2MR8A

Holo structure of the peptidyl carrier protein domain 7 of the teicoplanin producing non-ribosomal peptide synthetase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
91
structure length
91
Chain Sequence
GAMAKAPESATEKVLCALYAEILGVERVGVDDAFHDLGGSSALAMRLIARIREELGVDLPIRQLFSSPTPAGVARALAAKSASWSHPQFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Non-ribosomal peptide synthetase
publication title Structure of the terminal PCP domain of the non-ribosomal peptide synthetase in teicoplanin biosynthesis.
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
total genus 25
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2mr8A00
2PNGA 4MRTC 3GZMA 2CG5B 2MR7A 2KGCA 2N6ZA 3EJEA 2KG9A 2LKIA 1NQ4A 2KWLA 4CA3A 4BPFA 2XZ1C 2K93A 5CZDB 2KGEA 5EJDA 4R0MA 2L0QA 2MR8A 2GDWA 5KP6B 4PXHB 2CQ8A 2MD9A 2JU2A 1DV5A 2FACA 3RG2A 2LL8A 2K0XA 2EHTA 2FQ0A 2N50A 2FQ1A 2MY5A 2FVEA 1X3OA 2N5HA 2GDYA 2FVFA 2ROQA 2JQ4A 2MVUA 1L0HA 2DNWA 2LMLA 2KGAA 2FADA 5HVCA 2GDXA 5KP8B 2LTEA 2L22A 2KOOA 4IZ6A 2JU1A 1T8KA 4NEOA 4PWVB 2KOSA 2L9FA 3CE7A 1OR5A 2KGDA 2XZ0D 2K0YA 4HKGA 2AFDA 2KOPA 3GZLA 2LOLA 4H2XC 3LMOA 2KORA 2CGQA 2VSQA 1VKUA 2QNWA 1ACPA 2AVAA 2EHSA 1HY8A 2FVAA 2MVVA 1DNYA 2FQ2A 2KG6A 2N5IA 1AF8A 2KR5A 2X2BA 1HQBA 4DG9A 3EJDA 2L4BA 2N98A 2KOQA 2N6YA 1KLPA 2LIWA 2KG8A 2LPKA 4BPGA 3NY7B 5HV8A 1F80D 2FAEA 2M5RA 2K2QA 2KW2A 2MF4A 3EJBA 1L0IA 2K92A 4H2YC 2JGPA 2LIUA 4BPHA 4H2WC 2FHSC 2CNRA 2K94A 5KP7B 2AFEA 2AF8A
chains in the Genus database with same CATH superfamily
3NTEA 2PEQA 3G28A 2K0DX 4MRTC 3G71P 1K9MQ 2PEKA 3DS2A 2OARA 1NQ4A 4CA3A 4BPFA 1YI2P 2M8LA 5CZDB 2KGEA 5EJDA 2L0QA 2MR8A 3G1GA 4PXHB 2ERHA 1DV5A 3B4QA 5I4TG 2K0XA 2PY8A 2QEXP 1M6EX 2MY5A 2MVUA 2DNWA 2GDXA 2JO0A 3CCJP 3B5IA 3GJNA 2KOOA 1Z6MA 4IZ6A 2GZIA 2GZEA 2VLOA 4NEOA 4PWVB 3Q20A 1OR5A 2KGDA 4HKGA 1UJZA 3CCQP 2FVAA 2MVVA 3DS3A 1DNYA 4M0IA 1VQPP 1VQ4P 2KG6A 5HGMA 1M6NA 1A8OA 1IUQA 1ZMBA 3CCRP 2N98A 1KLPA 2LIWA 2KG8A 4COPA 3LRYA 2E1MA 2FAEA 2M5RA 1Q81Q 2K2QA 2KW2A 2MF4A 4U0CA 4XFZA 1JJ2O 2FHSC 1YITP 2K94A 2ONTA 2JAZA 3CMAP 5KP7B 4PH0A 4WYMA 1S72P 