1GXHA

Colicin e8 dnase immunity protein: im8
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
85
structure length
85
Chain Sequence
MELKNSISDYTETEFKKIIEDIINCEGDEKKQDDNLEHFISVTEHPSGSDLIYYPEGNNDGSPEAVIKEIKEWRAANGKSGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN E8 IMMUNITY PROTEIN
publication title Non-Cognate Protein-Protein Interaction: The NMR Structure of the Colicin E8 Inhibitor Protein Im8 and its Interaction with the DNase Domain of Colicin E9
rcsb
source organism Escherichia coli
molecule tags Inhibitor
total genus 32
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2002-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1gxhA00
1FR2A 4QKOA 1MZ8A 2GZIA 2VLQA 2VLPA 2JB0A 1UJZA 4UHPB 2JAZA 1GXHA 1IMQA 7CEIA 2GZGA 1AYIA 1BXIA 1GXGA 2ERHA 1IMPA 2GZJA 2WPTA 1ZNVA 2VLNA 3U43A 5EW5E 2GZEA 1UNKA 2K0DX 2K5XA 4F37A 3GJNA 1CEIA 2JBGA 2GYKA 3GKLC 1E0HA 2NO8A 2GZFA 1EMVA 2VLOA
chains in the Genus database with same CATH superfamily
5EJDA 2PEMA 4H2XC 2MD9A 1GPJA 1UJZA 2JAZA 2N5HA 1Q86Q 2FQ2A 3H0DA 1D1DA 5BS2A 2AFEA 4U0DA 5EW5E 2DGYA 2X2BA 2KG9A 1YIJP 2CNRA 3DS2A 1VQMP 3B4QA 4PWVB 4UHPB 3H4EA 1IMQA 2MVVA 3G71P 2AF8A 2PY8A 2OTJP 5I4TG 1F80D 1M74A 2LOLA 3DS5A 2LIWA 2KGDA 4H2WC 4MRTC 5HGOA 1T8KA 4H2YC 2MR8A 2PEKA 1CEIA 1K9MQ 1K73Q 2EHSA 4WYMA 5BS1A 2XZ1C 3CXCO 2CGQA 1VQLP 2K92A 3CCVP 2CWOA 7CEIA 3G26A 2N50A 3G4SP 4PH1A 3GZMA 2GZEA 1VHNA 2PEJA 3GJNA 3I56P 1E0HA 2NO8A 1VQ9P 5KP6B 3Q20A 2FACA 5HGLA 2PEIA 1GXHA 2BHVA 5HGNA 3G29A 3I55P 4HKGA 1ZNVA 3CE7A 2K0DX 4BPHA 2MY5A 1VQNP 2N6YA 2N5IA 2LL8A 2FQ1A 2M5RA 2LKIA 2KG6A 2XXMA 3RG2A 1L0HA 2L9FA 1N8RQ 3G1IA 1BXIA 2L4BA 2GZJA 1Q82Q 3CCLP 2QNWA 3EJBA 1BAJA 1VQ6P 1E6JP 2KORA 4XFXA 5F2OA 2MF4A 2JU1A 4QKOA 3G28A 2LIUA 3RG6C 2KGCA 3LMOA 2QEXP 1VQKP 4COPA 2FVFA 2JGPA 1IMPA 2K94A 3WBHA 2Z45A 1AUMA 1IUQA 1KD1Q 1VQOP 1EOQA 2GDWA 2CG5B 4U0BA 2JBGA 2GZFA 5KP8B 1RNIA 3CD6P 2GZGA 3M1MA 4PH0A 2ONTA 2K93A 4XFZA 5JPAA 2VLNA 3NY7B 2KW2A 2BUOA 1KQSO 1FR2A 1M1KQ 2EFJA 4PXHB 4BPFA 2XT1A 2K0YA 1X3OA 3DTJA 3P05A 1ACPA 1NJIQ 2M8PA 2KOOA 1QVGO 1K30A 1DNYA 4DG9A 2EIAA 4CA3A 2XV6A 5KP7B 3DS0A 2Z44A 2LF4A 3CC7P 2JYGA 4IPYA 1W2BO 2K2QA 1YJ9P 3DS3A 3G1GA 2KG8A 3HYBA 3LRYA 1Z6MA 1MZ8A 1M6EX 3CCUP 3CCJP 1M90Q 5HVCA 2PNGA 3EJDA 2N98A 1QRJA 2LPKA 3CMEP 2AFDA 3GZLA 2GYKA 2FADA 2L0QA 2MR7A 3DS1A 2VLOA 2LMLA 3CCMP 1VQ4P 2KOPA 4GR6A 2GDXA 4IZ6A 3EJEA 5F2KA 1VQPP 2OTLP 1RO2A 2QA4P 1DV5A 4U0EA 4U0CA 3DPHA 2FHSC 4XROA 2EHTA 3GKLC 2CQ8A 2XZ0D 3HZQA 2PEQA 5CZDB 2VLQA 2FQ0A 2DNWA 3H47A 4GR2A 1NQ4A 2JO0A 4NEOA 2L6EA 1K8AQ 1S72P 2FVAA 2KGEA 