2JQ4 A;  3NY7 B;  2GDY A;  1YJN P;  4XFY A;  1AYI A;  3CCS P;  4WYM A;  3DS1 A;  2N6Y A;  2KG6 A;  2MR8 A;  3G71 P;  1F80 D;  5BS1 A;  1W2B O;  2JYL A;  2GZF A;  3DPH A;  2AFE A;  3B4Q A;  1JJ2 O;  1HQB A;  3NTE A;  3H0D A;  2OTL P;  3EJD A;  4GR2 A;  1D1D A;  2K93 A;  2LML A;  2CG5 B;  2FQ0 A;  3Q20 A;  3GJN A;  4XRQ A;  4CA3 A;  2LL8 A;  3B5I A;  4U0E A;  1RNI A;  2KGA A;  4NEO A;  2L9F A;  2X2B A;  2AF8 A;  1DV5 A;  1EIA A;  2VSQ A;  5KP6 B;  3CCR P;  2EFJ A;  2Z46 A;  5HGL A;  3DS0 A;  3G28 A;  1VQO P;  1VQL P;  2LPK A;  5F2O A;  5HVC A;  2LIW A;  2QEX P;  2KR5 A;  1NQ4 A;  2P9X A;  2VLQ A;  3G21 A;  2JAZ A;  2PEQ A;  2PEO A;  1KD1 Q;  2K5X A;  2PEM A;  4U0D A;  2K0Y A;  2BUO A;  2CQ8 A;  2ONT A;  3OW2 O;  1BAJ A;  1QVF O;  5F2N A;  2LOL A;  3DTJ A;  3DS3 A;  4PWV B;  4BPF A;  2QA4 P;  1RO0 A;  2AFD A;  1YI2 P;  5EW5 E;  2NO8 A;  1IMQ A;  2PNG A;  2KGC A;  1Z6M A;  1VQ4 P;  1KLP A;  2JU2 A;  1K8A Q;  1HY8 A;  2MD9 A;  4XRO A;  5HGO A;  2GYK A;  2CNR A;  3EJB A;  3VRL C;  2LTE A;  2ROQ A;  3G29 A;  2GZE A;  2N98 A;  5HV8 A;  5EJD A;  4BPG A;  1M6N A;  3U43 A;  2KOS A;  2DGY A;  2FAD A;  2XT1 A;  1VQK P;  2KOQ A;  3CCE P;  2N5H A;  2MF4 A;  3CCQ P;  1QVG O;  4GR6 A;  4U0A A;  2PEK A;  2MY5 A;  3RG6 C;  2FAC A;  2M8N A;  3CD6 P;  1OR5 A;  3CCL P;  2BHV A;  1ZNV A;  2VLP A;  2KW2 A;  2L4B A;  1K73 Q;  5JPA A;  2E1M A;  3CCM P;  2VLN A;  1M90 Q;  2QNW A;  2XXM A;  1M6E X;  1E6J P;  5DCK A;  2Z44 A;  2PEI A;  2WPT A;  1M1K Q;  2LF4 A;  1M74 A;  2GZG A;  1N8R Q;  2FHS C;  3CME P;  4H2Y C;  2FAE A;  5HGM A;  3CC2 P;  1L0H A;  2KOP A;  2FQ2 A;  3DS4 A;  4U0F A;  1ACP A;  1YJW P;  2JU1 A;  2PEN A;  2XZ1 C;  2M8P A;  2EHS A;  3LRY A;  2FQ1 A;  2VLO A;  1FR2 A;  2N6Z A;  2XZ0 D;  4PXH B;  2CGQ A;  3P05 A;  2EIA A;  2KG9 A;  2MR7 A;  5F2K A;  2JBG A;  2K94 A;  2FVA A;  2M8L A;  7CEI A;  1YIT P;  3HYB A;  4QKO A;  1EOQ A;  1K9M Q;  3G6E P;  3EJE A;  1GXH A;  2GZI A;  4U0B A;  2KOD A;  3LMO A;  4HKG A;  2MVU A;  4BPH A;  2OAR A;  3DS5 A;  2LIU A;  3I55 P;  