2AVAA

Solution structure of stearoyl-acyl carrier protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
b'AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein I, chloroplast
publication title Solution structures of spinach acyl carrier protein with decanoate and stearate
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Biosynthetic protein
total genus 19
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2005-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2avaA00
2FAEA 2L4BA 1L0HA 3RG2A 2N98A 1DNYA 4H2XC 4NEOA 2MF4A 2FQ1A 2LL8A 2KG6A 5HV8A 2CGQA 2FVEA 2KORA 2KOOA 2JQ4A 2K2QA 1AF8A 2KG8A 5CZDB 2KOSA 5KP8B 2AFDA 2MVUA 2KG9A 4H2YC 3EJDA 2LIWA 2N5HA 2GDYA 2KW2A 1KLPA 4BPFA 2FACA 4IZ6A 2LMLA 2DNWA 5HVCA 3CE7A 2EHTA 2MR8A 4PXHB 2M5RA 2N6ZA 2KR5A 2CG5B 4R0MA 5KP7B 2LPKA 2MD9A 2AF8A 2KWLA 4BPGA 2K93A 2ROQA 3GZLA 5KP6B 2FADA 4HKGA 2CNRA 2GDWA 2FVAA 2JU2A 2FQ2A 2L0QA 2L22A 3EJEA 1F80D 3EJBA 2JU1A 2XZ0D 2LTEA 2AVAA 2LKIA 2MY5A 2XZ1C 2K94A 3GZMA 5EJDA 1OR5A 1DV5A 1T8KA 2KGCA 2KOPA 2LIUA 2MR7A 2GDXA 2N6YA 2X2BA 2CQ8A 1X3OA 2KGDA 2KGEA 3LMOA 1NQ4A 3NY7B 2MVVA 2K0YA 4BPHA 1L0IA 2JGPA 2K0XA 2N50A 2N5IA 1ACPA 2KGAA 2LOLA 4H2WC 2PNGA 1VKUA 2EHSA 4CA3A 1HY8A 1HQBA 2L9FA 2VSQA 2KOQA 2QNWA 4PWVB 2K92A 2FVFA 2FHSC 2FQ0A 2AFEA 4DG9A 4MRTC
chains in the Genus database with same CATH superfamily
2ONTA 1YITP 2EFJA 2L6EA 1UNKA 4H2XC 4NEOA 1VQ9P 1GXHA 1VQOP 2FQ1A 3DPHA 5BS1A 1VQ7P 2JAZA 1VQ5P 1D1DA 2K2QA 3DS3A 2XXMA 2EIAA 3U43A 5CZDB 2E1MA 2KOSA 4PH1A 2MVUA 2KG9A 1M90Q 3CMAP 2LIWA 2GDYA 2VLOA 1M6NA 3DTJA 2LF4A 1Q86Q 2LMLA 1VQPP 1IUQA 2OTLP 1GXGA 2MR8A 2CG5B 1BXIA 2LPKA 2MD9A 2M8NA 3GJNA 1ZMBA 2ROQA 1A43A 1KC8Q 5F2NA 3DS5A 2GDWA 2FVAA 2JU2A 3EJEA 2XZ0D 3G29A 2Z46A 1M6EX 3GZMA 1UJZA 1MZ8A 2LIUA 2KOPA 2MR7A 2GDXA 1X3OA 4U0EA 3GKLC 2K0XA 1BAJA 2LOLA 2PNGA 2VLQA 2EHSA 3CC7P 2KODA 4U0DA 3DS4A 1VQLP 3CPWO 2FVFA 2JYLA 4DG9A 2ERHA 2PEKA 2L4BA 3HZQA 3RG2A 3H0DA 2GYKA 2MF4A 2PEQA 2LL8A 2KG6A 2FVEA 2KORA 1EMVA 1K9MQ 1RNIA 2PEJA 2KG8A 4QNBA 3B4QA 4U0FA 3CC4P 2BUOA 3P05A 