4COCA 1YITP 4U0FA 2JU2A 1AF8A 3CMAP 2KOQA 2EG5A 3G6EP 3CCRP 1YJWP 3CC2P 2K0XA 1Q7YQ 1UNKA 2LTEA 3B5IA 1VKUA 4XRQA 2M8NA 4BPGA 4R0MA 3VRLC 1OR5A 4U0AA 1KC8Q 2KR5A 2N6ZA 1KLPA 2GZIA 4QNBA 2VLPA 4M0IA 1HQBA 2JYLA 2KWLA 2P9XA 1VQ7P 3U43A 2MVUA 3OW2O 5HGMA 4F37A 1YJNP 2KGAA 2JB0A 1M6NA 1EIAA 1A8OA 1VQ8P 2E1MA 3MGEA 3G0VA 3DS4A 2AVAA 1A43A 2VSQA 4XFYA 1JJ2O 5HV8A 3G21A 3CCEP 2OARA 5DCKA 3CCSP 1QVFO 2KODA 2Z46A 2ROQA 1RO0A 3NTEA 1EMVA 2L22A 3CC4P 2PEOA 1Q81Q 2FVEA 1L0IA 2FAEA 3CCQP 2KOSA 1VQ5P 1YHQP 1AYIA 1GXGA 2ERHA 1YI2P 2WPTA 1ZMBA 2GDYA 1HY8A 2PENA 3E2DA 2K5XA 3CPWO 5F2NA 2M8LA 2JQ4A
chains in the Genus database with same CATH topology
1FR2A 4QKOA 1MZ8A 2GZIA 2VLQA 2VLPA 2JB0A 1UJZA 4UHPB 2JAZA 1GXHA 1IMQA 7CEIA 2GZGA 1AYIA 1BXIA 1GXGA 2ERHA 1IMPA 2GZJA 2WPTA 1ZNVA 2VLNA 3U43A 5EW5E 2GZEA 1UNKA 2K0DX 2K5XA 4F37A 3GJNA 1CEIA 2JBGA 2GYKA 3GKLC 1E0HA 2NO8A 2GZFA 1EMVA 2VLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FR2 A;  4QKO A;  1MZ8 A;  2GZI A;  2VLQ A;  2VLP A;  2JB0 A;  1UJZ A;  4UHP B;  2JAZ A;  1GXH A;  1IMQ A;  7CEI A;  2GZG A;  1AYI A;  1BXI A;  1GXG A;  2ERH A;  1IMP A;  2GZJ A;  2WPT A;  1ZNV A;  2VLN A;  3U43 A;  5EW5 E;  2GZE A;  1UNK A;  2K0D X;  2K5X A;  4F37 A;  3GJN A;  1CEI A;  2JBG A;  2GYK A;  3GKL C;  1E0H A;  2NO8 A;  2GZF A;  1EMV A;  2VLO A; 
#chains in the Genus database with same CATH topology
 5EJD A;  2PEM A;  4H2X C;  2MD9 A;  1GPJ A;  1UJZ A;  2JAZ A;  2N5H A;  1Q86 Q;  2FQ2 A;  3H0D A;  1D1D A;  5BS2 A;  2AFE A;  4U0D A;  5EW5 E;  2DGY A;  2X2B A;  2KG9 A;  1YIJ P;  2CNR A;  3DS2 A;  1VQM P;  3B4Q A;  4PWV B;  4UHP B;  3H4E A;  1IMQ A;  2MVV A;  3G71 P;  2AF8 A;  2PY8 A;  2OTJ P;  5I4T G;  1F80 D;  1M74 A;  2LOL A;  3DS5 A;  2LIW A;  2KGD A;  4H2W C;  4MRT C;  5HGO A;  1T8K A;  4H2Y C;  2MR8 A;  2PEK A;  1CEI A;  1K9M Q;  1K73 Q;  2EHS A;  4WYM A;  5BS1 A;  2XZ1 C;  3CXC O;  2CGQ A;  1VQL P;  2K92 A;  3CCV P;  2CWO A;  7CEI A;  3G26 A;  2N50 A;  3G4S P;  4PH1 A;  3GZM A;  2GZE A;  1VHN A;  2PEJ A;  3GJN A;  3I56 P;  1E0H A;  2NO8 A;  1VQ9 P;  5KP6 B;  3Q20 A;  2FAC A;  5HGL A;  2PEI A;  1GXH A;  2BHV A;  5HGN A;  3G29 A;  3I55 P;  4HKG A;  1ZNV A;  3CE7 A;  2K0D X;  4BPH A;  2MY5 A;  1VQN P;  2N6Y A;  2N5I A;  2LL8 A;  2FQ1 A;  2M5R A;  2LKI A;  2KG6 A;  2XXM A;  3RG2 A;  1L0H A;  2L9F A;  1N8R Q;  3G1I A;  1BXI A;  2L4B A;  2GZJ A;  1Q82 Q;  3CCL P;  2QNW A;  3EJB A;  1BAJ A;  1VQ6 P;  1E6J P;  2KOR A;  4XFX A;  5F2O A;  2MF4 A;  2JU1 A;  4QKO A;  3G28 A;  2LIU A;  3RG6 C;  2KGC A;  3LMO A;  2QEX P;  1VQK P;  4COP