3DS1A 2PEOA 4IPYA 5BS2A 3G4SP 2MR7A 1E6JP 2OTLP 2LKIA 3I56P 2WPTA 3CC4P 4R0MA 1VQLP 1N8RQ 3G29A 3H47A 5KP6B 2MD9A 2JU2A 2LF4A 5F2OA 2EHTA 2FQ0A 2FQ1A 3CCMP 1Q82Q 1X3OA 3G0VA 2N5HA 1VQKP 2GDYA 2ROQA 1QRJA 2EFJA 2JYGA 5BS1A 1QVFO 2LTEA 2BHVA 3VRLC 2M8NA 1K8AQ 1EOQA 3CCLP 2XZ0D 1KD1Q 4H2XC 4U0DA 2KORA 1VQOP 1Q86Q 1FR2A 2QNWA 1ACPA 3RG6C 2AVAA 3MGEA 4QKOA 2GYKA 1MZ8A 3OW2O 3H4EA 2NO8A 1AF8A 2X2BA 2XT1A 4XROA 4DG9A 3EJDA 3M1MA 1GPJA 2LPKA 2Z44A 3G26A 4H2YC 1L0IA 2K92A 4PH1A 1KQSO 1VQ7P 4QNBA 4BPHA 1M74A 4XFXA 2JB0A 1W2BO 4UHPB 1BAJA 1AUMA 3DS5A 2AF8A 2VLQA 2CWOA 1YIJP 5HGOA 3DTJA 5JPAA 2JYLA 1M1KQ 2JBGA 3CPWO 1E0HA 1ZNVA 1VQ5P 2N6ZA 3EJEA 2GZFA 1QVGO 2KG9A 2KODA 1NJIQ 1GXHA 2XZ1C 2K93A 1M90Q 2PEIA 2CQ8A 3HZQA 2FACA 3CD6P 2XXMA 3RG2A 2LL8A 3WBHA 1VQ9P 2FVEA 1RNIA 5F2NA 2JQ4A 2XV6A 2KGAA 2FADA 2M8PA 3GKLC 1BXIA 1T8KA 3CMEP 1RO2A 2L9FA 3CE7A 2KOPA 3HYBA 5HGNA 3H0DA 2CGQA 1VKUA 2EHSA 2FQ2A 5EW5E 1GXGA 1D1DA 2KR5A 1HQBA 1EMVA 3G1IA 3I55P 2QA4P 2L6EA 1YHQP 4BPGA 5HV8A 3EJBA 2JGPA 2LIUA 4U0EA 1VQ6P 2CNRA 2K5XA 2PEMA 5DCKA 1VQNP 4U0BA 3G21A 4F37A 2PNGA 3CCSP 1IMQA 1VHNA 3GZMA 2CG5B 2GZGA 2KGCA 2GZJA 2KWLA 2Z45A 4GR6A 1K30A 2VLPA 3P05A 3E2DA 3G6EP 2EIAA 2GDWA 1VQ8P 2Z46A 3CCUP 1CEIA 1IMPA 2N50A 3DS4A 1YJNP 1KC8Q 3CXCO 4U0AA 2FVFA 1AYIA 1L0HA 2PEJA 2LMLA 5HVCA 3CCVP 5KP8B 2L22A 2JU1A 2KOSA 4XRQA 2K0YA 2AFDA 3GZLA 2LOLA 1EIAA 3LMOA 2VSQA 2OTJP 3DS0A 1HY8A 5F2KA 2N5IA 3CC7P 1RO0A 1A43A 4XFYA 2L4BA 1K73Q 7CEIA 1VQMP 2KOQA 2N6YA 2PENA 4GR2A 3CCEP 3U43A 2VLNA 3NY7B 1F80D 1YJ9P 3CC2P 3DPHA 2P9XA 1UNKA 4H2WC 4U0FA 2DGYA 4COCA 2BUOA 2EG5A 1YJWP 1Q7YQ 5HGLA 2AFEA
chains in the Genus database with same CATH topology
2PNGA 4MRTC 3GZMA 2CG5B 2MR7A 2KGCA 2N6ZA 3EJEA 2KG9A 2LKIA 1NQ4A 2KWLA 4CA3A 4BPFA 2XZ1C 2K93A 5CZDB 2KGEA 5EJDA 4R0MA 2L0QA 2MR8A 2GDWA 5KP6B 4PXHB 2CQ8A 2MD9A 2JU2A 1DV5A 2FACA 3RG2A 2LL8A 2K0XA 2EHTA 2FQ0A 2N50A 2FQ1A 2MY5A 2FVEA 1X3OA 2N5HA 2GDYA 2FVFA 2ROQA 2JQ4A 2MVUA 1L0HA 2DNWA 2LMLA 2KGAA 2FADA 5HVCA 2GDXA 5KP8B 2LTEA 2L22A 2KOOA 4IZ6A 2JU1A 1T8KA 4NEOA 4PWVB 2KOSA 2L9FA 3CE7A 1OR5A 