2MR8A

Holo structure of the peptidyl carrier protein domain 7 of the teicoplanin producing non-ribosomal peptide synthetase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
91
structure length
91
Chain Sequence
GAMAKAPESATEKVLCALYAEILGVERVGVDDAFHDLGGSSALAMRLIARIREELGVDLPIRQLFSSPTPAGVARALAAKSASWSHPQFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-ribosomal peptide synthetase
publication title Structure of the terminal PCP domain of the non-ribosomal peptide synthetase in teicoplanin biosynthesis.
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Biosynthetic protein
total genus 25
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2mr8A00
2LPKA 2KGCA 3NY7B 2K2QA 2KR5A 4BPGA 4IZ6A 1AF8A 3GZLA 2XZ0D 5HVCA 2FADA 4PWVB 1HY8A 2MY5A 1ACPA 2JGPA 2K0YA 4H2WC 2LIWA 4PXHB 2PNGA 2N98A 2FVAA 2N5IA 2FQ0A 2CNRA 2FACA 1L0HA 2DNWA 2KORA 2KOPA 2QNWA 2LKIA 2FQ1A 4MRTC 2FQ2A 2KW2A 4H2XC 5HV8A 5KP6B 2MVVA 2LOLA 2L9FA 2LMLA 1DNYA 5EJDA 1HQBA 4BPFA 2FAEA 1X3OA 4H2YC 1KLPA 2KWLA 4HKGA 2FHSC 4DG9A 2KGAA 2MF4A 2GDXA 2JU2A 4BPHA 2K94A 1F80D 3EJEA 1L0IA 3LMOA 2KOQA 2ROQA 2LIUA 2GDYA 2K0XA 2N5HA 1VKUA 2FVFA 2LL8A 2MVUA 2MR8A 2EHTA 2FVEA 2KG9A 2KGEA 5KP8B 2KOSA 2K93A 3EJBA 2EHSA 3EJDA 2AFDA 3GZMA 2K92A 2MD9A 2AFEA 4R0MA 2KG6A 2JU1A 5CZDB 2KOOA 1NQ4A 2L0QA 2LTEA 2KGDA 2KG8A 2L22A 2X2BA 3RG2A 1T8KA 2JQ4A 3CE7A 2CGQA 2L4BA 2GDWA 2VSQA 2N6YA 4NEOA 2CG5B 4CA3A 1DV5A 2M5RA 2N50A 2XZ1C 2N6ZA 2AVAA 2CQ8A 5KP7B 2MR7A 2AF8A 1OR5A
chains in the Genus database with same CATH superfamily
2LPKA 2K2QA 3CCRP 3B4QA 2Z46A 4PWVB 1RNIA 2GZEA 1VQ7P 3GKLC 1BAJA 3CC4P 4QKOA 4GR6A 2FACA 3I56P 2DNWA 2KORA 1VQ4P 2LKIA 3H4EA 2FQ1A 2KW2A 5HV8A 3DPHA 1IMPA 2M8NA 2LOLA 2LMLA 1DNYA 1VQKP 1M6NA 5BS1A 3CCLP 4DG9A 4PH0A 2MF4A 4XRQA 5I4TG 2GDXA 2JU2A 2K94A 2XV6A 3CCEP 4M0IA 2K0DX 4U0DA 1K73Q 4UHPB 2ROQA 1YIJP 2LIUA 1E0HA 1GXHA 2K0XA 5EW5E 2JAZA 3EJBA 4XFYA 1VQLP 1VQPP 2MD9A 2KG6A 2JU1A 5CZDB 2GZGA 2JYLA 1EMVA 1IMQA 2KG8A 2L22A 1YJWP 2CGQA 2L4BA 2EFJA 2VLQA 2CG5B 4CA3A 1DV5A 3DS3A 4U0BA 5HGNA 1EIAA 2M8PA 1VQMP 3Q20A 1QVFO 4IZ6A 3MGEA 