2BUOA

Hiv-1 capsid c-terminal domain in complex with an inhibitor of particle assembly
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
84
structure length
84
Chain Sequence
PTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein/peptide
molecule keywords HIV-1 CAPSID PROTEIN
publication title The HIV-1 Capsid Protein C-Terminal Domain in Complex with a Virus Assembly Inhibitor
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 28
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2buoA00
2L6EA 3DS5A 2JYGA 3DS4A 3DS0A 2KODA 3DS3A 4U0BA 4WYMA 3DPHA 3NTEA 1AUMA 4U0FA 4XFZA 4PH0A 5I4TG 3LRYA 5HGOA 3G1GA 2M8LA 2XV6A 1BAJA 3G26A 5HGNA 1E6JP 4COCA 4XFYA 1A8OA 3P05A 4XRQA 3VRLC 1QRJA 4COPA 3H47A 4QNBA 2JYLA 2ONTA 3G0VA 2M8PA 3G28A 2XT1A 3H4EA 5HGLA 3MGEA 2M8NA 3G29A 1EIAA 2LF4A 1A43A 2XXMA 4M0IA 4U0EA 4U0AA 3G1IA 4PH1A 4XROA 5DCKA 5HGMA 1D1DA 1EOQA 3G21A 5JPAA 2BUOA 2JO0A 4XFXA 2EIAA 4IPYA 4U0DA 3DS2A 4U0CA 3DTJA 3DS1A
chains in the Genus database with same CATH superfamily
4UHPB 3WBHA 1DV5A 2DNWA 1VQNP 5EW5E 3CCMP 2EHSA 2EFJA 5F2KA 1VQ4P 3G71P 4XFYA 1VQ5P 3VRLC 1GXHA 3RG6C 2XZ1C 2XT1A 1VKUA 2ROQA 3G1IA 3CCRP 1D1DA 3I56P 3DS4A 2MR8A 1AUMA 1M90Q 3G1GA 2WPTA 2MVVA 2N6YA 3G26A 3CMEP 2MVUA 3G29A 3CC4P 2FVAA 1X3OA 1YHQP 3DTJA 2P9XA 2M5RA 2KOOA 3DS0A 2LL8A 3DPHA 1T8KA 3NTEA 4PH0A 2CNRA 2N5HA 4BPHA 1A8OA 2KR5A 3M1MA 1M74A 2L22A 1GXGA 2K0DX 2JB0A 3GZLA 2E1MA 2CGQA 1M6EX 1ZMBA 1L0IA 5KP7B 2MY5A 2GDYA 2PEJA 5I4TG 2XV6A 1BAJA 1IMQA 3EJEA 3CCEP 2GZIA 2Z45A 4MRTC 4HKGA 4PXHB 2XXMA 2MR7A 4XROA 5HGMA 1YJNP 2PEQA 3GKLC 4U0CA 5CZDB 4BPFA 4CA3A 3HYBA 2JAZA 1M1KQ 2ERHA 3GJNA 2M8LA 2KOQA 1E6JP 4COCA 2FAEA 2L4BA 3G28A 1RO0A 1OR5A 2GDWA 5KP8B 3CXCO 3CCVP 2KG6A 4PH1A 2VLPA 3G21A 1Q82Q 3OW2O 1QVFO 2OARA 1YIJP 2L6EA 4NEOA 2K5XA 3U43A 5HVCA 1EMVA 2FVFA 2AFEA 2KG8A 2FACA 2KW2A 1ZNVA 2KGDA 3H47A 1MZ8A 4QKOA 2OTJP 3G6EP 1KD1Q 1Z6MA 1K8AQ 4GR2A 1DNYA 2KGCA 2EIAA 1VQ7P 3CE7A 2JGPA 1KQSO 2EG5A 2KODA 4WYMA 2K0YA 3CPWO 5HGOA 2KOSA 2LKIA 2JYLA 2VSQA 3B4QA 4U0EA 1IMPA 3DS2A 1RO2A 