2AVAA

Solution structure of stearoyl-acyl carrier protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Acyl carrier protein I, chloroplast
publication title Solution structures of spinach acyl carrier protein with decanoate and stearate
pubmed doi rcsb
source organism Spinacia oleracea
total genus 19
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2005-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2avaA00
2N6YA 2K0XA 2LIUA 2FADA 4H2YC 2KOOA 5KP8B 2K93A 2LPKA 2ROQA 5KP7B 4BPFA 2K92A 3GZLA 2MF4A 2KGAA 2JU2A 1KLPA 2MR8A 4DG9A 2AFEA 4PXHB 2FVFA 2N5IA 5EJDA 5HV8A 1DNYA 1L0HA 2MY5A 4PWVB 2EHTA 2K94A 2FQ1A 2N6ZA 2KW2A 2QNWA 2FHSC 2KWLA 4BPGA 1OR5A 1F80D 2KGCA 2KORA 4H2XC 2AF8A 2GDYA 2KG6A 2MVUA 2L9FA 4HKGA 2KOSA 2JU1A 2MD9A 1L0IA 3RG2A 1VKUA 2CQ8A 2FQ0A 2LL8A 2L4BA 2VSQA 1HY8A 3EJBA 2M5RA 2PNGA 3GZMA 2K2QA 4MRTC 1X3OA 2L22A 2KGDA 3LMOA 2LKIA 3NY7B 2JQ4A 2FACA 2MVVA 2LMLA 2N50A 4NEOA 1DV5A 4R0MA 2L0QA 2EHSA 5KP6B 2GDXA 2CGQA 2LTEA 2AFDA 2KOPA 2KOQA 2K0YA 2LIWA 2N98A 3CE7A 4BPHA 1ACPA 5HVCA 2KGEA 1HQBA 5CZDB 2CNRA 2MR7A 2X2BA 1T8KA 3EJDA 2XZ1C 2DNWA 2FQ2A 2KG8A 2JGPA 2FAEA 3EJEA 2LOLA 2AVAA 2GDWA 2XZ0D 2FVEA 1NQ4A 2N5HA 2KR5A 4H2WC 4IZ6A 2CG5B 2KG9A 1AF8A 4CA3A 2FVAA
chains in the Genus database with same CATH superfamily
1Q82Q 1M90Q 3CPWO 5HGOA 1M1KQ 3DS4A 2KOOA 2ROQA 5KP7B 4BPFA 2CWOA 3GZLA 5F2OA 2MR8A 1K9MQ 3LRYA 5EJDA 5HV8A 2VLQA 3DS0A 1VQMP 2QNWA 2JB0A 3G1IA 1ZNVA 2JYLA 5JPAA 3CCMP 5F2KA 2GZEA 3DS1A 1W2BO 1M6NA 3CXCO 1E6JP 4U0BA 2KOSA 1ZMBA 1A8OA 3GKLC 1L0IA 1VKUA 2CQ8A 2JAZA 2LL8A 4U0FA 2VSQA 2BHVA 3EJBA 1YI2P 1FR2A 2PEJA 1KQSO 2Z45A 2Z44A 2L22A 2P9XA 2LKIA 3B5IA 1YITP 2FACA 3I56P 3Q20A 3CCUP 1VHNA 2M8PA 3CCEP 2GDXA 2CGQA 3HZQA 1GXGA 2LIWA 1NJIQ 2DGYA 2XV6A 5F2NA 3OW2O 1IMQA 1T8KA 2E1MA 2GZGA 1QVGO 3H0DA 2FQ2A 4XFXA 3G29A 2AVAA 4IPYA 2N5HA 1NQ4A 3HYBA 1VQKP 2FVAA 2JYGA 3DS3A 1CEIA 2LIUA 1RNIA 4H2YC 2K93A 2GZIA 4M0IA 2ONTA 2GYKA 2N5IA 4U0DA 1L0HA 2MY5A 4PWVB 2OARA 3G21A 2KWLA 5HGLA 3G28A 1OR5A 2KORA 2AF8A 4GR6A 4HKGA 2JU1A 2MD9A 