2MR8A

Holo structure of the peptidyl carrier protein domain 7 of the teicoplanin producing non-ribosomal peptide synthetase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
91
structure length
91
Chain Sequence
GAMAKAPESATEKVLCALYAEILGVERVGVDDAFHDLGGSSALAMRLIARIREELGVDLPIRQLFSSPTPAGVARALAAKSASWSHPQFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-ribosomal peptide synthetase
publication title Structure of the terminal PCP domain of the non-ribosomal peptide synthetase in teicoplanin biosynthesis.
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Biosynthetic protein
total genus 25
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2mr8A00
2N98A 2ROQA 2X2BA 2N5HA 2LOLA 2LPKA 4MRTC 1HQBA 2MR7A 5HVCA 2QNWA 3GZMA 4H2WC 2KW2A 2KR5A 2CG5B 1L0IA 1VKUA 1DV5A 2FQ1A 2MD9A 4BPHA 5HV8A 4DG9A 3LMOA 2LIUA 2L0QA 1T8KA 2CGQA 2GDWA 3RG2A 2GDXA 5KP8B 2KGAA 2AF8A 2KGCA 2GDYA 2FAEA 2LIWA 4H2YC 2FVFA 2FVAA 1AF8A 2VSQA 2K0YA 4R0MA 2K92A 2K93A 2KG9A 2KOOA 2FACA 2FHSC 2CQ8A 1F80D 2KORA 5CZDB 3CE7A 2M5RA 2LKIA 2AVAA 3GZLA 2LMLA 2MR8A 2JGPA 2MVUA 2LL8A 2N6ZA 5EJDA 2DNWA 2JU1A 2CNRA 2FQ0A 2MVVA 2N50A 4H2XC 2KOPA 1X3OA 2MF4A 4PWVB 2KGEA 2L9FA 4BPGA 2FQ2A 2MY5A 2KG8A 2KOSA 2PNGA 1HY8A 2L22A 1DNYA 5KP6B 4IZ6A 2EHSA 2KGDA 1NQ4A 2FVEA 1OR5A 3EJBA 2L4BA 2KWLA 2N5IA 2AFDA 4PXHB 2JU2A 2XZ1C 5KP7B 3EJEA 4HKGA 2JQ4A 4NEOA 2K0XA 2K2QA 3NY7B 1L0HA 2AFEA 2KG6A 2EHTA 2FADA 1KLPA 1ACPA 3EJDA 2KOQA 4BPFA 4CA3A 2K94A 2N6YA 2LTEA 2XZ0D
chains in the Genus database with same CATH superfamily
2N98A 3B4QA 1VQ7P 2N5HA 3CCLP 3G0VA 3G71P 2PEKA 1K8AQ 2PEQA 3CCJP 3CC2P 4M0IA 5HVCA 3GZMA 1VQ6P 3CPWO 1DV5A 4DG9A 1T8KA 2CGQA 2GDWA 3OW2O 3CCSP 1Q82Q 1EMVA 5F2NA 2GDYA 2FAEA 2FVFA 2XV6A 1N8RQ 1YJ9P 1AF8A 3CMAP 2VSQA 4R0MA 1VQOP 2KOOA 4F37A 2GYKA 2CQ8A 4XROA 1GXGA 1AUMA 2GZJA 1K30A 2AVAA 3GZLA 2LMLA 2MR8A 4WYMA 2MVUA 5HGOA 2ONTA 3LRYA 2CNRA 4H2XC 1VQ5P 1X3OA 2MF4A 7CEIA 4BPGA 4U0BA 2MY5A 2CWOA 2KOSA 2PNGA 5EW5E 1AYIA 2EG5A 4U0AA 1IUQA 1YITP 2GZGA 3EJBA 3HZQA 2KWLA 2BHVA 4XFXA 4PXHB 2PEJA 2JU2A 1VQMP 3H4EA 2VLOA 3NY7B 3M1MA 1M1KQ 4CA3A 