1K9MQ 2FADA 4XFXA 2DGYA 2K0YA 4U0FA 2PEIA 4PXHB 3M1MA 4U0AA 1GPJA 2ERHA 4GR2A 2N98A 3CCVP 2FQ0A 1VQ9P 1NJIQ 3DS1A 1YHQP 1M6EX 3LRYA 4MRTC 1YITP 2L9FA 1MZ8A 3HZQA 2KWLA 1VQ6P 4HKGA 2FHSC 2PENA 2GZFA 3CC2P 1QVGO 3DS4A 4BPHA 3G26A 1L0IA 3G28A 2KOQA 1K8AQ 2JBGA 2FVFA 2VLPA 2MR8A 2EHTA 2FVEA 2KG9A 1BXIA 4QNBA 2CWOA 1AYIA 2KOSA 2EG5A 1M90Q 2AFEA 5BS2A 1N8RQ 2L0QA 2LTEA 2OTJP 2OTLP 2LF4A 3RG2A 2JQ4A 3G0VA 5HGLA 3VRLC 3GJNA 4NEOA 2N50A 2XZ1C 4BPGA 3CMAP 1GXGA 3G6EP 2K5XA 3NTEA 2XT1A 2PEQA 2MY5A 1YJ9P 7CEIA 4H2WC 3CPWO 2PNGA 2PY8A 2FVAA 5F2OA 2N5IA 2PEJA 1A43A 4IPYA 2QEXP 1W2BO 2QA4P 5KP6B 3CCUP 5HGOA 3DS5A 2MVVA 3CD6P 1YI2P 5EJDA 1HQBA 2PEMA 3U43A 2FAEA 1X3OA 2PEOA 4H2YC 3B5IA 1IUQA 2KGAA 4WYMA 2ONTA 1KC8Q 1F80D 3EJEA 4COPA 1M1KQ 4PH1A 1E6JP 4COCA 2N5HA 1ZNVA 1YJNP 1M74A 1VHNA 1S72P 3CC7P 3G29A 3CMEP 4U0CA 2K93A 2EHSA 3EJDA 3GZMA 1Q7YQ 3WBHA 4R0MA 2PEKA 2KOOA 1NQ4A 2VLNA 2JYGA 1RO2A 2KGDA 1EOQA 2X2BA 3G1GA 2EIAA 1VQ8P 1T8KA 1VQ5P 1KD1Q 5F2NA 1VQOP 1Q86Q 2GZIA 3G21A 4F37A 2BHVA 5HGMA 2N6ZA 2OARA 2AVAA 5KP7B 1OR5A 2KGCA 3NY7B 2KR5A 1FR2A 3H0DA 1QRJA 1AF8A 3GZLA 2XZ0D 5HVCA 1Z6MA 1HY8A 1ZMBA 1ACPA 1VQNP 2M8LA 2JGPA 2GYKA 3I55P 2KODA 2LIWA 3DTJA 2XXMA 3CCQP 3CCSP 2L6EA 3H47A 1Q81Q 2CNRA 3HYBA 1L0HA 2KOPA 2QNWA 2FQ2A 4H2XC 1Q82Q 2P9XA 1JJ2O 3OW2O 1AUMA 4XFZA 2JB0A 3G4SP 4BPFA 1KLPA 1CEIA 2VLOA 2WPTA 3LMOA 2E1MA 2JO0A 3RG6C 2GDYA 2BUOA 1RO0A 1VKUA 2LL8A 2MVUA 2KGEA 5KP8B 1UNKA 2NO8A 3G1IA 1K30A 3CCMP 2Z44A 2AFDA 2K92A 3P05A 2GZJA 5F2KA 3DS2A 4XROA 3CCJP 3DS0A 5DCKA 1UJZA 2GDWA 2VSQA 2N6YA 3G71P 2M5RA 4U0EA 3CXCO 2Z45A 3E2DA 5JPAA 2CQ8A 1A8OA 2MR7A 1D1DA 2AF8A 1KQSO 3CE7A
chains in the Genus database with same CATH topology
2LPKA 2KGCA 3NY7B 2K2QA 2KR5A 4BPGA 4IZ6A 1AF8A 3GZLA 2XZ0D 5HVCA 2FADA 4PWVB 1HY8A 2MY5A 1ACPA 2JGPA 2K0YA 4H2WC 2LIWA 4PXHB 2PNGA 2N98A 2FVAA 2N5IA 2FQ0A 2CNRA 2FACA 1L0HA 2DNWA 2KORA 2KOPA 2QNWA 2LKIA 2FQ1A 4MRTC 2FQ2A 2KW2A 4H2XC 5HV8A 5KP6B 2MVVA 2LOLA 2L9FA 2LMLA 1DNYA 5EJDA 1HQBA 4BPFA 2FAEA 1X3OA 4H2YC 1KLPA 2KWLA 4HKGA 2FHSC 4DG9A 2KGAA 2MF4A 2GDXA 2JU2A 4BPHA 2K94A 1F80D 3EJEA 