3CD6P 4XFZA 3CCJP 1VQLP 1VQ6P 1EMVA 1IMPA 1YJWP 1Z6MA 2M5RA 1X3OA 4U0EA 3LMOA 2VLPA 1N8RQ 1Q86Q 2EFJA 4NEOA 1E0HA 1Q7YQ 3CC7P 4BPHA 1VQ9P 3CE7A 4GR2A 2EIAA 5HVCA 3GJNA 1RO2A 1HQBA 3CCLP 1GXHA 2VLOA 2X2BA 2XXMA 3B4QA 2XZ1C 1Q81Q 3G6EP 1K73Q 2JGPA 2GDWA 2XZ0D 2FVEA 4H2WC 1VQ8P 2PENA 4COPA 2N6YA 2K0XA 2K0DX 2NO8A 2FADA 2LPKA 2MF4A 2KGAA 1KLPA 2PEKA 3E2DA 2XT1A 4DG9A 3G1GA 3CC2P 1IUQA 2AFEA 3NTEA 1DNYA 4QKOA 1D1DA 2BUOA 2EHTA 2N6ZA 2FQ1A 1EOQA 2LF4A 3CCQP 2WPTA 4BPGA 3CCRP 1F80D 2KG6A 2MVUA 2L9FA 3RG2A 2JBGA 2L4BA 1MZ8A 1HY8A 2GZFA 2PNGA 2JO0A 3GZMA 2K2QA 4MRTC 5EW5E 1BXIA 1M74A 1DV5A 1JJ2O 2EHSA 5KP6B 2K5XA 3CCSP 2AFDA 2KOPA 2KOQA 2K0YA 1ACPA 2N98A 3WBHA 2PEQA 3G4SP 5CZDB 2PY8A 3CC4P 2M8NA 3G71P 3H47A 2M8LA 2FAEA 3EJEA 3DPHA 1VQNP 2LOLA 2PEOA 2OTLP 1A43A 3I55P 2QEXP 2KR5A 1AUMA 2CG5B 2KG9A 1AF8A 4CA3A 1RO0A 3DTJA 1VQ7P 3H4EA 3M1MA 4U0AA 1GPJA 1VQOP 2QA4P 1VQ5P 4UHPB 1K30A 3G0VA 5KP8B 1AYIA 7CEIA 2K92A 4PH0A 2GZJA 5I4TG 2JU2A 2PEIA 4PXHB 2FVFA 1UJZA 2K94A 4U0CA 2KW2A 3G26A 3P05A 2FHSC 5BS1A 1VQPP 3MGEA 4PH1A 2KGCA 2OTJP 3CMEP 4H2XC 1VQ4P 2ERHA 2GDYA 1YHQP 2Z46A 1QVFO 2PEMA 2FQ0A 1KD1Q 5HGMA 1M6EX 3CMAP 3DS5A 2VLNA 4XRQA 3VRLC 4WYMA 1EIAA 2EG5A 3DS2A 2KGDA 1K8AQ 3NY7B 2JQ4A 1YJ9P 2MVVA 2LMLA 2N50A 4R0MA 2L0QA 2KODA 1YIJP 2L6EA 2LTEA 3CCVP 4XFYA 1UNKA 1YJNP 4COCA 1BAJA 2KGEA 1QRJA 5HGNA 2CNRA 2MR7A 1S72P 1KC8Q 3RG6C 4F37A 3EJDA 3U43A 2DNWA 4QNBA 2KG8A 4XROA 4IZ6A 5BS2A 5DCKA
chains in the Genus database with same CATH topology
2N6YA 2K0XA 2LIUA 2FADA 4H2YC 2KOOA 5KP8B 2K93A 2LPKA 2ROQA 5KP7B 4BPFA 2K92A 3GZLA 2MF4A 2KGAA 2JU2A 1KLPA 2MR8A 4DG9A 2AFEA 4PXHB 2FVFA 2N5IA 5EJDA 5HV8A 1DNYA 1L0HA 2MY5A 4PWVB 2EHTA 2K94A 2FQ1A 2N6ZA 2KW2A 2QNWA 2FHSC 2KWLA 4BPGA 1OR5A 1F80D 2KGCA 2KORA 4H2XC 2AF8A 2GDYA 2KG6A 2MVUA 2L9FA 4HKGA 2KOSA 2JU1A 2MD9A 1L0IA 3RG2A 1VKUA 2CQ8A 2FQ0A 2LL8A 2L4BA 2VSQA 1HY8A 3EJBA 2M5RA 2PNGA 3GZMA 2K2QA 4MRTC 1X3OA 2L22A 2KGDA 3LMOA 2LKIA 3NY7B 2JQ4A 2FACA 2MVVA 2LMLA 2N50A 4NEOA 1DV5A 4R0MA 2L0QA 2EHSA 5KP6B 2GDXA 2CGQA 2LTEA 