1GXHA

Colicin e8 dnase immunity protein: im8
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
85
structure length
85
Chain Sequence
MELKNSISDYTETEFKKIIEDIINCEGDEKKQDDNLEHFISVTEHPSGSDLIYYPEGNNDGSPEAVIKEIKEWRAANGKSGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Non-Cognate Protein-Protein Interaction: The NMR Structure of the Colicin E8 Inhibitor Protein Im8 and its Interaction with the DNase Domain of Colicin E9
rcsb
molecule keywords COLICIN E8 IMMUNITY PROTEIN
molecule tags Inhibitor
source organism Escherichia coli
total genus 32
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2002-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1gxhA00
2VLPA 1MZ8A 3U43A 1CEIA 1FR2A 2K0DX 1EMVA 1IMPA 4F37A 2JBGA 3GKLC 2GYKA 4QKOA 4UHPB 2NO8A 1ZNVA 2VLQA 1AYIA 3GJNA 2GZEA 2JAZA 2K5XA 5EW5E 2GZFA 2WPTA 1UNKA 1IMQA 1UJZA 2GZIA 2GZGA 2GZJA 1GXHA 7CEIA 2ERHA 1E0HA 1BXIA 2VLOA 2VLNA 2JB0A 1GXGA
chains in the Genus database with same CATH superfamily
2EIAA 2DNWA 4UHPB 4PH0A 3CC2P 2KORA 5KP8B 2OARA 2L9FA 4PXHB 1NQ4A 1E0HA 2K93A 2XT1A 5F2KA 2XXMA 3B5IA 1FR2A 1VQ8P 3M1MA 4XRQA 5JPAA 3CCMP 1DV5A 5KP6B 2LKIA 2MVUA 1ZNVA 2LIUA 1L0IA 1Q7YQ 2FVFA 2PEMA 3Q20A 1IMQA 2M8LA 3CCLP 1VQ6P 2FACA 4COCA 4U0FA 4NEOA 3G1IA 3DS0A 4U0BA 5KP7B 3CC4P 3CXCO 3DS3A 3GKLC 1EIAA 2MY5A 1YITP 5EJDA 5EW5E 2N5HA 4H2WC 4H2XC 1A43A 3CCVP 1BAJA 3OW2O 2L22A 3CCEP 3CCQP 1VQNP 2ROQA 1MZ8A 2FQ0A 5HVCA 2KGDA 1IMPA 1EMVA 1M6EX 3G29A 3CPWO 4QNBA 2L6EA 1K8AQ 2M8NA 1RO0A 2EG5A 1UJZA 1Q82Q 2ERHA 3EJBA 2LTEA 1Q81Q 2K0XA 1ACPA 1VQ5P 3CC7P 2BUOA 2JBGA 3EJDA 4XFYA 2KOSA 2PNGA 2GYKA 2GDXA 3NTEA 3CD6P 1M6NA 3MGEA 5HGNA 2Z45A 1N8RQ 1YI2P 3CMAP 2KGEA 2KG6A 1NJIQ 2PEOA 2VLNA 1VQPP 3DTJA 4U0AA 1W2BO 3HYBA 4MRTC 3VRLC 1IUQA 1M1KQ 5F2OA 3G0VA 2XV6A 2GZEA 2LL8A 3RG2A 2JYGA 2FADA 2LIWA 4XROA 3NY7B 3I56P 3DS5A 4U0EA 3B4QA 3H0DA 3CCSP 2KODA 4PH1A 3H47A 2DGYA 2JU2A 2MR7A 1RO2A 1GPJA 3HZQA 2Z46A 2K5XA 1E6JP 4IPYA 2KG9A 3I55P 5HGLA 2CWOA 2P9XA 5I4TG 2OTLP 2PEKA 3G1GA 2FQ1A 3GJNA 2KR5A 3DS2A 2KWLA 2AFDA 2JQ4A 2MF4A 1QVGO 2EFJA 3G71P 1AUMA 2VLOA 1VQLP 3P05A 2KW2A 3G21A 4DG9A 2MR8A 1S72P 3GZMA 1KQSO 2PEQA 1VQMP 4XFXA 1M74A 2GDYA 1Z6MA 2LOLA 1KD1Q 2VSQA 4CA3A 2QA4P 4R0MA 1VQKP 2AFEA 2X2BA 2EHSA 4BPGA 3H4EA 5DCKA 3G6EP 5HGOA 4IZ6A 2KOOA 5BS1A 2BHVA 2CG5B 2M8PA 2LPKA 3CCJP 1YIJP 2LF4A 2GZFA 2GZIA 2K94A 1GXHA 1VKUA 2JB0A 3CMEP 4U0DA 1QVFO 2LMLA 2K0YA 3G28A 2K0DX 3E2DA 2N50A 1HQBA 1F80D 2CGQA 3CE7A 3CCRP 1VQ4P 1VQ7P 2PENA 1D1DA 2KGCA 4HKGA 1KLPA 2FAEA 2GZJA 1K73Q 5HGMA 2N5IA 2FQ2A 2ONTA 1ZMBA 4WYMA 1K9MQ 1K30A 1JJ2O 1VQ9P 