4BPFA 2K94A 2N6YA 2M8LA 2XZ0D 1UJZA 2OTLP 2PEIA 3WBHA 4U0DA 2LPKA 2MR7A 1K9MQ 2QNWA 4H2WC 2JBGA 1L0IA 2FQ1A 2Z45A 3G4SP 2LIUA 3H0DA 1RO0A 2XT1A 4XFYA 2AF8A 3P05A 2KGCA 4H2YC 3CMEP 5I4TG 1VQNP 1VQKP 2GZFA 2K93A 3G1GA 1UNKA 3DPHA 3B5IA 5HGMA 1YJWP 2OTJP 2QA4P 3NTEA 2VLPA 1VHNA 2K5XA 1M6EX 2JGPA 4QNBA 1QVGO 1Q86Q 2N6ZA 5HGLA 2DNWA 3CCRP 2JU1A 2MVVA 3H47A 2PEOA 2KODA 1EIAA 2EIAA 1Q7YQ 4IPYA 1YIJP 2PY8A 3DS3A 3DS5A 5KP6B 2Z46A 2EHSA 1NQ4A 1OR5A 2AFDA 3EJEA 4HKGA 2JQ4A 1YJNP 4QKOA 1L0HA 2JYLA 4U0FA 4COCA 2KG6A 1QRJA 1KC8Q 3EJDA 3DS2A 1ZNVA 4U0CA 2PEMA 1BAJA 3CXCO 4COPA 3RG6C 4MRTC 3VRLC 1HQBA 3I56P 3DS1A 2KW2A 1VQ8P 1E0HA 2EFJA 2L6EA 1GPJA 3G6EP 1M6NA 1YI2P 1KD1Q 1RNIA 5KP8B 4PH0A 3CCMP 1A8OA 2K0YA 2VLQA 2JB0A 2FACA 2FHSC 5BS1A 1YHQP 1VQ9P 2M8NA 2P9XA 1BXIA 3CC4P 4U0EA 1EOQA 2LL8A 2WPTA 3Q20A 4PH1A 1FR2A 3CCQP 1S72P 2GZEA 3I55P 3CCVP 3CC7P 1A43A 2KG8A 1HY8A 1IMQA 3DS4A 2L22A 1DNYA 3MGEA 3G26A 1K73Q 1D1DA 2KGDA 3DS0A 1Z6MA 2L4BA 3G1IA 2N5IA 2JO0A 1MZ8A 5KP7B 1ZMBA 2K2QA 2OARA 3GJNA 2AFEA 2Z44A 4GR6A 2FADA 1ACPA 1RO2A 1QVFO 5DCKA 3G21A 2QEXP 2ERHA 2ROQA 2X2BA 5JPAA 2LOLA 2JAZA 1Q81Q 3CCEP 3G29A 2KR5A 5HGNA 2CG5B 1VKUA 2MD9A 4BPHA 5HV8A 1W2BO 3LMOA 2L0QA 3CD6P 2LF4A 1IMPA 1GXHA 2VLNA 3RG2A 2GDXA 2KGAA 5F2OA 2LIWA 3G28A 2FVAA 4UHPB 2K92A 3E2DA 2KG9A 1VQLP 1VQPP 1F80D 2BUOA 2KORA 5CZDB 3CE7A 2M5RA 2DGYA 2LKIA 2PENA 2K0DX 4XFZA 5EJDA 2FQ0A 2N50A 1KQSO 2KOPA 4PWVB 2KGEA 2L9FA 2M8PA 3GKLC 1E6JP 2FQ2A 1VQ4P 3U43A 1NJIQ 2NO8A 3HYBA 3CCUP 4IZ6A 2GZIA 5F2KA 1M74A 2FVEA 2XXMA 2E1MA 2XZ1C 3DTJA 4NEOA 1M90Q 2K0XA 5BS2A 1CEIA 2EHTA 4XRQA 1KLPA 2KOQA 2JYGA 4GR2A 2LTEA 1JJ2O
chains in the Genus database with same CATH topology
2N98A 2ROQA 2X2BA 2N5HA 2LOLA 2LPKA 4MRTC 1HQBA 2MR7A 5HVCA 2QNWA 3GZMA 4H2WC 2KW2A 2KR5A 2CG5B 1L0IA 1VKUA 1DV5A 2FQ1A 2MD9A 4BPHA 5HV8A 4DG9A 3LMOA 2LIUA 2L0QA 1T8KA 2CGQA 2GDWA 3RG2A 2GDXA 5KP8B 2KGAA 2AF8A 2KGCA 2GDYA 2FAEA 2LIWA 4H2YC 2FVFA 2FVAA 1AF8A 2VSQA 2K0YA 4R0MA 2K92A 2K93A 2KG9A 2KOOA 2FACA 2FHSC 2CQ8A 1F80D 2KORA 5CZDB 3CE7A 2M5RA 2LKIA 2AVAA 3GZLA 2LMLA 2MR8A 2JGPA 2MVUA 