2AFDA 2KOPA 2KOQA 2K0YA 2LIWA 2N98A 3CE7A 4BPHA 1ACPA 5HVCA 2KGEA 1HQBA 5CZDB 2CNRA 2MR7A 2X2BA 1T8KA 3EJDA 2XZ1C 2DNWA 2FQ2A 2KG8A 2JGPA 2FAEA 3EJEA 2LOLA 2AVAA 2GDWA 2XZ0D 2FVEA 1NQ4A 2N5HA 2KR5A 4H2WC 4IZ6A 2CG5B 2KG9A 1AF8A 4CA3A 2FVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N6Y A;  2K0X A;  2LIU A;  2FAD A;  4H2Y C;  2KOO A;  5KP8 B;  2K93 A;  2LPK A;  2ROQ A;  5KP7 B;  4BPF A;  2K92 A;  3GZL A;  2MF4 A;  2KGA A;  2JU2 A;  1KLP A;  2MR8 A;  4DG9 A;  2AFE A;  4PXH B;  2FVF A;  2N5I A;  5EJD A;  5HV8 A;  1DNY A;  1L0H A;  2MY5 A;  4PWV B;  2EHT A;  2K94 A;  2FQ1 A;  2N6Z A;  2KW2 A;  2QNW A;  2FHS C;  2KWL A;  4BPG A;  1OR5 A;  1F80 D;  2KGC A;  2KOR A;  4H2X C;  2AF8 A;  2GDY A;  2KG6 A;  2MVU A;  2L9F A;  4HKG A;  2KOS A;  2JU1 A;  2MD9 A;  1L0I A;  3RG2 A;  1VKU A;  2CQ8 A;  2FQ0 A;  2LL8 A;  2L4B A;  2VSQ A;  1HY8 A;  3EJB A;  2M5R A;  2PNG A;  3GZM A;  2K2Q A;  4MRT C;  1X3O A;  2L22 A;  2KGD A;  3LMO A;  2LKI A;  3NY7 B;  2JQ4 A;  2FAC A;  2MVV A;  2LML A;  2N50 A;  4NEO A;  1DV5 A;  4R0M A;  2L0Q A;  2EHS A;  5KP6 B;  2GDX A;  2CGQ A;  2LTE A;  2AFD A;  2KOP A;  2KOQ A;  2K0Y A;  2LIW A;  2N98 A;  3CE7 A;  4BPH A;  1ACP A;  5HVC A;  2KGE A;  1HQB A;  5CZD B;  2CNR A;  2MR7 A;  2X2B A;  1T8K A;  3EJD A;  2XZ1 C;  2DNW A;  2FQ2 A;  2KG8 A;  2JGP A;  2FAE A;  3EJE A;  2LOL A;  2AVA A;  2GDW A;  2XZ0 D;  2FVE A;  1NQ4 A;  2N5H A;  2KR5 A;  4H2W C;  4IZ6 A;  2CG5 B;  2KG9 A;  1AF8 A;  4CA3 A;  2FVA A; 
#chains in the Genus database with same CATH topology
 1Q82 Q;  1M90 Q;  3CPW O;  5HGO A;  1M1K Q;  3DS4 A;  2KOO A;  2ROQ A;  5KP7 B;  4BPF A;  2CWO A;  3GZL A;  5F2O A;  2MR8 A;  1K9M Q;  3LRY A;  5EJD A;  5HV8 A;  2VLQ A;  3DS0 A;  1VQM P;  2QNW A;  2JB0 A;  3G1I A;  1ZNV A;  2JYL A;  5JPA A;  3CCM P;  5F2K A;  2GZE A;  3DS1 A;  1W2B O;  1M6N A;  3CXC O;  1E6J P;  4U0B A;  2KOS A;  1ZMB A;  1A8O A;  3GKL C;  1L0I A;  1VKU A;  2CQ8 A;  2JAZ A;  2LL8 A;  4U0F A;  2VSQ A;  2BHV A;  3EJB A;  1YI2 P;  1FR2 A;  2PEJ A;  1KQS O;  2Z45 