2BUOA

Hiv-1 capsid c-terminal domain in complex with an inhibitor of particle assembly
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
84
structure length
84
Chain Sequence
PTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 CAPSID PROTEIN
publication title The HIV-1 Capsid Protein C-Terminal Domain in Complex with a Virus Assembly Inhibitor
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/peptide
total genus 28
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2buoA00
4XRQA 3G21A 3G28A 2LF4A 3DS0A 4U0BA 3DS5A 3H4EA 3LRYA 1D1DA 3DS2A 3DPHA 2L6EA 4COCA 2ONTA 2JO0A 3G0VA 5JPAA 5HGLA 1EOQA 2JYLA 4XROA 5HGMA 3VRLC 5HGOA 3P05A 1A43A 1QRJA 2XT1A 3G26A 3NTEA 3G1IA 1AUMA 4M0IA 4XFZA 4XFYA 5DCKA 5HGNA 2M8LA 2M8NA 4IPYA 4U0DA 2M8PA 3DS4A 3DTJA 1E6JP 4QNBA 2JYGA 2BUOA 3G29A 4XFXA 1BAJA 3DS1A 5I4TG 4U0EA 4PH0A 1A8OA 4COPA 3H47A 4U0CA 3MGEA 2XV6A 1EIAA 2XXMA 3DS3A 4PH1A 2EIAA 4U0FA 3G1GA 4U0AA 2KODA 4WYMA
chains in the Genus database with same CATH superfamily
2KOQA 3CXCO 5BS1A 4MRTC 1IUQA 5F2KA 2LL8A 4H2YC 1VQNP 4PWVB 5HV8A 1AUMA 2M8PA 3DTJA 2FHSC 1GXGA 2KW2A 2FACA 1OR5A 2PEIA 4HKGA 2GDWA 1DV5A 2BHVA 3DS0A 1NQ4A 2LIUA 2WPTA 2E1MA 2MD9A 3G6EP 3H4EA 3CC7P 2ONTA 1A43A 5HGNA 2K93A 2FQ0A 1UNKA 2EHSA 3CC2P 4U0CA 1EIAA 2GDYA 2KORA 3HZQA 1JJ2O 2Z45A 3B5IA 2N6YA 5HGMA 2Z46A 3G26A 1L0HA 1DNYA 2VSQA 1BAJA 4PH0A 1Z6MA 1YJ9P 3CCRP 1VQ7P 2MVVA 3DPHA 2KGAA 2N5HA 2K92A 2LOLA 2PEKA 3H0DA 3G71P 3NY7B 4GR6A 2Z44A 4F37A 1X3OA 3H47A 3GJNA 3CCJP 3CMAP 2EG5A 2AFEA 1VHNA 1YITP 2VLNA 2L22A 1M74A 5HGOA 3VRLC 2ERHA 4QNBA 1N8RQ 1KD1Q 1VQ6P 3CC4P 3DS1A 2XZ1C 5F2NA 2XV6A 1VQ5P 3CCSP 1VQKP 2FAEA 1E0HA 1VQMP 2KWLA 1D1DA 3WBHA 5KP7B 2LMLA 2CNRA 1YHQP 1Q81Q 3G1IA 4IPYA 2P9XA 2QNWA 2L4BA 2PEOA 2EHTA 4XFXA 2N98A 1VQPP 2FVEA 2EFJA 2PEMA 2DGYA 2LF4A 4U0BA 4BPGA 3DS5A 4COCA 2JAZA 2JO0A 2K0XA 2PY8A 1M90Q 1EOQA 1GPJA 1VQOP 3CCEP 3P05A 4XFZA 1RNIA 1W2BO 1A8OA 2L9FA 4PH1A 2FQ2A 4GR2A 1VQ9P 2K2QA 1YIJP 4U0AA 2KODA 1VQLP 4CA3A 2OTJP 5KP8B 2LIWA 3CCUP 1ZNVA 1UJZA 3U43A 3DS2A 5KP6B 1IMPA 