2LL8A 2N6ZA 5EJDA 2DNWA 2JU1A 2CNRA 2FQ0A 2MVVA 2N50A 4H2XC 2KOPA 1X3OA 2MF4A 4PWVB 2KGEA 2L9FA 4BPGA 2FQ2A 2MY5A 2KG8A 2KOSA 2PNGA 1HY8A 2L22A 1DNYA 5KP6B 4IZ6A 2EHSA 2KGDA 1NQ4A 2FVEA 1OR5A 3EJBA 2L4BA 2KWLA 2N5IA 2AFDA 4PXHB 2JU2A 2XZ1C 5KP7B 3EJEA 4HKGA 2JQ4A 4NEOA 2K0XA 2K2QA 3NY7B 1L0HA 2AFEA 2KG6A 2EHTA 2FADA 1KLPA 1ACPA 3EJDA 2KOQA 4BPFA 4CA3A 2K94A 2N6YA 2LTEA 2XZ0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N98 A;  2ROQ A;  2X2B A;  2N5H A;  2LOL A;  2LPK A;  4MRT C;  1HQB A;  2MR7 A;  5HVC A;  2QNW A;  3GZM A;  4H2W C;  2KW2 A;  2KR5 A;  2CG5 B;  1L0I A;  1VKU A;  1DV5 A;  2FQ1 A;  2MD9 A;  4BPH A;  5HV8 A;  4DG9 A;  3LMO A;  2LIU A;  2L0Q A;  1T8K A;  2CGQ A;  2GDW A;  3RG2 A;  2GDX A;  5KP8 B;  2KGA A;  2AF8 A;  2KGC A;  2GDY A;  2FAE A;  2LIW A;  4H2Y C;  2FVF A;  2FVA A;  1AF8 A;  2VSQ A;  2K0Y A;  4R0M A;  2K92 A;  2K93 A;  2KG9 A;  2KOO A;  2FAC A;  2FHS C;  2CQ8 A;  1F80 D;  2KOR A;  5CZD B;  3CE7 A;  2M5R A;  2LKI A;  2AVA A;  3GZL A;  2LML A;  2MR8 A;  2JGP A;  2MVU A;  2LL8 A;  2N6Z A;  5EJD A;  2DNW A;  2JU1 A;  2CNR A;  2FQ0 A;  2MVV A;  2N50 A;  4H2X C;  2KOP A;  1X3O A;  2MF4 A;  4PWV B;  2KGE A;  2L9F A;  4BPG A;  2FQ2 A;  2MY5 A;  2KG8 A;  2KOS A;  2PNG A;  1HY8 A;  2L22 A;  1DNY A;  5KP6 B;  4IZ6 A;  2EHS A;  2KGD A;  1NQ4 A;  2FVE A;  1OR5 A;  3EJB A;  2L4B A;  2KWL A;  2N5I A;  2AFD A;  4PXH B;  2JU2 A;  2XZ1 C;  5KP7 B;  3EJE A;  4HKG A;  2JQ4 A;  4NEO A;  2K0X A;  2K2Q A;  3NY7 B;  1L0H A;  2AFE A;  2KG6 A;  2EHT A;  2FAD A;  1KLP A;  1ACP A;  3EJD A;  2KOQ A;  4BPF A;  4CA3 A;  2K94 A;  2N6Y A;  2LTE A;  2XZ0 D; 
#chains in the Genus database with same CATH topology
 2N98 A;  3B4Q A;  1VQ7 P;  2N5H A;  3CCL P;  3G0V A;  3G71 P;  2PEK A;  1K8A Q;  2PEQ A;  3CCJ P;  3CC2 P;  4M0I A;  5HVC A;  3GZM A;  1VQ6 P;  3CPW O;  1DV5 A;  4DG9 A;  1T8K A;  2CGQ A;  2GDW A;  3OW2 O;  3CCS P;  1Q82 Q;  1EMV A;  5F2N A;  2GDY A;  2FAE A;  2FVF A;  2XV6 A;  1N8R Q;  1YJ9 P;  1AF8 A;  3CMA P;  2VSQ A;  4R0M A;  1VQO P;  2KOO A;  4F37 A;  2GYK A;  2CQ8 A;  4XRO A;  