3HZQA 2L0QA 2MD9A 4BPGA 2LIWA 1YJWP 2KWLA 4QNBA 1Q81Q 2GZGA 2JBGA 2PNGA 2CWOA 1S72P 2MF4A 1UJZA 2XZ0D 4R0MA 2FQ1A 1AF8A 1N8RQ 3CCSP 1AYIA 1VQLP 3P05A 1W2BO 2BHVA 1VQKP 3G0VA 2FHSC 2KOPA 5BS1A 2K0XA 2BUOA 1YJ9P 2OTLP 1CEIA 2K92A 4U0DA 1KLPA 2LMLA 1RNIA 2LPKA 1KC8Q 1QVGO 1UNKA 2LTEA 3GZMA 1YITP 4U0FA 3H0DA 3CCUP 1VQ8P 2Z44A 3CC7P 2LOLA 3LMOA 5BS2A 1QRJA 3Q20A 1VHNA 3CMAP 4H2WC 2M8PA 2LF4A 3G4SP 5HV8A 1EOQA 1JJ2O 1NQ4A 4DG9A 2GDXA 4XFZA 1Q86Q 4PWVB 3E2DA 5KP6B 2FVEA 2AVAA 2CG5B 2ONTA 2QA4P 1K9MQ 1EIAA 1A43A 2PEOA 5JPAA 2K94A 4IPYA 3DS1A 2N5IA 2X2BA 2JYGA 3EJBA 2JU1A 3CCQP 1ACPA 1K30A 3EJDA 2QNWA 3CC2P 4M0IA 3B5IA 2FQ0A 2CQ8A 1E0HA 2N6ZA 1M6NA 1BXIA 2JU2A 2KG9A 2N98A 3DS3A 1YI2P 4GR6A 3LRYA 7CEIA 2PY8A 3NY7B 2QEXP 5F2OA 3H4EA 3MGEA 4U0AA 1K73Q 2PEKA 2K2QA 2VLOA 2DGYA 5EJDA 2EHTA 2GZJA 4U0BA 1Q7YQ 1HY8A 5F2NA 2GYKA 4H2YC 2KGEA 2PEMA 1FR2A 2N50A 5HGLA 2FADA 2AF8A 3I55P 2FQ2A 2LIUA 2K93A 2NO8A 2KGAA 2KORA 2Z46A 1HQBA 1VQ9P 3RG2A 3CCLP 2L9FA 1L0HA 5HGNA 1F80D 4COPA 2VLQA 1IUQA 2GZFA 2M8NA 1NJIQ 2PENA 5DCKA 2JO0A 4IZ6A 2JQ4A 3DS5A 2PEIA 1GPJA 1VQPP 4H2XC 2AFDA 3CCJP 1VQ6P 3CD6P 4XRQA 2GZEA 2VLNA 4XFXA 1VQMP 4F37A 1VQOP
chains in the Genus database with same CATH topology
3WBHA 3DS3A 1YI2P 1VQNP 3HYBA 4GR6A 3CCMP 1M1KQ 1N8RQ 3LRYA 3CCSP 2M8LA 2EFJA 5F2KA 1VQ4P 2PY8A 1VQLP 3G71P 1E6JP 4COCA 4XFYA 3P05A 3VRLC 1VQ5P 1W2BO 2BHVA 3RG6C 1VQKP 2QEXP 3G0VA 3G28A 1RO0A 5F2OA 2XT1A 3H4EA 3MGEA 3CXCO 3CCVP 4U0AA 5BS1A 1K73Q 2PEKA 3G1IA 4PH1A 3CCRP 1D1DA 3G21A 2BUOA 1Q82Q 3I56P 3OW2O 1YJ9P 2OTLP 4U0DA 1QVFO 2OARA 1YIJP 2L6EA 2DGYA 1RNIA 1KC8Q 3DS4A 1QVGO 4U0BA 1YITP 1AUMA 4U0FA 1M90Q 3H0DA 1Q7YQ 5F2NA 3CCUP 3G1GA 1VQ8P 2Z44A 3CC7P 3G26A 5BS2A 1QRJA 3H47A 3Q20A 2PEMA 3CMAP 3CMEP 2OTJP 2M8PA 3G6EP 1KD1Q 5HGLA 3G29A 1K8AQ 2LF4A 4GR2A 3I55P 3G4SP 3CC4P 1EOQA 1JJ2O 2EIAA 2Z46A 1YHQP 1VQ7P 1VQ9P 3DTJA 2P9XA 1KQSO 2EG5A 3CCLP 3DS0A 2KODA 4WYMA 3DPHA 3NTEA 4XFZA 4PH0A 3CPWO 5HGOA 1Q86Q 3E2DA 5HGNA 1A8OA 4COPA 2JYLA 3M1MA 1IUQA 2ONTA 1M74A 2QA4P 1K9MQ 2M8NA 1EIAA 1A43A 2PEOA 