1CEIA 2MY5A 5DCKA 1KC8Q 2MR8A 4DG9A 3DS4A 1M6NA 2JU1A 4PXHB 3I56P 2XXMA 2KGCA 1K73Q 1ACPA 3CMEP 3B4QA 3G4SP 2AF8A 4H2WC 3RG2A 2XT1A 1FR2A 2JU2A 2LTEA 4U0DA 3HYBA 3G29A 3CCQP 5HVCA 1AF8A 2FADA 4U0FA 2QA4P 4WYMA 2VLPA 2CQ8A 5HGLA 2PEQA 3OW2O 2JYLA 4XROA 1IMQA 1MZ8A 2JBGA 2N6ZA 1YJNP 2JYGA 2JQ4A 5F2OA 5I4TG 1QVFO 2K5XA 2FVAA 1HQBA 2LKIA 4R0MA 2GZIA 1YJWP 1RO0A 2L0QA 2GYKA 1QRJA 2KG8A 2M8NA 1M6EX 2MVUA 4BPHA 4H2XC 2PEJA 3GZMA 3EJEA 3DS3A 2EIAA 1YI2P 4NEOA 1Q7YQ 2K0YA 3LRYA 2L6EA 2JGPA 2LPKA 5JPAA 1AYIA 2PENA 3RG6C 2K0DX 4XFYA 3EJDA 2GZEA 1E6JP 3CPWO 2VLOA 1ZMBA 4BPFA 2FVFA 2CWOA 2PNGA 1QVGO 7CEIA 5BS2A 2AVAA 1VQ8P 1T8KA 2KG6A 3G0VA 2XZ0D 1K9MQ 2CGQA 2M8LA 3CCMP 2MF4A 2QEXP 2BUOA 1VQ4P 4U0EA 5EW5E 4COPA 2KOOA 2OARA 3EJBA 3G1GA 2KGEA 1KQSO 2N50A 2JB0A 3G28A 1BXIA 2AFDA 2GDXA 3CCVP 3E2DA 1K8AQ 1Q86Q 2N5IA 2FQ1A 4M0IA 2GZJA 2GZGA 3CD6P 3LMOA 1EMVA 2X2BA 2M5RA 2NO8A 1L0IA 1VKUA 4XRQA 3G21A 1HY8A 3M1MA 1M1KQ 3CE7A 1Q82Q 2KOPA 5CZDB 2MR7A 1GXHA 1S72P 1RO2A 2CG5B 3GKLC 3CCLP 3MGEA 2OTLP 2GZFA 5EJDA 2KR5A 3Q20A 4IZ6A 1K30A 3GZLA 2K94A 4UHPB 3NTEA 1KLPA 2DNWA 2KGDA 1NJIQ 3I55P 1F80D 2KG9A 4QKOA 2KOSA 2VLQA 2ROQA
chains in the Genus database with same CATH topology
3CCJP 3CXCO 3CMAP 1K73Q 5BS2A 5BS1A 2EG5A 1VQ8P 1IUQA 1YITP 3CMEP 3G4SP 3G0VA 1M74A 5F2KA 5HGOA 1VQNP 3VRLC 2XT1A 1K9MQ 1AUMA 2M8LA 4U0DA 2M8PA 3DTJA 3CCMP 4QNBA 3HYBA 2QEXP 1N8RQ 2BUOA 1KD1Q 1VQ6P 3G29A 3CC4P 2PEIA 3DS1A 1VQ4P 4U0EA 3CCQP 5F2NA 4COPA 2BHVA 2XV6A 4U0FA 2QA4P 3DS0A 2OARA 3CCSP 3G1GA 1VQ5P 1KQSO 1VQKP 4WYMA 3G28A 1VQMP 2E1MA 3G6EP 3H4EA 3CC7P 1D1DA 3WBHA 3CCVP 2ONTA 3E2DA 1K8AQ 5HGLA 2PEQA 3OW2O 2JYLA 4XROA 1YHQP 1Q86Q 1A43A 1Q81Q 5HGNA 3G1IA 4M0IA 4IPYA 2P9XA 1YJNP 2JYGA 2PEOA 3CD6P 4XFXA 5F2OA 5I4TG 1QVFO 3CC2P 4U0CA 1EIAA 1VQPP 4XRQA 3G21A 3M1MA 2EFJA 2PEMA 2DGYA 2LF4A 4U0BA 1YJWP 3DS5A 1RO0A 1M1KQ 3HZQA 1JJ2O 4COCA 1Q82Q 2JO0A 2Z45A 2PY8A 1M90Q 1EOQA 3B5IA 1VQOP 5HGMA 3CCEP 1S72P 2Z46A 3P05A 1RO2A 1QRJA 3G26A 4XFZA 1RNIA 2M8NA 1M6EX 3CCLP 2PEJA 1BAJA 1W2BO 4PH0A 1A8OA 3MGEA 3DS3A 