1GXG A;  1AUM A;  2GZJ A;  1K30 A;  2AVA A;  3GZL A;  2LML A;  2MR8 A;  4WYM A;  2MVU A;  5HGO A;  2ONT A;  3LRY A;  2CNR A;  4H2X C;  1VQ5 P;  1X3O A;  2MF4 A;  7CEI A;  4BPG A;  4U0B A;  2MY5 A;  2CWO A;  2KOS A;  2PNG A;  5EW5 E;  1AYI A;  2EG5 A;  4U0A A;  1IUQ A;  1YIT P;  2GZG A;  3EJB A;  3HZQ A;  2KWL A;  2BHV A;  4XFX A;  4PXH B;  2PEJ A;  2JU2 A;  1VQM P;  3H4E A;  2VLO A;  3NY7 B;  3M1M A;  1M1K Q;  4CA3 A;  4BPF A;  2K94 A;  2N6Y A;  2M8L A;  2XZ0 D;  1UJZ A;  2OTL P;  2PEI A;  3WBH A;  4U0D A;  2LPK A;  2MR7 A;  1K9M Q;  2QNW A;  4H2W C;  2JBG A;  1L0I A;  2FQ1 A;  2Z45 A;  3G4S P;  2LIU A;  3H0D A;  1RO0 A;  2XT1 A;  4XFY A;  2AF8 A;  3P05 A;  2KGC A;  4H2Y C;  3CME P;  5I4T G;  1VQN P;  1VQK P;  2GZF A;  2K93 A;  3G1G A;  1UNK A;  3DPH A;  3B5I A;  5HGM A;  1YJW P;  2OTJ P;  2QA4 P;  3NTE A;  2VLP A;  1VHN A;  2K5X A;  1M6E X;  2JGP A;  4QNB A;  1QVG O;  1Q86 Q;  2N6Z A;  5HGL A;  2DNW A;  3CCR P;  2JU1 A;  2MVV A;  3H47 A;  2PEO A;  2KOD A;  1EIA A;  2EIA A;  1Q7Y Q;  4IPY A;  1YIJ P;  2PY8 A;  3DS3 A;  3DS5 A;  5KP6 B;  2Z46 A;  2EHS A;  1NQ4 A;  1OR5 A;  2AFD A;  3EJE A;  4HKG A;  2JQ4 A;  1YJN P;  4QKO A;  1L0H A;  2JYL A;  4U0F A;  4COC A;  2KG6 A;  1QRJ A;  1KC8 Q;  3EJD A;  3DS2 A;  1ZNV A;  4U0C A;  2PEM A;  1BAJ A;  3CXC O;  4COP A;  3RG6 C;  4MRT C;  3VRL C;  1HQB A;  3I56 P;  3DS1 A;  2KW2 A;  1VQ8 P;  1E0H A;  2EFJ A;  2L6E A;  1GPJ A;  3G6E P;  1M6N A;  1YI2 P;  1KD1 Q;  1RNI A;  5KP8 B;  4PH0 A;  3CCM P;  1A8O A;  2K0Y A;  2VLQ A;  2JB0 A;  2FAC A;  2FHS C;  5BS1 A;  1YHQ P;  1VQ9 P;  2M8N A;  2P9X A;  1BXI A;  3CC4 P;  4U0E A;  1EOQ A;  2LL8 A;  2WPT A;  3Q20 A;  4PH1 A;  1FR2 A;  3CCQ P;  1S72 P;  2GZE A;  3I55 P;  3CCV P;  3CC7 P;  1A43 A;  2KG8 A;  1HY8 A;  1IMQ A;  3DS4 A;  2L22 A;  1DNY A;  3MGE A;  3G26 A;  1K73 Q;  1D1D A;  2KGD A;  3DS0 A;  1Z6M A;  2L4B A;  3G1I A;  2N5I A;  2JO0 A;  1MZ8 A;  5KP7 B;  1ZMB A;  2K2Q A;  2OAR A;  3GJN A;  2AFE A;  2Z44 A;  4GR6 A;  2FAD A;  1ACP A;  1RO2 A;  1QVF O;  5DCK A;  3G21 A;  2QEX P;  2ERH A;  2ROQ A;  2X2B A;  