1L0IA 3LMOA 2KOQA 2ROQA 2LIUA 2GDYA 2K0XA 2N5HA 1VKUA 2FVFA 2LL8A 2MVUA 2MR8A 2EHTA 2FVEA 2KG9A 2KGEA 5KP8B 2KOSA 2K93A 3EJBA 2EHSA 3EJDA 2AFDA 3GZMA 2K92A 2MD9A 2AFEA 4R0MA 2KG6A 2JU1A 5CZDB 2KOOA 1NQ4A 2L0QA 2LTEA 2KGDA 2KG8A 2L22A 2X2BA 3RG2A 1T8KA 2JQ4A 3CE7A 2CGQA 2L4BA 2GDWA 2VSQA 2N6YA 4NEOA 2CG5B 4CA3A 1DV5A 2M5RA 2N50A 2XZ1C 2N6ZA 2AVAA 2CQ8A 5KP7B 2MR7A 2AF8A 1OR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPK A;  2KGC A;  3NY7 B;  2K2Q A;  2KR5 A;  4BPG A;  4IZ6 A;  1AF8 A;  3GZL A;  2XZ0 D;  5HVC A;  2FAD A;  4PWV B;  1HY8 A;  2MY5 A;  1ACP A;  2JGP A;  2K0Y A;  4H2W C;  2LIW A;  4PXH B;  2PNG A;  2N98 A;  2FVA A;  2N5I A;  2FQ0 A;  2CNR A;  2FAC A;  1L0H A;  2DNW A;  2KOR A;  2KOP A;  2QNW A;  2LKI A;  2FQ1 A;  4MRT C;  2FQ2 A;  2KW2 A;  4H2X C;  5HV8 A;  5KP6 B;  2MVV A;  2LOL A;  2L9F A;  2LML A;  1DNY A;  5EJD A;  1HQB A;  4BPF A;  2FAE A;  1X3O A;  4H2Y C;  1KLP A;  2KWL A;  4HKG A;  2FHS C;  4DG9 A;  2KGA A;  2MF4 A;  2GDX A;  2JU2 A;  4BPH A;  2K94 A;  1F80 D;  3EJE A;  1L0I A;  3LMO A;  2KOQ A;  2ROQ A;  2LIU A;  2GDY A;  2K0X A;  2N5H A;  1VKU A;  2FVF A;  2LL8 A;  2MVU A;  2MR8 A;  2EHT A;  2FVE A;  2KG9 A;  2KGE A;  5KP8 B;  2KOS A;  2K93 A;  3EJB A;  2EHS A;  3EJD A;  2AFD A;  3GZM A;  2K92 A;  2MD9 A;  2AFE A;  4R0M A;  2KG6 A;  2JU1 A;  5CZD B;  2KOO A;  1NQ4 A;  2L0Q A;  2LTE A;  2KGD A;  2KG8 A;  2L22 A;  2X2B A;  3RG2 A;  1T8K A;  2JQ4 A;  3CE7 A;  2CGQ A;  2L4B A;  2GDW A;  2VSQ A;  2N6Y A;  4NEO A;  2CG5 B;  4CA3 A;  1DV5 A;  2M5R A;  2N50 A;  2XZ1 C;  2N6Z A;  2AVA A;  2CQ8 A;  5KP7 B;  2MR7 A;  2AF8 A;  1OR5 A; 
#chains in the Genus database with same CATH topology
 2LPK A;  2K2Q A;  3CCR P;  3B4Q A;  2Z46 A;  4PWV B;  1RNI A;  2GZE A;  1VQ7 P;  3GKL C;  1BAJ A;  3CC4 P;  4QKO A;  4GR6 A;  2FAC A;  3I56 P;  2DNW A;  2KOR A;  1VQ4 P;  2LKI A;  3H4E A;  2FQ1 A;  2KW2 A;  5HV8 A;  3DPH A;  1IMP A;  2M8N A;  2LOL A;  2LML A;  1DNY A;  1VQK P;  1M6N A;  5BS1 A;  3CCL P;  4DG9 A;  4PH0 A;  2MF4 A;  4XRQ A;  5I4T G;  2GDX A;  2JU2 A;  2K94 A;  2XV6 A;  