4U0EA 1NJIQ 2PENA 5DCKA 5JPAA 2JO0A 2E1MA 1M6EX 4IPYA 3DS2A 1ZMBA 3DS1A 1RO2A 3DS5A 2JYGA 2PEIA 3CCQP 3HZQA 1VQPP 2PEJA 5I4TG 2XV6A 3CCJP 1VQ6P 1BAJA 1K30A 3CD6P 3CCEP 1YJWP 4XRQA 2Z45A 4QNBA 3CC2P 1Q81Q 4M0IA 2XXMA 3B5IA 4XROA 5HGMA 1YJNP 4XFXA 1VQMP 2PEQA 1M6NA 2CWOA 1S72P 4U0CA 1VQOP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6E A;  3DS5 A;  2JYG A;  3DS4 A;  3DS0 A;  2KOD A;  3DS3 A;  4U0B A;  4WYM A;  3DPH A;  3NTE A;  1AUM A;  4U0F A;  4XFZ A;  4PH0 A;  5I4T G;  3LRY A;  5HGO A;  3G1G A;  2M8L A;  2XV6 A;  1BAJ A;  3G26 A;  5HGN A;  1E6J P;  4COC A;  4XFY A;  1A8O A;  3P05 A;  4XRQ A;  3VRL C;  1QRJ A;  4COP A;  3H47 A;  4QNB A;  2JYL A;  2ONT A;  3G0V A;  2M8P A;  3G28 A;  2XT1 A;  3H4E A;  5HGL A;  3MGE A;  2M8N A;  3G29 A;  1EIA A;  2LF4 A;  1A43 A;  2XXM A;  4M0I A;  4U0E A;  4U0A A;  3G1I A;  4PH1 A;  4XRO A;  5DCK A;  5HGM A;  1D1D A;  1EOQ A;  3G21 A;  5JPA A;  2BUO A;  2JO0 A;  4XFX A;  2EIA A;  4IPY A;  4U0D A;  3DS2 A;  4U0C A;  3DTJ A;  3DS1 A; 
#chains in the Genus database with same CATH topology
 4UHP B;  3WBH A;  1DV5 A;  2DNW A;  1VQN P;  5EW5 E;  3CCM P;  2EHS A;  2EFJ A;  5F2K A;  1VQ4 P;  3G71 P;  4XFY A;  1VQ5 P;  3VRL C;  1GXH A;  3RG6 C;  2XZ1 C;  2XT1 A;  1VKU A;  2ROQ A;  3G1I A;  3CCR P;  1D1D A;  3I56 P;  3DS4 A;  2MR8 A;  1AUM A;  1M90 Q;  3G1G A;  2WPT A;  2MVV A;  2N6Y A;  3G26 A;  3CME P;  2MVU A;  3G29 A;  3CC4 P;  2FVA A;  1X3O A;  1YHQ P;  3DTJ A;  2P9X A;  2M5R A;  2KOO A;  3DS0 A;  2LL8 A;  3DPH A;  1T8K A;  3NTE A;  4PH0 A;  2CNR A;  2N5H A;  4BPH A;  1A8O A;  2KR5 A;  3M1M A;  1M74 A;  2L22 A;  1GXG A;  2K0D X;  2JB0 A;  3GZL A;  2E1M A;  2CGQ A;  1M6E X;  1ZMB A;  1L0I A;  5KP7 B;  2MY5 A;  2GDY A;  2PEJ A;  5I4T G;  2XV6 A;  1BAJ A;  1IMQ A;  3EJE A;  3CCE P;  2GZI A;  2Z45 A;  4MRT C;  4HKG A;  4PXH B;  2XXM A;  2MR7 A;  4XRO A;  5HGM A;  1YJN P;  2PEQ A;  3GKL C;  4U0C A;  5CZD B;  4BPF A;  4CA3 A;  3HYB A;  2JAZ A;  1M1K Q;  2ERH A;  3GJN A;  2M8L A;  2KOQ A;  1E6J P;  4COC A;  2FAE A;  2L4B A;  