A;  2Z44 A;  2L22 A;  2P9X A;  2LKI A;  3B5I A;  1YIT P;  2FAC A;  3I56 P;  3Q20 A;  3CCU P;  1VHN A;  2M8P A;  3CCE P;  2GDX A;  2CGQ A;  3HZQ A;  1GXG A;  2LIW A;  1NJI Q;  2DGY A;  2XV6 A;  5F2N A;  3OW2 O;  1IMQ A;  1T8K A;  2E1M A;  2GZG A;  1QVG O;  3H0D A;  2FQ2 A;  4XFX A;  3G29 A;  2AVA A;  4IPY A;  2N5H A;  1NQ4 A;  3HYB A;  1VQK P;  2FVA A;  2JYG A;  3DS3 A;  1CEI A;  2LIU A;  1RNI A;  4H2Y C;  2K93 A;  2GZI A;  4M0I A;  2ONT A;  2GYK A;  2N5I A;  4U0D A;  1L0H A;  2MY5 A;  4PWV B;  2OAR A;  3G21 A;  2KWL A;  5HGL A;  3G28 A;  1OR5 A;  2KOR A;  2AF8 A;  4GR6 A;  4HKG A;  2JU1 A;  2MD9 A;  3CD6 P;  4XFZ A;  3CCJ P;  1VQL P;  1VQ6 P;  1EMV A;  1IMP A;  1YJW P;  1Z6M A;  2M5R A;  1X3O A;  4U0E A;  3LMO A;  2VLP A;  1N8R Q;  1Q86 Q;  2EFJ A;  4NEO A;  1E0H A;  1Q7Y Q;  3CC7 P;  4BPH A;  1VQ9 P;  3CE7 A;  4GR2 A;  2EIA A;  5HVC A;  3GJN A;  1RO2 A;  1HQB A;  3CCL P;  1GXH A;  2VLO A;  2X2B A;  2XXM A;  3B4Q A;  2XZ1 C;  1Q81 Q;  3G6E P;  1K73 Q;  2JGP A;  2GDW A;  2XZ0 D;  2FVE A;  4H2W C;  1VQ8 P;  2PEN A;  4COP A;  2N6Y A;  2K0X A;  2K0D X;  2NO8 A;  2FAD A;  2LPK A;  2MF4 A;  2KGA A;  1KLP A;  2PEK A;  3E2D A;  2XT1 A;  4DG9 A;  3G1G A;  3CC2 P;  1IUQ A;  2AFE A;  3NTE A;  1DNY A;  4QKO A;  1D1D A;  2BUO A;  2EHT A;  2N6Z A;  2FQ1 A;  1EOQ A;  2LF4 A;  3CCQ P;  2WPT A;  4BPG A;  3CCR P;  1F80 D;  2KG6 A;  2MVU A;  2L9F A;  3RG2 A;  2JBG A;  2L4B A;  1MZ8 A;  1HY8 A;  2GZF A;  2PNG A;  2JO0 A;  3GZM A;  2K2Q A;  4MRT C;  5EW5 E;  1BXI A;  1M74 A;  1DV5 A;  1JJ2 O;  2EHS A;  5KP6 B;  2K5X A;  3CCS P;  2AFD A;  2KOP A;  2KOQ A;  2K0Y A;  1ACP A;  2N98 A;  3WBH A;  2PEQ A;  3G4S P;  5CZD B;  2PY8 A;  3CC4 P;  2M8N A;  3G71 P;  3H47 A;  2M8L A;  2FAE A;  3EJE A;  3DPH A;  1VQN P;  2LOL A;  2PEO A;  2OTL P;  1A43 A;  3I55 P;  2QEX P;  2KR5 A;  1AUM A;  2CG5 B;  2KG9 A;  1AF8 A;  4CA3 A;  1RO0 A;  3DTJ A;  1VQ7 P;  3H4E A;  3M1M A;  4U0A A;  1GPJ A;  1VQO P;  2QA4 P;  1VQ5 P;  4UHP B;  1K30 A;  3G0V A;  5KP8 B;  1AYI A;  7CEI A;  2K92 A;  