2MR8A

Holo structure of the peptidyl carrier protein domain 7 of the teicoplanin producing non-ribosomal peptide synthetase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
91
structure length
91
Chain Sequence
GAMAKAPESATEKVLCALYAEILGVERVGVDDAFHDLGGSSALAMRLIARIREELGVDLPIRQLFSSPTPAGVARALAAKSASWSHPQFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the terminal PCP domain of the non-ribosomal peptide synthetase in teicoplanin biosynthesis.
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Biosynthetic protein
molecule keywords Non-ribosomal peptide synthetase
total genus 25
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2mr8A00
2KORA 1T8KA 2KOOA 2KWLA 1DV5A 1X3OA 2KW2A 2LOLA 4BPGA 3EJEA 3EJDA 2L4BA 4NEOA 5HVCA 2KGEA 2KG8A 4MRTC 2X2BA 2M5RA 2LTEA 2FACA 2MVUA 2QNWA 2MD9A 2DNWA 2FADA 4PXHB 2FVEA 1NQ4A 1DNYA 2AVAA 2FQ0A 2AFEA 2KGAA 2K94A 3LMOA 2JQ4A 1HY8A 2LPKA 2AFDA 2KR5A 5KP8B 4HKGA 2MR8A 3NY7B 1VKUA 2N98A 1KLPA 2K0YA 2N50A 4H2WC 2KOPA 2K93A 4H2YC 2FAEA 2AF8A 2L22A 4CA3A 4R0MA 2CGQA 2LL8A 4IZ6A 4BPHA 2KG9A 2CQ8A 2CNRA 2KGCA 2MVVA 2GDWA 1L0IA 5EJDA 2ROQA 2JU2A 2EHTA 5HV8A 1ACPA 2MF4A 2FHSC 3EJBA 2LKIA 3RG2A 4DG9A 2MY5A 2KOQA 2KG6A 2FVFA 2LMLA 4PWVB 1HQBA 3GZMA 2EHSA 2FQ2A 2KGDA 2CG5B 2JU1A 5KP7B 2LIWA 2N5HA 3GZLA 4BPFA 1F80D 4H2XC 2LIUA 3CE7A 2K92A 2K0XA 2FQ1A 1OR5A 2PNGA 2K2QA 2N6YA 2N5IA 2GDYA 2L0QA 2XZ0D 5CZDB 1AF8A 2L9FA 2JGPA 1L0HA 2XZ1C 2N6ZA 2GDXA 5KP6B 2KOSA 2VSQA 2FVAA 2MR7A
chains in the Genus database with same CATH superfamily
2KWLA 1DV5A 5BS2A 2WPTA 3EJDA 3G1GA 5HVCA 1KC8Q 4XFXA 2LF4A 2FACA 2MVUA 2DNWA 2M8NA 4PXHB 1NQ4A 1BAJA 2FQ0A 2JO0A 3B5IA 3VRLC 1W2BO 2JQ4A 2LPKA 3GKLC 1M90Q 4HKGA 3NY7B 1VKUA 1YI2P 2OTLP 1VQ8P 2VLOA 4H2YC 2Z46A 4BPHA 3E2DA 1K9MQ 1ZMBA 2CQ8A 2KGCA 3H4EA 2EFJA 2PEIA 2MF4A 3B4QA 3EJBA 3CCSP 2PY8A 3RG2A 3I55P 3G21A 3I56P 1VQKP 4PWVB 3GZMA 2JU1A 3DS0A 3GZLA 2PEQA 4H2XC 2LIUA 2K92A 1VQOP 2GYKA 1M1KQ 4PH1A 1VQLP 2PNGA 3U43A 3DS4A 2N5IA 2XZ0D 4COCA 5CZDB 1M6EX 1GXGA 1EOQA 5HGLA 3G6EP 4U0AA 2DGYA 3G28A 1Q82Q 1VQ9P 2LOLA 1EMVA 4BPGA 3EJEA 2JB0A 1QRJA 2X2BA 2M5RA 4WYMA 3Q20A 1YJWP 2M8LA 2MD9A 3DS2A 1DNYA 3CC7P 1Q86Q 5HGMA 1VQ4P 2KGAA 3CCVP 2K94A 3LMOA 2GZJA 2AFDA 5KP8B 2E1MA 5I4TG 1KLPA 3GJNA 2K0YA 3CMAP 4H2WC 2KODA 2FAEA 2AF8A 2CGQA 2LL8A 1AUMA 2PEOA 5DCKA 2KG9A 2PEJA 1Z6MA 4UHPB 1K73Q 1YIJP 2OTJP 2ROQA 2M8PA 3DS3A 3H0DA 1E6JP 1VHNA 2EHTA 5HV8A 2FHSC 4XRQA 2P9XA 2LMLA 3HZQA 1HQBA 2ERHA 2EHSA 2KGDA 2VLPA 2CG5B 2XT1A 2N5HA 2VLNA 2Z45A 4BPFA 1F80D 2K0XA 1OR5A 2BUOA 1RO0A 3CD6P 1RNIA 2N6YA 2L0QA 