2KGDA 2XZ0D 2K0YA 4HKGA 2AFDA 2KOPA 3GZLA 2LOLA 4H2XC 3LMOA 2KORA 2CGQA 2VSQA 1VKUA 2QNWA 1ACPA 2AVAA 2EHSA 1HY8A 2FVAA 2MVVA 1DNYA 2FQ2A 2KG6A 2N5IA 1AF8A 2KR5A 2X2BA 1HQBA 4DG9A 3EJDA 2L4BA 2N98A 2KOQA 2N6YA 1KLPA 2LIWA 2KG8A 2LPKA 4BPGA 3NY7B 5HV8A 1F80D 2FAEA 2M5RA 2K2QA 2KW2A 2MF4A 3EJBA 1L0IA 2K92A 4H2YC 2JGPA 2LIUA 4BPHA 4H2WC 2FHSC 2CNRA 2K94A 5KP7B 2AFEA 2AF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNG A;  4MRT C;  3GZM A;  2CG5 B;  2MR7 A;  2KGC A;  2N6Z A;  3EJE A;  2KG9 A;  2LKI A;  1NQ4 A;  2KWL A;  4CA3 A;  4BPF A;  2XZ1 C;  2K93 A;  5CZD B;  2KGE A;  5EJD A;  4R0M A;  2L0Q A;  2MR8 A;  2GDW A;  5KP6 B;  4PXH B;  2CQ8 A;  2MD9 A;  2JU2 A;  1DV5 A;  2FAC A;  3RG2 A;  2LL8 A;  2K0X A;  2EHT A;  2FQ0 A;  2N50 A;  2FQ1 A;  2MY5 A;  2FVE A;  1X3O A;  2N5H A;  2GDY A;  2FVF A;  2ROQ A;  2JQ4 A;  2MVU A;  1L0H A;  2DNW A;  2LML A;  2KGA A;  2FAD A;  5HVC A;  2GDX A;  5KP8 B;  2LTE A;  2L22 A;  2KOO A;  4IZ6 A;  2JU1 A;  1T8K A;  4NEO A;  4PWV B;  2KOS A;  2L9F A;  3CE7 A;  1OR5 A;  2KGD A;  2XZ0 D;  2K0Y A;  4HKG A;  2AFD A;  2KOP A;  3GZL A;  2LOL A;  4H2X C;  3LMO A;  2KOR A;  2CGQ A;  2VSQ A;  1VKU A;  2QNW A;  1ACP A;  2AVA A;  2EHS A;  1HY8 A;  2FVA A;  2MVV A;  1DNY A;  2FQ2 A;  2KG6 A;  2N5I A;  1AF8 A;  2KR5 A;  2X2B A;  1HQB A;  4DG9 A;  3EJD A;  2L4B A;  2N98 A;  2KOQ A;  2N6Y A;  1KLP A;  2LIW A;  2KG8 A;  2LPK A;  4BPG A;  3NY7 B;  5HV8 A;  1F80 D;  2FAE A;  2M5R A;  2K2Q A;  2KW2 A;  2MF4 A;  3EJB A;  1L0I A;  2K92 A;  4H2Y C;  2JGP A;  2LIU A;  4BPH A;  4H2W C;  2FHS C;  2CNR A;  2K94 A;  5KP7 B;  2AFE A;  2AF8 A; 
#chains in the Genus database with same CATH topology
 3NTE A;  2PEQ A;  3G28 A;  2K0D X;  4MRT C;  3G71 P;  1K9M Q;  2PEK A;  3DS2 A;  2OAR A;  1NQ4 A;  4CA3 A;  4BPF A;  1YI2 P;  2M8L A;  5CZD B;  2KGE A;  5EJD A;  2L0Q A;  2MR8 A;  3G1G A;  4PXH B;  2ERH A;  1DV5 A;  3B4Q A;  5I4T G;  2K0X A;  2PY8 A;  2QEX P;  1M6E X;  2MY5 A;  2MVU A;  2DNW A;  2GDX A;  2JO0 A;  3CCJ P;  3B5I A;  3GJN A;  2KOO A;  1Z6M A;  4IZ6 A;  2GZI A;  2GZE A;  2VLO A;  