4PH1A 2EIAA 4GR2A 1YIJP 1YI2P 4U0AA 1VQ9P 2KODA 1YJ9P 3CCRP 1VQLP 2OTJP 2OTLP 1Q7YQ 3CCUP 3Q20A 1VQ7P 3LRYA 3DS2A 1K30A 3DPHA 2L6EA 5JPAA 2PEKA 3H0DA 2PENA 3RG6C 3NTEA 5DCKA 1KC8Q 4XFYA 3G71P 3DS4A 4GR6A 1E6JP 1M6NA 2Z44A 3CPWO 1NJIQ 1ZMBA 3I55P 3I56P 3H47A 2CWOA 2XXMA 1QVGO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRQ A;  3G21 A;  3G28 A;  2LF4 A;  3DS0 A;  4U0B A;  3DS5 A;  3H4E A;  3LRY A;  1D1D A;  3DS2 A;  3DPH A;  2L6E A;  4COC A;  2ONT A;  2JO0 A;  3G0V A;  5JPA A;  5HGL A;  1EOQ A;  2JYL A;  4XRO A;  5HGM A;  3VRL C;  5HGO A;  3P05 A;  1A43 A;  1QRJ A;  2XT1 A;  3G26 A;  3NTE A;  3G1I A;  1AUM A;  4M0I A;  4XFZ A;  4XFY A;  5DCK A;  5HGN A;  2M8L A;  2M8N A;  4IPY A;  4U0D A;  2M8P A;  3DS4 A;  3DTJ A;  1E6J P;  4QNB A;  2JYG A;  2BUO A;  3G29 A;  4XFX A;  1BAJ A;  3DS1 A;  5I4T G;  4U0E A;  4PH0 A;  1A8O A;  4COP A;  3H47 A;  4U0C A;  3MGE A;  2XV6 A;  1EIA A;  2XXM A;  3DS3 A;  4PH1 A;  2EIA A;  4U0F A;  3G1G A;  4U0A A;  2KOD A;  4WYM A; 
#chains in the Genus database with same CATH topology
 2KOQ A;  3CXC O;  5BS1 A;  4MRT C;  1IUQ A;  5F2K A;  2LL8 A;  4H2Y C;  1VQN P;  4PWV B;  5HV8 A;  1AUM A;  2M8P A;  3DTJ A;  2FHS C;  1GXG A;  2KW2 A;  2FAC A;  1OR5 A;  2PEI A;  4HKG A;  2GDW A;  1DV5 A;  2BHV A;  3DS0 A;  1NQ4 A;  2LIU A;  2WPT A;  2E1M A;  2MD9 A;  3G6E P;  3H4E A;  3CC7 P;  2ONT A;  1A43 A;  5HGN A;  2K93 A;  2FQ0 A;  1UNK A;  2EHS A;  3CC2 P;  4U0C A;  1EIA A;  2GDY A;  2KOR A;  3HZQ A;  1JJ2 O;  2Z45 A;  3B5I A;  2N6Y A;  5HGM A;  2Z46 A;  3G26 A;  1L0H A;  1DNY A;  2VSQ A;  1BAJ A;  4PH0 A;  1Z6M A;  1YJ9 P;  3CCR P;  1VQ7 P;  2MVV A;  3DPH A;  2KGA A;  2N5H A;  2K92 A;  2LOL A;  2PEK A;  3H0D A;  3G71 P;  3NY7 B;  4GR6 A;  2Z44 A;  4F37 A;  1X3O A;  3H47 A;  3GJN A;  3CCJ P;  3CMA P;  2EG5 A;  2AFE A;  1VHN A;  1YIT P;  2VLN A;  2L22 A;  1M74 A;  5HGO A;  3VRL C;  2ERH A;  4QNB A;  1N8R Q;  1KD1 Q;  1VQ6 P;  3CC4 P;  3DS1 A;  2XZ1 C;  5F2N A;  2XV6 A;  1VQ5 P;  3CCS P;  1VQK P;  2FAE A;  1E0H A;  1VQM P;  2KWL