A;  2FVF A;  2JGP A;  1IMP A;  2K94 A;  3WBH A;  2Z45 A;  1AUM A;  1IUQ A;  1KD1 Q;  1VQO P;  1EOQ A;  2GDW A;  2CG5 B;  4U0B A;  2JBG A;  2GZF A;  5KP8 B;  1RNI A;  3CD6 P;  2GZG A;  3M1M A;  4PH0 A;  2ONT A;  2K93 A;  4XFZ A;  5JPA A;  2VLN A;  3NY7 B;  2KW2 A;  2BUO A;  1KQS O;  1FR2 A;  1M1K Q;  2EFJ A;  4PXH B;  4BPF A;  2XT1 A;  2K0Y A;  1X3O A;  3DTJ A;  3P05 A;  1ACP A;  1NJI Q;  2M8P A;  2KOO A;  1QVG O;  1K30 A;  1DNY A;  4DG9 A;  2EIA A;  4CA3 A;  2XV6 A;  5KP7 B;  3DS0 A;  2Z44 A;  2LF4 A;  3CC7 P;  2JYG A;  4IPY A;  1W2B O;  2K2Q A;  1YJ9 P;  3DS3 A;  3G1G A;  2KG8 A;  3HYB A;  3LRY A;  1Z6M A;  1MZ8 A;  1M6E X;  3CCU P;  3CCJ P;  1M90 Q;  5HVC A;  2PNG A;  3EJD A;  2N98 A;  1QRJ A;  2LPK A;  3CME P;  2AFD A;  3GZL A;  2GYK A;  2FAD A;  2L0Q A;  2MR7 A;  3DS1 A;  2VLO A;  2LML A;  3CCM P;  1VQ4 P;  2KOP A;  4GR6 A;  2GDX A;  4IZ6 A;  3EJE A;  5F2K A;  1VQP P;  2OTL P;  1RO2 A;  2QA4 P;  1DV5 A;  4U0E A;  4U0C A;  3DPH A;  2FHS C;  4XRO A;  2EHT A;  3GKL C;  2CQ8 A;  2XZ0 D;  3HZQ A;  2PEQ A;  5CZD B;  2VLQ A;  2FQ0 A;  2DNW A;  3H47 A;  4GR2 A;  1NQ4 A;  2JO0 A;  4NEO A;  2L6E A;  1K8A Q;  1S72 P;  2FVA A;  2KGE A;  4COC A;  1YIT P;  4U0F A;  2JU2 A;  1AF8 A;  3CMA P;  2KOQ A;  2EG5 A;  3G6E P;  3CCR P;  1YJW P;  3CC2 P;  2K0X A;  1Q7Y Q;  1UNK A;  2LTE A;  3B5I A;  1VKU A;  4XRQ A;  2M8N A;  4BPG A;  4R0M A;  3VRL C;  1OR5 A;  4U0A A;  1KC8 Q;  2KR5 A;  2N6Z A;  1KLP A;  2GZI A;  4QNB A;  2VLP A;  4M0I A;  1HQB A;  2JYL A;  2KWL A;  2P9X A;  1VQ7 P;  3U43 A;  2MVU A;  3OW2 O;  5HGM A;  4F37 A;  1YJN P;  2KGA A;  2JB0 A;  1M6N A;  1EIA A;  1A8O A;  1VQ8 P;  2E1M A;  3MGE A;  3G0V A;  3DS4 A;  2AVA A;  1A43 A;  2VSQ A;  4XFY A;  1JJ2 O;  5HV8 A;  3G21 A;  3CCE P;  2OAR A;  5DCK A;  3CCS P;  1QVF O;  2KOD A;  2Z46 A;  2ROQ A;  1RO0 A;  3NTE A;  1EMV A;  2L22 A;  3CC4 P;  2PEO A;  1Q81 Q;  2FVE A;  1L0I A;  2FAE A;  3CCQ P;  2KOS A;  1VQ5 P;  1YHQ P;  1AYI A;  1GXG A;  2ERH A;  1YI2 P;  2WPT A;  1ZMB A;  2GDY A;  1HY8 A;  2PEN A;  3E2D A;  2K5X A;  3CPW O;  5F2N A;  2M8L A;  2JQ4 A; 
#chains in the Genus database with same CATH homology
 1FR2 A;  4QKO A;  1MZ8 A;  2GZI A;  2VLQ A;  2VLP A;  2JB0 A;  1UJZ A;  4UHP B;  2JAZ A;  1GXH A;  1IMQ A;  7CEI A;  2GZG A;  1AYI A;  1BXI A;  1GXG A;  2ERH A;  1IMP A;  2GZJ A;  2WPT A;  1ZNV A;  2VLN A;  3U43 A;  5EW5 E;  2GZE A;  1UNK A;  2K0D X;  2K5X A;  4F37 A;  3GJN A;  1CEI A;  2JBG A;  2GYK A;  3GKL C;  1E0H A;  2NO8 A;  2GZF A;  1EMV A;  2VLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...