4NEO A;  4PWV B;  3Q20 A;  1OR5 A;  2KGD A;  4HKG A;  1UJZ A;  3CCQ P;  2FVA A;  2MVV A;  3DS3 A;  1DNY A;  4M0I A;  1VQP P;  1VQ4 P;  2KG6 A;  5HGM A;  1M6N A;  1A8O A;  1IUQ A;  1ZMB A;  3CCR P;  2N98 A;  1KLP A;  2LIW A;  2KG8 A;  4COP A;  3LRY A;  2E1M A;  2FAE A;  2M5R A;  1Q81 Q;  2K2Q A;  2KW2 A;  2MF4 A;  4U0C A;  4XFZ A;  1JJ2 O;  2FHS C;  1YIT P;  2K94 A;  2ONT A;  2JAZ A;  3CMA P;  5KP7 B;  4PH0 A;  4WYM A;  1S72 P;  3DS1 A;  2PEO A;  4IPY A;  5BS2 A;  3G4S P;  2MR7 A;  1E6J P;  2OTL P;  2LKI A;  3I56 P;  2WPT A;  3CC4 P;  4R0M A;  1VQL P;  1N8R Q;  3G29 A;  3H47 A;  5KP6 B;  2MD9 A;  2JU2 A;  2LF4 A;  5F2O A;  2EHT A;  2FQ0 A;  2FQ1 A;  3CCM P;  1Q82 Q;  1X3O A;  3G0V A;  2N5H A;  1VQK P;  2GDY A;  2ROQ A;  1QRJ A;  2EFJ A;  2JYG A;  5BS1 A;  1QVF O;  2LTE A;  2BHV A;  3VRL C;  2M8N A;  1K8A Q;  1EOQ A;  3CCL P;  2XZ0 D;  1KD1 Q;  4H2X C;  4U0D A;  2KOR A;  1VQO P;  1Q86 Q;  1FR2 A;  2QNW A;  1ACP A;  3RG6 C;  2AVA A;  3MGE A;  4QKO A;  2GYK A;  1MZ8 A;  3OW2 O;  3H4E A;  2NO8 A;  1AF8 A;  2X2B A;  2XT1 A;  4XRO A;  4DG9 A;  3EJD A;  3M1M A;  1GPJ A;  2LPK A;  2Z44 A;  3G26 A;  4H2Y C;  1L0I A;  2K92 A;  4PH1 A;  1KQS O;  1VQ7 P;  4QNB A;  4BPH A;  1M74 A;  4XFX A;  2JB0 A;  1W2B O;  4UHP B;  1BAJ A;  1AUM A;  3DS5 A;  2AF8 A;  2VLQ A;  2CWO A;  1YIJ P;  5HGO A;  3DTJ A;  5JPA A;  2JYL A;  1M1K Q;  2JBG A;  3CPW O;  1E0H A;  1ZNV A;  1VQ5 P;  2N6Z A;  3EJE A;  2GZF A;  1QVG O;  2KG9 A;  2KOD A;  1NJI Q;  1GXH A;  2XZ1 C;  2K93 A;  1M90 Q;  2PEI A;  2CQ8 A;  3HZQ A;  2FAC A;  3CD6 P;  2XXM A;  3RG2 A;  2LL8 A;  3WBH A;  1VQ9 P;  2FVE A;  1RNI A;  5F2N A;  2JQ4 A;  2XV6 A;  2KGA A;  2FAD A;  2M8P A;  3GKL C;  1BXI A;  1T8K A;  3CME P;  1RO2 A;  2L9F A;  3CE7 A;  2KOP A;  3HYB A;  5HGN A;  3H0D A;  2CGQ A;  1VKU A;  2EHS A;  2FQ2 A;  5EW5 E;  1GXG A;  1D1D A;  2KR5 A;  1HQB A;  1EMV A;  3G1I A;  3I55 P;  2QA4 P;  2L6E A;  1YHQ P;  4BPG A;  5HV8 A;  3EJB A;  2JGP A;  2LIU A;  4U0E A;  1VQ6 P;  2CNR A;  2K5X A;  2PEM A;  5DCK A;  1VQN P;  4U0B A;  3G21 A;  4F37 A;  2PNG A;  3CCS