A;  1D1D A;  3WBH A;  5KP7 B;  2LML A;  2CNR A;  1YHQ P;  1Q81 Q;  3G1I A;  4IPY A;  2P9X A;  2QNW A;  2L4B A;  2PEO A;  2EHT A;  4XFX A;  2N98 A;  1VQP P;  2FVE A;  2EFJ A;  2PEM A;  2DGY A;  2LF4 A;  4U0B A;  4BPG A;  3DS5 A;  4COC A;  2JAZ A;  2JO0 A;  2K0X A;  2PY8 A;  1M90 Q;  1EOQ A;  1GPJ A;  1VQO P;  3CCE P;  3P05 A;  4XFZ A;  1RNI A;  1W2B O;  1A8O A;  2L9F A;  4PH1 A;  2FQ2 A;  4GR2 A;  1VQ9 P;  2K2Q A;  1YIJ P;  4U0A A;  2KOD A;  1VQL P;  4CA3 A;  2OTJ P;  5KP8 B;  2LIW A;  3CCU P;  1ZNV A;  1UJZ A;  3U43 A;  3DS2 A;  5KP6 B;  1IMP A;  1CEI A;  2MY5 A;  5DCK A;  1KC8 Q;  2MR8 A;  4DG9 A;  3DS4 A;  1M6N A;  2JU1 A;  4PXH B;  3I56 P;  2XXM A;  2KGC A;  1K73 Q;  1ACP A;  3CME P;  3B4Q A;  3G4S P;  2AF8 A;  4H2W C;  3RG2 A;  2XT1 A;  1FR2 A;  2JU2 A;  2LTE A;  4U0D A;  3HYB A;  3G29 A;  3CCQ P;  5HVC A;  1AF8 A;  2FAD A;  4U0F A;  2QA4 P;  4WYM A;  2VLP A;  2CQ8 A;  5HGL A;  2PEQ A;  3OW2 O;  2JYL A;  4XRO A;  1IMQ A;  1MZ8 A;  2JBG A;  2N6Z A;  1YJN P;  2JYG A;  2JQ4 A;  5F2O A;  5I4T G;  1QVF O;  2K5X A;  2FVA A;  1HQB A;  2LKI A;  4R0M A;  2GZI A;  1YJW P;  1RO0 A;  2L0Q A;  2GYK A;  1QRJ A;  2KG8 A;  2M8N A;  1M6E X;  2MVU A;  4BPH A;  4H2X C;  2PEJ A;  3GZM A;  3EJE A;  3DS3 A;  2EIA A;  1YI2 P;  4NEO A;  1Q7Y Q;  2K0Y A;  3LRY A;  2L6E A;  2JGP A;  2LPK A;  5JPA A;  1AYI A;  2PEN A;  3RG6 C;  2K0D X;  4XFY A;  3EJD A;  2GZE A;  1E6J P;  3CPW O;  2VLO A;  1ZMB A;  4BPF A;  2FVF A;  2CWO A;  2PNG A;  1QVG O;  7CEI A;  5BS2 A;  2AVA A;  1VQ8 P;  1T8K A;  2KG6 A;  3G0V A;  2XZ0 D;  1K9M Q;  2CGQ A;  2M8L A;  3CCM P;  2MF4 A;  2QEX P;  2BUO A;  1VQ4 P;  4U0E A;  5EW5 E;  4COP A;  2KOO A;  2OAR A;  3EJB A;  3G1G A;  2KGE A;  1KQS O;  2N50 A;  2JB0 A;  3G28 A;  1BXI A;  2AFD A;  2GDX A;  3CCV P;  3E2D A;  1K8A Q;  1Q86 Q;  2N5I A;  2FQ1 A;  4M0I A;  2GZJ A;  2GZG A;  3CD6 P;  3LMO A;  1EMV A;  2X2B A;  2M5R A;  2NO8 A;  1L0I A;  1VKU A;  4XRQ A;  3G21 A;  1HY8 A;  3M1M A;  1M1K Q;  3CE7 A;  1Q82 Q;  2KOP A;  5CZD B;  2MR7 A;  1GXH A;  1S72 P;  1RO2 A;  2CG5 B;  3GKL C;  3CCL P;  3MGE A;  2OTL P;  2GZF A;  5EJD A;  2KR5 A;  3Q20 A;  4IZ6 A;  1K30 A;  3GZL A;  2K94 A;  4UHP B;  3NTE A;  1KLP A;  2DNW A;  2KGD A;  1NJI Q;  3I55 P;  1F80 D;  2KG9 A;  4QKO A;  2KOS A;  2VLQ A;  2ROQ A; 