4PH0 A;  2GZJ A;  5I4T G;  2JU2 A;  2PEI A;  4PXH B;  2FVF A;  1UJZ A;  2K94 A;  4U0C A;  2KW2 A;  3G26 A;  3P05 A;  2FHS C;  5BS1 A;  1VQP P;  3MGE A;  4PH1 A;  2KGC A;  2OTJ P;  3CME P;  4H2X C;  1VQ4 P;  2ERH A;  2GDY A;  1YHQ P;  2Z46 A;  1QVF O;  2PEM A;  2FQ0 A;  1KD1 Q;  5HGM A;  1M6E X;  3CMA P;  3DS5 A;  2VLN A;  4XRQ A;  3VRL C;  4WYM A;  1EIA A;  2EG5 A;  3DS2 A;  2KGD A;  1K8A Q;  3NY7 B;  2JQ4 A;  1YJ9 P;  2MVV A;  2LML A;  2N50 A;  4R0M A;  2L0Q A;  2KOD A;  1YIJ P;  2L6E A;  2LTE A;  3CCV P;  4XFY A;  1UNK A;  1YJN P;  4COC A;  1BAJ A;  2KGE A;  1QRJ A;  5HGN A;  2CNR A;  2MR7 A;  1S72 P;  1KC8 Q;  3RG6 C;  4F37 A;  3EJD A;  3U43 A;  2DNW A;  4QNB A;  2KG8 A;  4XRO A;  4IZ6 A;  5BS2 A;  5DCK A; 
#chains in the Genus database with same CATH homology
 2N6Y A;  2K0X A;  2LIU A;  2FAD A;  4H2Y C;  2KOO A;  5KP8 B;  2K93 A;  2LPK A;  2ROQ A;  5KP7 B;  4BPF A;  2K92 A;  3GZL A;  2MF4 A;  2KGA A;  2JU2 A;  1KLP A;  2MR8 A;  4DG9 A;  2AFE A;  4PXH B;  2FVF A;  2N5I A;  5EJD A;  5HV8 A;  1DNY A;  1L0H A;  2MY5 A;  4PWV B;  2EHT A;  2K94 A;  2FQ1 A;  2N6Z A;  2KW2 A;  2QNW A;  2FHS C;  2KWL A;  4BPG A;  1OR5 A;  1F80 D;  2KGC A;  2KOR A;  4H2X C;  2AF8 A;  2GDY A;  2KG6 A;  2MVU A;  2L9F A;  4HKG A;  2KOS A;  2JU1 A;  2MD9 A;  1L0I A;  3RG2 A;  1VKU A;  2CQ8 A;  2FQ0 A;  2LL8 A;  2L4B A;  2VSQ A;  1HY8 A;  3EJB A;  2M5R A;  2PNG A;  3GZM A;  2K2Q A;  4MRT C;  1X3O A;  2L22 A;  2KGD A;  3LMO A;  2LKI A;  3NY7 B;  2JQ4 A;  2FAC A;  2MVV A;  2LML A;  2N50 A;  4NEO A;  1DV5 A;  4R0M A;  2L0Q A;  2EHS A;  5KP6 B;  2GDX A;  2CGQ A;  2LTE A;  2AFD A;  2KOP A;  2KOQ A;  2K0Y A;  2LIW A;  2N98 A;  3CE7 A;  4BPH A;  1ACP A;  5HVC A;  2KGE A;  1HQB A;  5CZD B;  2CNR A;  2MR7 A;  2X2B A;  1T8K A;  3EJD A;  2XZ1 C;  2DNW A;  2FQ2 A;  2KG8 A;  2JGP A;  2FAE A;  3EJE A;  2LOL A;  2AVA A;  2GDW A;  2XZ0 D;  2FVE A;  1NQ4 A;  2N5H A;  2KR5 A;  4H2W C;  4IZ6 A;  2CG5 B;  2KG9 A;  1AF8 A;  4CA3 A;  2FVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...