1CEIA 1A8OA 1AYIA 5BS2A 3DS1A 2JO0A 1DNYA 1VHNA 2PY8A 4XFZA 2AF8A 5HV8A 7CEIA 4F37A 2QNWA 2N6ZA 2KOPA 4PWVB 4BPFA 3GZLA 1YHQP 3WBHA 1EOQA 1OR5A 3LRYA 2WPTA 1YJNP 2EHTA 1KC8Q 1VQOP 4BPHA 3LMOA 2JU1A 2L4BA 2VLPA 2M5RA 2OTJP 2JGPA 4U0CA 2Z44A 4GR6A 4M0IA 5F2NA 2GZGA 1L0HA 2N98A 2KGAA 2MD9A 1QRJA 3DPHA 2E1MA 1YJ9P 4COPA 1X3OA 2QEXP 2KOQA 3G4SP 1YJWP 2VLQA 2FHSC 2JAZA 1Q86Q 2CNRA 2MVVA 2PEIA 2GDWA 1UNKA 2K92A 2FVEA 2XZ1C 1RNIA 2FVAA 3EJEA 3U43A 2KG8A 4H2YC 3G26A 2JYLA 4GR2A 4QKOA 2NO8A 2CQ8A 2K2QA 1AF8A 2XZ0D 3CCUP 1T8KA 1HY8A 1M90Q 2PEJA 5CZDB 2N6YA 2L0QA 3DS4A 1BXIA 2AVAA 1GXGA 3RG6C
chains in the Genus database with same CATH topology
2VLPA 1MZ8A 3U43A 1CEIA 1FR2A 2K0DX 1EMVA 1IMPA 4F37A 2JBGA 3GKLC 2GYKA 4QKOA 4UHPB 2NO8A 1ZNVA 2VLQA 1AYIA 3GJNA 2GZEA 2JAZA 2K5XA 5EW5E 2GZFA 2WPTA 1UNKA 1IMQA 1UJZA 2GZIA 2GZGA 2GZJA 1GXHA 7CEIA 2ERHA 1E0HA 1BXIA 2VLOA 2VLNA 2JB0A 1GXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLP A;  1MZ8 A;  3U43 A;  1CEI A;  1FR2 A;  2K0D X;  1EMV A;  1IMP A;  4F37 A;  2JBG A;  3GKL C;  2GYK A;  4QKO A;  4UHP B;  2NO8 A;  1ZNV A;  2VLQ A;  1AYI A;  3GJN A;  2GZE A;  2JAZ A;  2K5X A;  5EW5 E;  2GZF A;  2WPT A;  1UNK A;  1IMQ A;  1UJZ A;  2GZI A;  2GZG A;  2GZJ A;  1GXH A;  7CEI A;  2ERH A;  1E0H A;  1BXI A;  2VLO A;  2VLN A;  2JB0 A;  1GXG A; 
#chains in the Genus database with same CATH topology
 2EIA A;  2DNW A;  4UHP B;  4PH0 A;  3CC2 P;  2KOR A;  5KP8 B;  2OAR A;  2L9F A;  4PXH B;  1NQ4 A;  1E0H A;  2K93 A;  2XT1 A;  5F2K A;  2XXM A;  3B5I A;  1FR2 A;  1VQ8 P;  3M1M A;  4XRQ A;  5JPA A;  3CCM P;  1DV5 A;  5KP6 B;  2LKI A;  2MVU A;  1ZNV A;  2LIU A;  1L0I A;  1Q7Y Q;  2FVF A;  2PEM A;  3Q20 A;  1IMQ A;  2M8L A;  3CCL P;  1VQ6 P;  2FAC A;  4COC A;  4U0F A;  4NEO A;  3G1I A;  3DS0 A;  4U0B A;  5KP7 B;  3CC4 P;  3CXC O;  3DS3 A;  3GKL C;  1EIA A;  2MY5 A;  1YIT P;  5EJD A;  5EW5 E;  2N5H A;  4H2W C;  4H2X C;  1A43 A;  3CCV P;  1BAJ A;  3OW2 O;  2L22 A;  3CCE P;  3CCQ P;  1VQN P;  2ROQ A;  1MZ8 A;  2FQ0 A;  5HVC A;  2KGD A;  1IMP A;  1EMV A;  1M6E X;  3G29 A;  3CPW O;  4QNB A;  2L6E A;  1K8A Q;  2M8N A;  1RO0 A;  2EG5 A;  1UJZ A;  1Q82 Q;  2ERH A;  3EJB A;  2LTE A;  1Q81 Q;  2K0X A;  1ACP A;  1VQ5 P;  3CC7 P;  2BUO A;  2JBG A;  3EJD A;  4XFY A;  2KOS A;  2PNG A;  2GYK A;  2GDX A;  3NTE A;  3CD6 P;  1M6N A;  3MGE A;  5HGN A;  2Z45 A;  1N8R Q;  1YI2 P;  3CMA P;  2KGE A;  2KG6 A;  1NJI Q;  2PEO A;  2VLN A;  1VQP P;  3DTJ A;  4U0A A;  1W2B O;  3HYB A;  4MRT C;  3VRL C;  1IUQ A;  1M1K Q;  5F2O A;  3G0V A;  2XV6 A;  2GZE A;  2LL8 