5BS2A 1EOQA 4XFXA 4COPA 4IZ6A 1VHNA 2K0DX 3G71P 2DNWA 5HVCA 3CE7A 5JPAA 3RG6C 2Z45A 3G1GA 1K73Q 3G4SP 1JJ2O 2KWLA 4U0AA 3CXCO 4U0CA 3G0VA 5KP6B 4XRQA 4HKGA 4GR2A 3H4EA 4UHPB 1ZNVA 2NO8A 3EJBA 4M0IA 4PH0A 1A8OA 1EIAA 2XZ1C 1Z6MA 2K94A 1IMQA 1OR5A 2X2BA 2N6YA 2KGDA 5EW5E 3CCMP 4BPHA 1W2BO 1L0IA 2N50A 2N5IA 1ACPA 3G26A 2PEMA 1E6JP 1AUMA 2L9FA 3CC2P 1M74A 4F37A 3CCQP 2Z44A 1RO0A 2FAEA 1Q81Q 1L0HA 3MGEA 1GPJA 2PEIA 2N98A 3CCJP 3HYBA 5HV8A 1QVGO 1RO2A 3B5IA 2KOOA 2JQ4A 3DS2A 3CCLP 4IPYA 2P9XA 5HGNA 2JYGA 3LRYA 4QKOA 3CCVP 5KP8B 2K5XA 2XV6A 2EG5A 5I4TG 2JO0A 1QRJA 3CCEP 2VLNA 2WPTA 1Q82Q 2EHTA 4PXHB 2KR5A 5KP7B 5HGOA 2AF8A 2PEOA 4WYMA 2K93A 1YI2P 2CNRA 2FQ2A 2VLPA 2DGYA 1F80D 3E2DA 4GR6A 1IMPA 1Q7YQ 2LKIA 2MY5A 1KD1Q 3CD6P 5EJDA 5HGLA 1DV5A 1KQSO 2OTJP 1NQ4A 1VQ6P 1YJ9P 2KGAA 1VQ4P 1CEIA 4H2WC 1S72P 4XFYA 1VKUA 4CA3A 1HY8A 3M1MA 1QVFO 1HQBA 2QNWA 4PWVB 2XT1A 3G1IA 3CCSP 2FQ0A 2AFEA 3DS1A 3CCUP 4MRTC 2GZIA 1YJNP 1K30A 3G6EP 2OARA 1DNYA 1K8AQ 5F2OA 2QA4P 1AYIA 1FR2A 2CGQA 1M1KQ 3VRLC 3WBHA 2M8PA 3G28A 4XFZA 1AF8A 3H47A 2AFDA 3I56P 4H2YC 3NTEA 3EJDA 2N5HA 3CCRP 1VQNP 2KW2A 1KLPA 4BPFA 2FACA 2GZEA 4XROA 1VQ8P 1YIJP 2BHVA 2M5RA 2N6ZA 4R0MA 2GZGA 4BPGA 2QEXP 1N8RQ 3GZLA 2FADA 1YHQP 1VQKP 3Q20A 2L0QA 1NJIQ 2L22A 2JB0A 2JU1A 2JBGA 2LTEA 2AVAA 2PENA 7CEIA 2M8LA 3DS0A 1T8KA 2KGCA 1VQMP 2CQ8A 2KGEA 3LMOA 3NY7B 2MVVA 3CMEP 2K0YA 3I55P 2JGPA 4COCA 5F2KA 2CWOA 2GZJA 4U0BA 1E0HA 2VSQA 3G21A 2KOQA 2GZFA 2K92A 5HGMA 5DCKA 3OW2O 2FHSC 2PY8A 1YJWP
chains in the Genus database with same CATH topology
2FAEA 2L4BA 1L0HA 3RG2A 2N98A 1DNYA 4H2XC 4NEOA 2MF4A 2FQ1A 2LL8A 2KG6A 5HV8A 2CGQA 2FVEA 2KORA 2KOOA 2JQ4A 2K2QA 1AF8A 2KG8A 5CZDB 2KOSA 5KP8B 2AFDA 2MVUA 2KG9A 4H2YC 3EJDA 2LIWA 2N5HA 2GDYA 2KW2A 1KLPA 4BPFA 2FACA 4IZ6A 2LMLA 2DNWA 5HVCA 3CE7A 2EHTA 2MR8A 4PXHB 2M5RA 2N6ZA 2KR5A 2CG5B 4R0MA 5KP7B 2LPKA 2MD9A 2AF8A 2KWLA 4BPGA 2K93A 2ROQA 3GZLA 5KP6B 2FADA 4HKGA 2CNRA 2GDWA 2FVAA 2JU2A 2FQ2A 2L0QA 2L22A 3EJEA 1F80D 3EJBA 2JU1A 2XZ0D 2LTEA 2AVAA 2LKIA 2MY5A 2XZ1C 2K94A 3GZMA 5EJDA 1OR5A 