5JPA A;  2LOL A;  2JAZ A;  1Q81 Q;  3CCE P;  3G29 A;  2KR5 A;  5HGN A;  2CG5 B;  1VKU A;  2MD9 A;  4BPH A;  5HV8 A;  1W2B O;  3LMO A;  2L0Q A;  3CD6 P;  2LF4 A;  1IMP A;  1GXH A;  2VLN A;  3RG2 A;  2GDX A;  2KGA A;  5F2O A;  2LIW A;  3G28 A;  2FVA A;  4UHP B;  2K92 A;  3E2D A;  2KG9 A;  1VQL P;  1VQP P;  1F80 D;  2BUO A;  2KOR A;  5CZD B;  3CE7 A;  2M5R A;  2DGY A;  2LKI A;  2PEN A;  2K0D X;  4XFZ A;  5EJD A;  2FQ0 A;  2N50 A;  1KQS O;  2KOP A;  4PWV B;  2KGE A;  2L9F A;  2M8P A;  3GKL C;  1E6J P;  2FQ2 A;  1VQ4 P;  3U43 A;  1NJI Q;  2NO8 A;  3HYB A;  3CCU P;  4IZ6 A;  2GZI A;  5F2K A;  1M74 A;  2FVE A;  2XXM A;  2E1M A;  2XZ1 C;  3DTJ A;  4NEO A;  1M90 Q;  2K0X A;  5BS2 A;  1CEI A;  2EHT A;  4XRQ A;  1KLP A;  2KOQ A;  2JYG A;  4GR2 A;  2LTE A;  1JJ2 O; 
#chains in the Genus database with same CATH homology
 2N98 A;  2ROQ A;  2X2B A;  2N5H A;  2LOL A;  2LPK A;  4MRT C;  1HQB A;  2MR7 A;  5HVC A;  2QNW A;  3GZM A;  4H2W C;  2KW2 A;  2KR5 A;  2CG5 B;  1L0I A;  1VKU A;  1DV5 A;  2FQ1 A;  2MD9 A;  4BPH A;  5HV8 A;  4DG9 A;  3LMO A;  2LIU A;  2L0Q A;  1T8K A;  2CGQ A;  2GDW A;  3RG2 A;  2GDX A;  5KP8 B;  2KGA A;  2AF8 A;  2KGC A;  2GDY A;  2FAE A;  2LIW A;  4H2Y C;  2FVF A;  2FVA A;  1AF8 A;  2VSQ A;  2K0Y A;  4R0M A;  2K92 A;  2K93 A;  2KG9 A;  2KOO A;  2FAC A;  2FHS C;  2CQ8 A;  1F80 D;  2KOR A;  5CZD B;  3CE7 A;  2M5R A;  2LKI A;  2AVA A;  3GZL A;  2LML A;  2MR8 A;  2JGP A;  2MVU A;  2LL8 A;  2N6Z A;  5EJD A;  2DNW A;  2JU1 A;  2CNR A;  2FQ0 A;  2MVV A;  2N50 A;  4H2X C;  2KOP A;  1X3O A;  2MF4 A;  4PWV B;  2KGE A;  2L9F A;  4BPG A;  2FQ2 A;  2MY5 A;  2KG8 A;  2KOS A;  2PNG A;  1HY8 A;  2L22 A;  1DNY A;  5KP6 B;  4IZ6 A;  2EHS A;  2KGD A;  1NQ4 A;  2FVE A;  1OR5 A;  3EJB A;  2L4B A;  2KWL A;  2N5I A;  2AFD A;  4PXH B;  2JU2 A;  2XZ1 C;  5KP7 B;  3EJE A;  4HKG A;  2JQ4 A;  4NEO A;  2K0X A;  2K2Q A;  3NY7 B;  1L0H A;  2AFE A;  2KG6 A;  2EHT A;  2FAD A;  1KLP A;  1ACP A;  3EJD A;  2KOQ A;  4BPF A;  4CA3 A;  2K94 A;  2N6Y A;  2LTE A;  2XZ0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...