A;  3RG2 A;  2JYG A;  2FAD A;  2LIW A;  4XRO A;  3NY7 B;  3I56 P;  3DS5 A;  4U0E A;  3B4Q A;  3H0D A;  3CCS P;  2KOD A;  4PH1 A;  3H47 A;  2DGY A;  2JU2 A;  2MR7 A;  1RO2 A;  1GPJ A;  3HZQ A;  2Z46 A;  2K5X A;  1E6J P;  4IPY A;  2KG9 A;  3I55 P;  5HGL A;  2CWO A;  2P9X A;  5I4T G;  2OTL P;  2PEK A;  3G1G A;  2FQ1 A;  3GJN A;  2KR5 A;  3DS2 A;  2KWL A;  2AFD A;  2JQ4 A;  2MF4 A;  1QVG O;  2EFJ A;  3G71 P;  1AUM A;  2VLO A;  1VQL P;  3P05 A;  2KW2 A;  3G21 A;  4DG9 A;  2MR8 A;  1S72 P;  3GZM A;  1KQS O;  2PEQ A;  1VQM P;  4XFX A;  1M74 A;  2GDY A;  1Z6M A;  2LOL A;  1KD1 Q;  2VSQ A;  4CA3 A;  2QA4 P;  4R0M A;  1VQK P;  2AFE A;  2X2B A;  2EHS A;  4BPG A;  3H4E A;  5DCK A;  3G6E P;  5HGO A;  4IZ6 A;  2KOO A;  5BS1 A;  2BHV A;  2CG5 B;  2M8P A;  2LPK A;  3CCJ P;  1YIJ P;  2LF4 A;  2GZF A;  2GZI A;  2K94 A;  1GXH A;  1VKU A;  2JB0 A;  3CME P;  4U0D A;  1QVF O;  2LML A;  2K0Y A;  3G28 A;  2K0D X;  3E2D A;  2N50 A;  1HQB A;  1F80 D;  2CGQ A;  3CE7 A;  3CCR P;  1VQ4 P;  1VQ7 P;  2PEN A;  1D1D A;  2KGC A;  4HKG A;  1KLP A;  2FAE A;  2GZJ A;  1K73 Q;  5HGM A;  2N5I A;  2FQ2 A;  2ONT A;  1ZMB A;  4WYM A;  1K9M Q;  1K30 A;  1JJ2 O;  1VQ9 P;  1CEI A;  1A8O A;  1AYI A;  5BS2 A;  3DS1 A;  2JO0 A;  1DNY A;  1VHN A;  2PY8 A;  4XFZ A;  2AF8 A;  5HV8 A;  7CEI A;  4F37 A;  2QNW A;  2N6Z A;  2KOP A;  4PWV B;  4BPF A;  3GZL A;  1YHQ P;  3WBH A;  1EOQ A;  1OR5 A;  3LRY A;  2WPT A;  1YJN P;  2EHT A;  1KC8 Q;  1VQO P;  4BPH A;  3LMO A;  2JU1 A;  2L4B A;  2VLP A;  2M5R A;  2OTJ P;  2JGP A;  4U0C A;  2Z44 A;  4GR6 A;  4M0I A;  5F2N A;  2GZG A;  1L0H A;  2N98 A;  2KGA A;  2MD9 A;  1QRJ A;  3DPH A;  2E1M A;  1YJ9 P;  4COP A;  1X3O A;  2QEX P;  2KOQ A;  3G4S P;  1YJW P;  2VLQ A;  2FHS C;  2JAZ A;  1Q86 Q;  2CNR A;  2MVV A;  2PEI A;  2GDW A;  1UNK A;  2K92 A;  2FVE A;  2XZ1 C;  1RNI A;  2FVA A;  3EJE A;  3U43 A;  2KG8 A;  4H2Y C;  3G26 A;  2JYL A;  4GR2 A;  4QKO A;  2NO8 A;  2CQ8 A;  2K2Q A;  1AF8 A;  2XZ0 D;  3CCU P;  1T8K A;  1HY8 A;  1M90 Q;  2PEJ A;  5CZD B;  2N6Y A;  2L0Q A;  3DS4 A;  1BXI A;  2AVA A;  1GXG A;  3RG6 C; 
#chains in the Genus database with same CATH homology
 2VLP A;  1MZ8 A;  3U43 A;  1CEI A;  1FR2 A;  2K0D X;  1EMV A;  1IMP A;  4F37 A;  2JBG A;  3GKL C;  2GYK A;  4QKO A;  4UHP B;  2NO8 A;  1ZNV A;  2VLQ A;  1AYI A;  3GJN A;  2GZE A;  2JAZ A;  2K5X A;  5EW5 E;  2GZF A;  2WPT A;  1UNK A;  1IMQ A;  1UJZ A;  2GZI A;  2GZG A;  2GZJ A;  1GXH A;  7CEI A;  2ERH A;  1E0H A;  1BXI A;  2VLO A;  2VLN A;  2JB0 A;  1GXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...