1DV5A 1T8KA 2KGCA 2KOPA 2LIUA 2MR7A 2GDXA 2N6YA 2X2BA 2CQ8A 1X3OA 2KGDA 2KGEA 3LMOA 1NQ4A 3NY7B 2MVVA 2K0YA 4BPHA 1L0IA 2JGPA 2K0XA 2N50A 2N5IA 1ACPA 2KGAA 2LOLA 4H2WC 2PNGA 1VKUA 2EHSA 4CA3A 1HY8A 1HQBA 2L9FA 2VSQA 2KOQA 2QNWA 4PWVB 2K92A 2FVFA 2FHSC 2FQ0A 2AFEA 4DG9A 4MRTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAE A;  2L4B A;  1L0H A;  3RG2 A;  2N98 A;  1DNY A;  4H2X C;  4NEO A;  2MF4 A;  2FQ1 A;  2LL8 A;  2KG6 A;  5HV8 A;  2CGQ A;  2FVE A;  2KOR A;  2KOO A;  2JQ4 A;  2K2Q A;  1AF8 A;  2KG8 A;  5CZD B;  2KOS A;  5KP8 B;  2AFD A;  2MVU A;  2KG9 A;  4H2Y C;  3EJD A;  2LIW A;  2N5H A;  2GDY A;  2KW2 A;  1KLP A;  4BPF A;  2FAC A;  4IZ6 A;  2LML A;  2DNW A;  5HVC A;  3CE7 A;  2EHT A;  2MR8 A;  4PXH B;  2M5R A;  2N6Z A;  2KR5 A;  2CG5 B;  4R0M A;  5KP7 B;  2LPK A;  2MD9 A;  2AF8 A;  2KWL A;  4BPG A;  2K93 A;  2ROQ A;  3GZL A;  5KP6 B;  2FAD A;  4HKG A;  2CNR A;  2GDW A;  2FVA A;  2JU2 A;  2FQ2 A;  2L0Q A;  2L22 A;  3EJE A;  1F80 D;  3EJB A;  2JU1 A;  2XZ0 D;  2LTE A;  2AVA A;  2LKI A;  2MY5 A;  2XZ1 C;  2K94 A;  3GZM A;  5EJD A;  1OR5 A;  1DV5 A;  1T8K A;  2KGC A;  2KOP A;  2LIU A;  2MR7 A;  2GDX A;  2N6Y A;  2X2B A;  2CQ8 A;  1X3O A;  2KGD A;  2KGE A;  3LMO A;  1NQ4 A;  3NY7 B;  2MVV A;  2K0Y A;  4BPH A;  1L0I A;  2JGP A;  2K0X A;  2N50 A;  2N5I A;  1ACP A;  2KGA A;  2LOL A;  4H2W C;  2PNG A;  1VKU A;  2EHS A;  4CA3 A;  1HY8 A;  1HQB A;  2L9F A;  2VSQ A;  2KOQ A;  2QNW A;  4PWV B;  2K92 A;  2FVF A;  2FHS C;  2FQ0 A;  2AFE A;  4DG9 A;  4MRT C; 
#chains in the Genus database with same CATH topology
 2ONT A;  1YIT P;  2EFJ A;  2L6E A;  1UNK A;  4H2X C;  4NEO A;  1VQ9 P;  1GXH A;  1VQO P;  2FQ1 A;  3DPH A;  5BS1 A;  1VQ7 P;  2JAZ A;  1VQ5 P;  1D1D A;  2K2Q A;  3DS3 A;  2XXM A;  2EIA A;  3U43 A;  5CZD B;  2E1M A;  2KOS A;  4PH1 A;  2MVU A;  2KG9 A;  1M90 Q;  3CMA P;  2LIW A;  2GDY A;  2VLO A;  1M6N A;  3DTJ A;  2LF4 A;  1Q86 Q;  2LML A;  1VQP P;  1IUQ A;  2OTL P;  1GXG A;  2MR8 A;  2CG5 B;  1BXI A;  2LPK A;  2MD9 A;  2M8N A;  3GJN A;  1ZMB A;  2ROQ A;  