P;  1IMQ A;  1VHN A;  3GZM A;  2CG5 B;  2GZG A;  2KGC A;  2GZJ A;  2KWL A;  2Z45 A;  4GR6 A;  1K30 A;  2VLP A;  3P05 A;  3E2D A;  3G6E P;  2EIA A;  2GDW A;  1VQ8 P;  2Z46 A;  3CCU P;  1CEI A;  1IMP A;  2N50 A;  3DS4 A;  1YJN P;  1KC8 Q;  3CXC O;  4U0A A;  2FVF A;  1AYI A;  1L0H A;  2PEJ A;  2LML A;  5HVC A;  3CCV P;  5KP8 B;  2L22 A;  2JU1 A;  2KOS A;  4XRQ A;  2K0Y A;  2AFD A;  3GZL A;  2LOL A;  1EIA A;  3LMO A;  2VSQ A;  2OTJ P;  3DS0 A;  1HY8 A;  5F2K A;  2N5I A;  3CC7 P;  1RO0 A;  1A43 A;  4XFY A;  2L4B A;  1K73 Q;  7CEI A;  1VQM P;  2KOQ A;  2N6Y A;  2PEN A;  4GR2 A;  3CCE P;  3U43 A;  2VLN A;  3NY7 B;  1F80 D;  1YJ9 P;  3CC2 P;  3DPH A;  2P9X A;  1UNK A;  4H2W C;  4U0F A;  2DGY A;  4COC A;  2BUO A;  2EG5 A;  1YJW P;  1Q7Y Q;  5HGL A;  2AFE A; 
#chains in the Genus database with same CATH homology
 2PNG A;  4MRT C;  3GZM A;  2CG5 B;  2MR7 A;  2KGC A;  2N6Z A;  3EJE A;  2KG9 A;  2LKI A;  1NQ4 A;  2KWL A;  4CA3 A;  4BPF A;  2XZ1 C;  2K93 A;  5CZD B;  2KGE A;  5EJD A;  4R0M A;  2L0Q A;  2MR8 A;  2GDW A;  5KP6 B;  4PXH B;  2CQ8 A;  2MD9 A;  2JU2 A;  1DV5 A;  2FAC A;  3RG2 A;  2LL8 A;  2K0X A;  2EHT A;  2FQ0 A;  2N50 A;  2FQ1 A;  2MY5 A;  2FVE A;  1X3O A;  2N5H A;  2GDY A;  2FVF A;  2ROQ A;  2JQ4 A;  2MVU A;  1L0H A;  2DNW A;  2LML A;  2KGA A;  2FAD A;  5HVC A;  2GDX A;  5KP8 B;  2LTE A;  2L22 A;  2KOO A;  4IZ6 A;  2JU1 A;  1T8K A;  4NEO A;  4PWV B;  2KOS A;  2L9F A;  3CE7 A;  1OR5 A;  2KGD A;  2XZ0 D;  2K0Y A;  4HKG A;  2AFD A;  2KOP A;  3GZL A;  2LOL A;  4H2X C;  3LMO A;  2KOR A;  2CGQ A;  2VSQ A;  1VKU A;  2QNW A;  1ACP A;  2AVA A;  2EHS A;  1HY8 A;  2FVA A;  2MVV A;  1DNY A;  2FQ2 A;  2KG6 A;  2N5I A;  1AF8 A;  2KR5 A;  2X2B A;  1HQB A;  4DG9 A;  3EJD A;  2L4B A;  2N98 A;  2KOQ A;  2N6Y A;  1KLP A;  2LIW A;  2KG8 A;  2LPK A;  4BPG A;  3NY7 B;  5HV8 A;  1F80 D;  2FAE A;  2M5R A;  2K2Q A;  2KW2 A;  2MF4 A;  3EJB A;  1L0I A;  2K92 A;  4H2Y C;  2JGP A;  2LIU A;  4BPH A;  4H2W C;  2FHS C;  2CNR A;  2K94 A;  5KP7 B;  2AFE A;  2AF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...