3G28 A;  1RO0 A;  1OR5 A;  2GDW A;  5KP8 B;  3CXC O;  3CCV P;  2KG6 A;  4PH1 A;  2VLP A;  3G21 A;  1Q82 Q;  3OW2 O;  1QVF O;  2OAR A;  1YIJ P;  2L6E A;  4NEO A;  2K5X A;  3U43 A;  5HVC A;  1EMV A;  2FVF A;  2AFE A;  2KG8 A;  2FAC A;  2KW2 A;  1ZNV A;  2KGD A;  3H47 A;  1MZ8 A;  4QKO A;  2OTJ P;  3G6E P;  1KD1 Q;  1Z6M A;  1K8A Q;  4GR2 A;  1DNY A;  2KGC A;  2EIA A;  1VQ7 P;  3CE7 A;  2JGP A;  1KQS O;  2EG5 A;  2KOD A;  4WYM A;  2K0Y A;  3CPW O;  5HGO A;  2KOS A;  2LKI A;  2JYL A;  2VSQ A;  3B4Q A;  4U0E A;  1IMP A;  3DS2 A;  1RO2 A;  3HZQ A;  2L0Q A;  2MD9 A;  4BPG A;  2LIW A;  1YJW P;  2KWL A;  4QNB A;  1Q81 Q;  2GZG A;  2JBG A;  2PNG A;  2CWO A;  1S72 P;  2MF4 A;  1UJZ A;  2XZ0 D;  4R0M A;  2FQ1 A;  1AF8 A;  1N8R Q;  3CCS P;  1AYI A;  1VQL P;  3P05 A;  1W2B O;  2BHV A;  1VQK P;  3G0V A;  2FHS C;  2KOP A;  5BS1 A;  2K0X A;  2BUO A;  1YJ9 P;  2OTL P;  1CEI A;  2K92 A;  4U0D A;  1KLP A;  2LML A;  1RNI A;  2LPK A;  1KC8 Q;  1QVG O;  1UNK A;  2LTE A;  3GZM A;  1YIT P;  4U0F A;  3H0D A;  3CCU P;  1VQ8 P;  2Z44 A;  3CC7 P;  2LOL A;  3LMO A;  5BS2 A;  1QRJ A;  3Q20 A;  1VHN A;  3CMA P;  4H2W C;  2M8P A;  2LF4 A;  3G4S P;  5HV8 A;  1EOQ A;  1JJ2 O;  1NQ4 A;  4DG9 A;  2GDX A;  4XFZ A;  1Q86 Q;  4PWV B;  3E2D A;  5KP6 B;  2FVE A;  2AVA A;  2CG5 B;  2ONT A;  2QA4 P;  1K9M Q;  1EIA A;  1A43 A;  2PEO A;  5JPA A;  2K94 A;  4IPY A;  3DS1 A;  2N5I A;  2X2B A;  2JYG A;  3EJB A;  2JU1 A;  3CCQ P;  1ACP A;  1K30 A;  3EJD A;  2QNW A;  3CC2 P;  4M0I A;  3B5I A;  2FQ0 A;  2CQ8 A;  1E0H A;  2N6Z A;  1M6N A;  1BXI A;  2JU2 A;  2KG9 A;  2N98 A;  3DS3 A;  1YI2 P;  4GR6 A;  3LRY A;  7CEI A;  2PY8 A;  3NY7 B;  2QEX P;  5F2O A;  3H4E A;  3MGE A;  4U0A A;  1K73 Q;  2PEK A;  2K2Q A;  2VLO A;  2DGY A;  5EJD A;  2EHT A;  2GZJ A;  4U0B A;  1Q7Y Q;  1HY8 A;  5F2N A;  2GYK A;  4H2Y C;  2KGE A;  2PEM A;  1FR2 A;  2N50 A;  5HGL A;  2FAD A;  2AF8 A;  3I55 P;  2FQ2 A;  2LIU A;  2K93 A;  2NO8 A;  2KGA A;  2KOR A;  2Z46 A;  1HQB A;  1VQ9 P;  3RG2 A;  3CCL P;  2L9F A;  1L0H A;  5HGN A;  1F80 D;  4COP A;  2VLQ A;  1IUQ A;  2GZF A;  2M8N A;  1NJI Q;  2PEN A;  5DCK A;  2JO0 A;  4IZ6 A;  2JQ4 A;  3DS5 A;  2PEI A;  1GPJ A;  1VQP P;  4H2X C;  2AFD A;  3CCJ P;  1VQ6 P;  3CD6 P;  4XRQ A;  2GZE A;  2VLN A;  4XFX A;  1VQM P;  4F37 A;  1VQO P; 