3CCE P;  4M0I A;  2K0D X;  4U0D A;  1K73 Q;  4UHP B;  2ROQ A;  1YIJ P;  2LIU A;  1E0H A;  1GXH A;  2K0X A;  5EW5 E;  2JAZ A;  3EJB A;  4XFY A;  1VQL P;  1VQP P;  2MD9 A;  2KG6 A;  2JU1 A;  5CZD B;  2GZG A;  2JYL A;  1EMV A;  1IMQ A;  2KG8 A;  2L22 A;  1YJW P;  2CGQ A;  2L4B A;  2EFJ A;  2VLQ A;  2CG5 B;  4CA3 A;  1DV5 A;  3DS3 A;  4U0B A;  5HGN A;  1EIA A;  2M8P A;  1VQM P;  3Q20 A;  1QVF O;  4IZ6 A;  3MGE A;  1K9M Q;  2FAD A;  4XFX A;  2DGY A;  2K0Y A;  4U0F A;  2PEI A;  4PXH B;  3M1M A;  4U0A A;  1GPJ A;  2ERH A;  4GR2 A;  2N98 A;  3CCV P;  2FQ0 A;  1VQ9 P;  1NJI Q;  3DS1 A;  1YHQ P;  1M6E X;  3LRY A;  4MRT C;  1YIT P;  2L9F A;  1MZ8 A;  3HZQ A;  2KWL A;  1VQ6 P;  4HKG A;  2FHS C;  2PEN A;  2GZF A;  3CC2 P;  1QVG O;  3DS4 A;  4BPH A;  3G26 A;  1L0I A;  3G28 A;  2KOQ A;  1K8A Q;  2JBG A;  2FVF A;  2VLP A;  2MR8 A;  2EHT A;  2FVE A;  2KG9 A;  1BXI A;  4QNB A;  2CWO A;  1AYI A;  2KOS A;  2EG5 A;  1M90 Q;  2AFE A;  5BS2 A;  1N8R Q;  2L0Q A;  2LTE A;  2OTJ P;  2OTL P;  2LF4 A;  3RG2 A;  2JQ4 A;  3G0V A;  5HGL A;  3VRL C;  3GJN A;  4NEO A;  2N50 A;  2XZ1 C;  4BPG A;  3CMA P;  1GXG A;  3G6E P;  2K5X A;  3NTE A;  2XT1 A;  2PEQ A;  2MY5 A;  1YJ9 P;  7CEI A;  4H2W C;  3CPW O;  2PNG A;  2PY8 A;  2FVA A;  5F2O A;  2N5I A;  2PEJ A;  1A43 A;  4IPY A;  2QEX P;  1W2B O;  2QA4 P;  5KP6 B;  3CCU P;  5HGO A;  3DS5 A;  2MVV A;  3CD6 P;  1YI2 P;  5EJD A;  1HQB A;  2PEM A;  3U43 A;  2FAE A;  1X3O A;  2PEO A;  4H2Y C;  3B5I A;  1IUQ A;  2KGA A;  4WYM A;  2ONT A;  1KC8 Q;  1F80 D;  3EJE A;  4COP A;  1M1K Q;  4PH1 A;  1E6J P;  4COC A;  2N5H A;  1ZNV A;  1YJN P;  1M74 A;  1VHN A;  1S72 P;  3CC7 P;  3G29 A;  3CME P;  4U0C A;  2K93 A;  2EHS A;  3EJD A;  3GZM A;  1Q7Y Q;  3WBH A;  4R0M A;  2PEK A;  2KOO A;  1NQ4 A;  2VLN A;  2JYG A;  1RO2 A;  2KGD A;  1EOQ A;  2X2B A;  3G1G A;  2EIA A;  1VQ8 P;  1T8K A;  1VQ5 P;  1KD1 Q;  5F2N A;  1VQO P;  1Q86 Q;  2GZI A;  3G21 A;  4F37 A;  2BHV A;  5HGM A;  2N6Z A;  2OAR A;  2AVA A;  5KP7 B;  1OR5 A;  2KGC A;  3NY7 B;  2KR5 A;  1FR2 A;  3H0D A;  1QRJ A;  1AF8 A;  3GZL A;  2XZ0 D;  