#chains in the Genus database with same CATH homology
 3CCJ P;  3CXC O;  3CMA P;  1K73 Q;  5BS2 A;  5BS1 A;  2EG5 A;  1VQ8 P;  1IUQ A;  1YIT P;  3CME P;  3G4S P;  3G0V A;  1M74 A;  5F2K A;  5HGO A;  1VQN P;  3VRL C;  2XT1 A;  1K9M Q;  1AUM A;  2M8L A;  4U0D A;  2M8P A;  3DTJ A;  3CCM P;  4QNB A;  3HYB A;  2QEX P;  1N8R Q;  2BUO A;  1KD1 Q;  1VQ6 P;  3G29 A;  3CC4 P;  2PEI A;  3DS1 A;  1VQ4 P;  4U0E A;  3CCQ P;  5F2N A;  4COP A;  2BHV A;  2XV6 A;  4U0F A;  2QA4 P;  3DS0 A;  2OAR A;  3CCS P;  3G1G A;  1VQ5 P;  1KQS O;  1VQK P;  4WYM A;  3G28 A;  1VQM P;  2E1M A;  3G6E P;  3H4E A;  3CC7 P;  1D1D A;  3WBH A;  3CCV P;  2ONT A;  3E2D A;  1K8A Q;  5HGL A;  2PEQ A;  3OW2 O;  2JYL A;  4XRO A;  1YHQ P;  1Q86 Q;  1A43 A;  1Q81 Q;  5HGN A;  3G1I A;  4M0I A;  4IPY A;  2P9X A;  1YJN P;  2JYG A;  2PEO A;  3CD6 P;  4XFX A;  5F2O A;  5I4T G;  1QVF O;  3CC2 P;  4U0C A;  1EIA A;  1VQP P;  4XRQ A;  3G21 A;  3M1M A;  2EFJ A;  2PEM A;  2DGY A;  2LF4 A;  4U0B A;  1YJW P;  3DS5 A;  1RO0 A;  1M1K Q;  3HZQ A;  1JJ2 O;  4COC A;  1Q82 Q;  2JO0 A;  2Z45 A;  2PY8 A;  1M90 Q;  1EOQ A;  3B5I A;  1VQO P;  5HGM A;  3CCE P;  1S72 P;  2Z46 A;  3P05 A;  1RO2 A;  1QRJ A;  3G26 A;  4XFZ A;  1RNI A;  2M8N A;  1M6E X;  3CCL P;  2PEJ A;  1BAJ A;  1W2B O;  4PH0 A;  1A8O A;  3MGE A;  3DS3 A;  4PH1 A;  2EIA A;  4GR2 A;  1YIJ P;  1YI2 P;  4U0A A;  1VQ9 P;  2KOD A;  1YJ9 P;  3CCR P;  1VQL P;  2OTJ P;  2OTL P;  1Q7Y Q;  3CCU P;  3Q20 A;  1VQ7 P;  3LRY A;  3DS2 A;  1K30 A;  3DPH A;  2L6E A;  5JPA A;  2PEK A;  3H0D A;  2PEN A;  3RG6 C;  3NTE A;  5DCK A;  1KC8 Q;  4XFY A;  3G71 P;  3DS4 A;  4GR6 A;  1E6J P;  1M6N A;  2Z44 A;  3CPW O;  1NJI Q;  1ZMB A;  3I55 P;  3I56 P;  3H47 A;  2CWO A;  2XXM A;  1QVG O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...