#chains in the Genus database with same CATH homology
 3WBH A;  3DS3 A;  1YI2 P;  1VQN P;  3HYB A;  4GR6 A;  3CCM P;  1M1K Q;  1N8R Q;  3LRY A;  3CCS P;  2M8L A;  2EFJ A;  5F2K A;  1VQ4 P;  2PY8 A;  1VQL P;  3G71 P;  1E6J P;  4COC A;  4XFY A;  3P05 A;  3VRL C;  1VQ5 P;  1W2B O;  2BHV A;  3RG6 C;  1VQK P;  2QEX P;  3G0V A;  3G28 A;  1RO0 A;  5F2O A;  2XT1 A;  3H4E A;  3MGE A;  3CXC O;  3CCV P;  4U0A A;  5BS1 A;  1K73 Q;  2PEK A;  3G1I A;  4PH1 A;  3CCR P;  1D1D A;  3G21 A;  2BUO A;  1Q82 Q;  3I56 P;  3OW2 O;  1YJ9 P;  2OTL P;  4U0D A;  1QVF O;  2OAR A;  1YIJ P;  2L6E A;  2DGY A;  1RNI A;  1KC8 Q;  3DS4 A;  1QVG O;  4U0B A;  1YIT P;  1AUM A;  4U0F A;  1M90 Q;  3H0D A;  1Q7Y Q;  5F2N A;  3CCU P;  3G1G A;  1VQ8 P;  2Z44 A;  3CC7 P;  3G26 A;  5BS2 A;  1QRJ A;  3H47 A;  3Q20 A;  2PEM A;  3CMA P;  3CME P;  2OTJ P;  2M8P A;  3G6E P;  1KD1 Q;  5HGL A;  3G29 A;  1K8A Q;  2LF4 A;  4GR2 A;  3I55 P;  3G4S P;  3CC4 P;  1EOQ A;  1JJ2 O;  2EIA A;  2Z46 A;  1YHQ P;  1VQ7 P;  1VQ9 P;  3DTJ A;  2P9X A;  1KQS O;  2EG5 A;  3CCL P;  3DS0 A;  2KOD A;  4WYM A;  3DPH A;  3NTE A;  4XFZ A;  4PH0 A;  3CPW O;  5HGO A;  1Q86 Q;  3E2D A;  5HGN A;  1A8O A;  4COP A;  2JYL A;  3M1M A;  1IUQ A;  2ONT A;  1M74 A;  2QA4 P;  1K9M Q;  2M8N A;  1EIA A;  1A43 A;  2PEO A;  4U0E A;  1NJI Q;  2PEN A;  5DCK A;  5JPA A;  2JO0 A;  2E1M A;  1M6E X;  4IPY A;  3DS2 A;  1ZMB A;  3DS1 A;  1RO2 A;  3DS5 A;  2JYG A;  2PEI A;  3CCQ P;  3HZQ A;  1VQP P;  2PEJ A;  5I4T G;  2XV6 A;  3CCJ P;  1VQ6 P;  1BAJ A;  1K30 A;  3CD6 P;  3CCE P;  1YJW P;  4XRQ A;  2Z45 A;  4QNB A;  3CC2 P;  1Q81 Q;  4M0I A;  2XXM A;  3B5I A;  4XRO A;  5HGM A;  1YJN P;  4XFX A;  1VQM P;  2PEQ A;  1M6N A;  2CWO A;  1S72 P;  4U0C A;  1VQO P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...