1A43 A;  1KC8 Q;  5F2N A;  3DS5 A;  2GDW A;  2FVA A;  2JU2 A;  3EJE A;  2XZ0 D;  3G29 A;  2Z46 A;  1M6E X;  3GZM A;  1UJZ A;  1MZ8 A;  2LIU A;  2KOP A;  2MR7 A;  2GDX A;  1X3O A;  4U0E A;  3GKL C;  2K0X A;  1BAJ A;  2LOL A;  2PNG A;  2VLQ A;  2EHS A;  3CC7 P;  2KOD A;  4U0D A;  3DS4 A;  1VQL P;  3CPW O;  2FVF A;  2JYL A;  4DG9 A;  2ERH A;  2PEK A;  2L4B A;  3HZQ A;  3RG2 A;  3H0D A;  2GYK A;  2MF4 A;  2PEQ A;  2LL8 A;  2KG6 A;  2FVE A;  2KOR A;  1EMV A;  1K9M Q;  1RNI A;  2PEJ A;  2KG8 A;  4QNB A;  3B4Q A;  4U0F A;  3CC4 P;  2BUO A;  3P05 A;  5BS2 A;  1EOQ A;  4XFX A;  4COP A;  4IZ6 A;  1VHN A;  2K0D X;  3G71 P;  2DNW A;  5HVC A;  3CE7 A;  5JPA A;  3RG6 C;  2Z45 A;  3G1G A;  1K73 Q;  3G4S P;  1JJ2 O;  2KWL A;  4U0A A;  3CXC O;  4U0C A;  3G0V A;  5KP6 B;  4XRQ A;  4HKG A;  4GR2 A;  3H4E A;  4UHP B;  1ZNV A;  2NO8 A;  3EJB A;  4M0I A;  4PH0 A;  1A8O A;  1EIA A;  2XZ1 C;  1Z6M A;  2K94 A;  1IMQ A;  1OR5 A;  2X2B A;  2N6Y A;  2KGD A;  5EW5 E;  3CCM P;  4BPH A;  1W2B O;  1L0I A;  2N50 A;  2N5I A;  1ACP A;  3G26 A;  2PEM A;  1E6J P;  1AUM A;  2L9F A;  3CC2 P;  1M74 A;  4F37 A;  3CCQ P;  2Z44 A;  1RO0 A;  2FAE A;  1Q81 Q;  1L0H A;  3MGE A;  1GPJ A;  2PEI A;  2N98 A;  3CCJ P;  3HYB A;  5HV8 A;  1QVG O;  1RO2 A;  3B5I A;  2KOO A;  2JQ4 A;  3DS2 A;  3CCL P;  4IPY A;  2P9X A;  5HGN A;  2JYG A;  3LRY A;  4QKO A;  3CCV P;  5KP8 B;  2K5X A;  2XV6 A;  2EG5 A;  5I4T G;  2JO0 A;  1QRJ A;  3CCE P;  2VLN A;  2WPT A;  1Q82 Q;  2EHT A;  4PXH B;  2KR5 A;  5KP7 B;  5HGO A;  2AF8 A;  2PEO A;  4WYM A;  2K93 A;  1YI2 P;  2CNR A;  2FQ2 A;  2VLP A;  2DGY A;  1F80 D;  3E2D A;  4GR6 A;  1IMP A;  1Q7Y Q;  2LKI A;  2MY5 A;  1KD1 Q;  3CD6 P;  5EJD A;  5HGL A;  1DV5 A;  1KQS O;  2OTJ P;  1NQ4 A;  1VQ6 P;  1YJ9 P;  2KGA A;  1VQ4 P;  1CEI A;  4H2W C;  1S72 P;  4XFY A;  1VKU A;  4CA3 A;  1HY8 A;  3M1M A;  1QVF O;  1HQB A;  2QNW A;  4PWV B;  2XT1 A;  3G1I A;  3CCS P;  2FQ0 A;  2AFE A;  3DS1 A;  3CCU P;  4MRT C;  2GZI A;  1YJN P;  1K30 A;  3G6E P;  2OAR A;  1DNY A;  1K8A Q;  5F2O A;  2QA4 P;  