5HVC A;  1Z6M A;  1HY8 A;  1ZMB A;  1ACP A;  1VQN P;  2M8L A;  2JGP A;  2GYK A;  3I55 P;  2KOD A;  2LIW A;  3DTJ A;  2XXM A;  3CCQ P;  3CCS P;  2L6E A;  3H47 A;  1Q81 Q;  2CNR A;  3HYB A;  1L0H A;  2KOP A;  2QNW A;  2FQ2 A;  4H2X C;  1Q82 Q;  2P9X A;  1JJ2 O;  3OW2 O;  1AUM A;  4XFZ A;  2JB0 A;  3G4S P;  4BPF A;  1KLP A;  1CEI A;  2VLO A;  2WPT A;  3LMO A;  2E1M A;  2JO0 A;  3RG6 C;  2GDY A;  2BUO A;  1RO0 A;  1VKU A;  2LL8 A;  2MVU A;  2KGE A;  5KP8 B;  1UNK A;  2NO8 A;  3G1I A;  1K30 A;  3CCM P;  2Z44 A;  2AFD A;  2K92 A;  3P05 A;  2GZJ A;  5F2K A;  3DS2 A;  4XRO A;  3CCJ P;  3DS0 A;  5DCK A;  1UJZ A;  2GDW A;  2VSQ A;  2N6Y A;  3G71 P;  2M5R A;  4U0E A;  3CXC O;  2Z45 A;  3E2D A;  5JPA A;  2CQ8 A;  1A8O A;  2MR7 A;  1D1D A;  2AF8 A;  1KQS O;  3CE7 A; 
#chains in the Genus database with same CATH homology
 2LPK A;  2KGC A;  3NY7 B;  2K2Q A;  2KR5 A;  4BPG A;  4IZ6 A;  1AF8 A;  3GZL A;  2XZ0 D;  5HVC A;  2FAD A;  4PWV B;  1HY8 A;  2MY5 A;  1ACP A;  2JGP A;  2K0Y A;  4H2W C;  2LIW A;  4PXH B;  2PNG A;  2N98 A;  2FVA A;  2N5I A;  2FQ0 A;  2CNR A;  2FAC A;  1L0H A;  2DNW A;  2KOR A;  2KOP A;  2QNW A;  2LKI A;  2FQ1 A;  4MRT C;  2FQ2 A;  2KW2 A;  4H2X C;  5HV8 A;  5KP6 B;  2MVV A;  2LOL A;  2L9F A;  2LML A;  1DNY A;  5EJD A;  1HQB A;  4BPF A;  2FAE A;  1X3O A;  4H2Y C;  1KLP A;  2KWL A;  4HKG A;  2FHS C;  4DG9 A;  2KGA A;  2MF4 A;  2GDX A;  2JU2 A;  4BPH A;  2K94 A;  1F80 D;  3EJE A;  1L0I A;  3LMO A;  2KOQ A;  2ROQ A;  2LIU A;  2GDY A;  2K0X A;  2N5H A;  1VKU A;  2FVF A;  2LL8 A;  2MVU A;  2MR8 A;  2EHT A;  2FVE A;  2KG9 A;  2KGE A;  5KP8 B;  2KOS A;  2K93 A;  3EJB A;  2EHS A;  3EJD A;  2AFD A;  3GZM A;  2K92 A;  2MD9 A;  2AFE A;  4R0M A;  2KG6 A;  2JU1 A;  5CZD B;  2KOO A;  1NQ4 A;  2L0Q A;  2LTE A;  2KGD A;  2KG8 A;  2L22 A;  2X2B A;  3RG2 A;  1T8K A;  2JQ4 A;  3CE7 A;  2CGQ A;  2L4B A;  2GDW A;  2VSQ A;  2N6Y A;  4NEO A;  2CG5 B;  4CA3 A;  1DV5 A;  2M5R A;  2N50 A;  2XZ1 C;  2N6Z A;  2AVA A;  2CQ8 A;  5KP7 B;  2MR7 A;  2AF8 A;  1OR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...