1S72 P;  3CXC O;  1X3O A;  4MRT C;  1Q7Y Q;  2JB0 A;  1K30 A;  2GZJ A;  3G1I A;  1VHN A;  2K0D X;  1YIJ P;  1A43 A;  3CCU P;  3CMA P;  5KP8 B;  3GKL C;  1MZ8 A;  1UJZ A;  4H2W C;  1RO2 A;  1VQ5 P;  4PH0 A;  1VQN P;  1Q81 Q;  4H2X C;  2PEJ A;  2KG8 A;  2GDW A;  2PY8 A;  3CCJ P;  2KWL A;  3E2D A;  1A8O A;  2L0Q A;  1KQS O;  2EHT A;  3GZL A;  1BXI A;  2CWO A;  2EG5 A;  5KP7 B;  2KGE A;  4IZ6 A;  3H47 A;  2ERH A;  3MGE A;  4F37 A;  3GZM A;  2LKI A;  5I4T G;  3RG2 A;  1NJI Q;  2GDX A;  2K92 A;  2N50 A;  3G0V A;  3CC4 P;  1CEI A;  1YHQ P;  1GXG A;  1AF8 A;  2FVE A;  2L6E A;  2KGD A;  2K0X A;  1ZMB A;  1VKU A;  4PH1 A;  3DS2 A;  4DG9 A;  1VQ7 P;  2JYG A;  4U0C A;  3G1G A;  2KOO A;  1Q86 Q;  4IPY A;  1EMV A;  1YJ9 P; 
#chains in the Genus database with same CATH homology
 2N5I A;  2FAC A;  1OR5 A;  1X3O A;  4MRT C;  2KGA A;  4NEO A;  2KW2 A;  2M5R A;  2FVF A;  2L4B A;  2L9F A;  2X2B A;  2K2Q A;  2AF8 A;  2AVA A;  1DV5 A;  2VSQ A;  5CZD B;  5KP6 B;  2QNW A;  2LPK A;  2MVV A;  5KP8 B;  5HVC A;  2LIW A;  2KR5 A;  1NQ4 A;  4H2W C;  2FHS C;  1T8K A;  2L22 A;  4H2Y C;  2FAE A;  1DNY A;  2K0Y A;  2CQ8 A;  4H2X C;  2DNW A;  1L0H A;  2KOP A;  2KG8 A;  2FQ2 A;  2JGP A;  2GDW A;  2KOR A;  1ACP A;  2JU1 A;  3CE7 A;  2XZ1 C;  2KWL A;  2EHS A;  2LOL A;  4R0M A;  4PWV B;  4BPF A;  2AFD A;  2L0Q A;  2FQ1 A;  2EHT A;  3GZL A;  1L0I A;  2N6Z A;  2XZ0 D;  4PXH B;  2CGQ A;  2PNG A;  2KGC A;  1KLP A;  5KP7 B;  2JU2 A;  2KGE A;  2JQ4 A;  1HY8 A;  3NY7 B;  4IZ6 A;  2MD9 A;  2KG9 A;  2CNR A;  2GDY A;  3EJB A;  2MR7 A;  3GZM A;  2LKI A;  2N6Y A;  2LTE A;  3RG2 A;  2ROQ A;  2GDX A;  2K92 A;  2KG6 A;  2N98 A;  2MR8 A;  1F80 D;  2N50 A;  5HV8 A;  2K94 A;  5EJD A;  4BPG A;  2FVA A;  2AFE A;  1HQB A;  1AF8 A;  2FVE A;  2KGD A;  2K0X A;  2KOS A;  3EJD A;  3EJE A;  1VKU A;  2FAD A;  2K93 A;  2LML A;  2CG5 B;  4DG9 A;  3LMO A;  2KOQ A;  2FQ0 A;  2MVU A;  4HKG A;  2N5H A;  4BPH A;  2MF4 A;  2KOO A;  4CA3 A;  2MY5 A;  2LL8 A;  2LIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...