1AYI A;  1FR2 A;  2CGQ A;  1M1K Q;  3VRL C;  3WBH A;  2M8P A;  3G28 A;  4XFZ A;  1AF8 A;  3H47 A;  2AFD A;  3I56 P;  4H2Y C;  3NTE A;  3EJD A;  2N5H A;  3CCR P;  1VQN P;  2KW2 A;  1KLP A;  4BPF A;  2FAC A;  2GZE A;  4XRO A;  1VQ8 P;  1YIJ P;  2BHV A;  2M5R A;  2N6Z A;  4R0M A;  2GZG A;  4BPG A;  2QEX P;  1N8R Q;  3GZL A;  2FAD A;  1YHQ P;  1VQK P;  3Q20 A;  2L0Q A;  1NJI Q;  2L22 A;  2JB0 A;  2JU1 A;  2JBG A;  2LTE A;  2AVA A;  2PEN A;  7CEI A;  2M8L A;  3DS0 A;  1T8K A;  2KGC A;  1VQM P;  2CQ8 A;  2KGE A;  3LMO A;  3NY7 B;  2MVV A;  3CME P;  2K0Y A;  3I55 P;  2JGP A;  4COC A;  5F2K A;  2CWO A;  2GZJ A;  4U0B A;  1E0H A;  2VSQ A;  3G21 A;  2KOQ A;  2GZF A;  2K92 A;  5HGM A;  5DCK A;  3OW2 O;  2FHS C;  2PY8 A;  1YJW P; 
#chains in the Genus database with same CATH homology
 2FAE A;  2L4B A;  1L0H A;  3RG2 A;  2N98 A;  1DNY A;  4H2X C;  4NEO A;  2MF4 A;  2FQ1 A;  2LL8 A;  2KG6 A;  5HV8 A;  2CGQ A;  2FVE A;  2KOR A;  2KOO A;  2JQ4 A;  2K2Q A;  1AF8 A;  2KG8 A;  5CZD B;  2KOS A;  5KP8 B;  2AFD A;  2MVU A;  2KG9 A;  4H2Y C;  3EJD A;  2LIW A;  2N5H A;  2GDY A;  2KW2 A;  1KLP A;  4BPF A;  2FAC A;  4IZ6 A;  2LML A;  2DNW A;  5HVC A;  3CE7 A;  2EHT A;  2MR8 A;  4PXH B;  2M5R A;  2N6Z A;  2KR5 A;  2CG5 B;  4R0M A;  5KP7 B;  2LPK A;  2MD9 A;  2AF8 A;  2KWL A;  4BPG A;  2K93 A;  2ROQ A;  3GZL A;  5KP6 B;  2FAD A;  4HKG A;  2CNR A;  2GDW A;  2FVA A;  2JU2 A;  2FQ2 A;  2L0Q A;  2L22 A;  3EJE A;  1F80 D;  3EJB A;  2JU1 A;  2XZ0 D;  2LTE A;  2AVA A;  2LKI A;  2MY5 A;  2XZ1 C;  2K94 A;  3GZM A;  5EJD A;  1OR5 A;  1DV5 A;  1T8K A;  2KGC A;  2KOP A;  2LIU A;  2MR7 A;  2GDX A;  2N6Y A;  2X2B A;  2CQ8 A;  1X3O A;  2KGD A;  2KGE A;  3LMO A;  1NQ4 A;  3NY7 B;  2MVV A;  2K0Y A;  4BPH A;  1L0I A;  2JGP A;  2K0X A;  2N50 A;  2N5I A;  1ACP A;  2KGA A;  2LOL A;  4H2W C;  2PNG A;  1VKU A;  2EHS A;  4CA3 A;  1HY8 A;  1HQB A;  2L9F A;  2VSQ A;  2KOQ A;  2QNW A;  4PWV B;  2K92 A;  2FVF A;  2FHS C;  2FQ0 A;  2AFE A;  4DG9 A;  4MRT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...