3CCQP 4F37A 5KP6B 2GZGA 2KOSA 2KORA 1T8KA 2KOOA 4U0CA 2L4BA 1N8RQ 4U0FA 1QVGO 4MRTC 1AYIA 1CEIA 1UNKA 2QNWA 1VQNP 4U0DA 2VLQA 2FVEA 2PEKA 1EIAA 2AVAA 2AFEA 3M1MA 2XXMA 2CWOA 1RO2A 3CCLP 3G26A 2MR8A 2N50A 1A8OA 3G1IA 2KOPA 1UJZA 4R0MA 3P05A 1M6NA 1VQPP 1KD1Q 3DPHA 3DTJA 2GDWA 2GZFA 4XFZA 2JU2A 1M74A 5EW5E 2QEXP 2L6EA 4DG9A 2MY5A 3RG6C 2KOQA 3CMEP 4U0EA 2FVFA 1ZNVA 1A43A 2NO8A 3CCUP 2BHVA 1IMQA 1YHQP 2LIWA 4GR2A 4XROA 2PEMA 2GZIA 3OW2O 2FQ1A 3NTEA 1IMPA 1YJ9P 1D1DA 3CCMP 2Z44A 5F2KA 1YITP 4COPA 1K8AQ 4QKOA 1E0HA 2JYGA 2L9FA 3HYBA 3G29A 3CXCO 1FR2A 1L0HA 1KQSO 2XZ1C 2GDXA 1VQMP 4QNBA 3CC2P 2VSQA 1GPJA 2GZEA 1X3OA 2KW2A 3CCJP 2JYLA 1Q81Q 3G0VA 4NEOA 2ONTA 2KGEA 2KG8A 2LTEA 1K30A 1JJ2O 1QVFO 2FADA 3CPWO 1MZ8A 4IPYA 3G4SP 3WBHA 3CCEP 1HY8A 2XV6A 1YJNP 2KR5A 1S72P 2N98A 4GR6A 1Q7YQ 5JPAA 2K93A 4CA3A 2L22A 4IZ6A 2JAZA 2JBGA 1BXIA 2CNRA 5F2NA 2MVVA 2EIAA 1VQ7P 1L0IA 5EJDA 2K0DX 3LRYA 1ACPA 4PH0A 2LKIA 5F2OA 3CC4P 2KG6A 1GXHA 2PENA 3G71P 3MGEA 5HGOA 2FQ2A 5HGNA 4XFYA 3H47A 5KP7B 1IUQA 2OARA 3CE7A 1VQ5P 3DS1A 3DS5A 2QA4P 2K2QA 4U0BA 2GDYA 1AF8A 2JGPA 3CCRP 4M0IA 1VQ6P 2N6ZA 1NJIQ 2EG5A 5BS1A 7CEIA 2FVAA 2MR7A 2K5XA
chains in the Genus database with same CATH topology
2KORA 1T8KA 2KOOA 2KWLA 1DV5A 1X3OA 2KW2A 2LOLA 4BPGA 3EJEA 3EJDA 2L4BA 4NEOA 5HVCA 2KGEA 2KG8A 4MRTC 2X2BA 2M5RA 2LTEA 2FACA 2MVUA 2QNWA 2MD9A 2DNWA 2FADA 4PXHB 2FVEA 1NQ4A 1DNYA 2AVAA 2FQ0A 2AFEA 2KGAA 2K94A 3LMOA 2JQ4A 1HY8A 2LPKA 2AFDA 2KR5A 5KP8B 4HKGA 2MR8A 3NY7B 1VKUA 2N98A 1KLPA 2K0YA 2N50A 4H2WC 2KOPA 2K93A 4H2YC 2FAEA 2AF8A 2L22A 4CA3A 4R0MA 2CGQA 2LL8A 4IZ6A 4BPHA 2KG9A 2CQ8A 2CNRA 2KGCA 2MVVA 2GDWA 1L0IA 5EJDA 2ROQA 2JU2A 2EHTA 5HV8A 1ACPA 2MF4A 2FHSC 3EJBA 2LKIA 3RG2A 4DG9A 2MY5A 2KOQA 2KG6A 2FVFA 2LMLA 4PWVB 1HQBA 3GZMA 2EHSA 2FQ2A 2KGDA 2CG5B 2JU1A 5KP7B 2LIWA 2N5HA 3GZLA 4BPFA 1F80D 4H2XC 2LIUA 3CE7A 2K92A 2K0XA 2FQ1A 1OR5A 2PNGA 2K2QA 2N6YA 2N5IA 2GDYA 2L0QA 2XZ0D 5CZDB 1AF8A 2L9FA 2JGPA 1L0HA 2XZ1C 2N6ZA 2GDXA 5KP6B 2KOSA 2VSQA 2FVAA 2MR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOR A;  1T8K A;  2KOO A;  2KWL A;  1DV5 A;  1X3O A;  2KW2 A;  2LOL A;  4BPG A;  3EJE A;  3EJD A;  2L4B A;  4NEO A;  5HVC A;  2KGE A;  2KG8 A;  4MRT C;  2X2B A;  2M5R A;  2LTE A;  2FAC A;  2MVU A;  2QNW A;  2MD9 A;  2DNW A;  2FAD A;  4PXH B;  2FVE A;  1NQ4 A;  1DNY A;  2AVA A;  2FQ0 A;  2AFE A;  2KGA A;  2K94 A;  3LMO A;  2JQ4 A;  1HY8 A;  2LPK A;  2AFD A;  2KR5 A;  5KP8 B;  4HKG A;  2MR8 A;  3NY7 B;  1VKU A;  2N98 A;  1KLP A;  2K0Y A;  2N50 A;  4H2W C;  2KOP A;  2K93 A;  4H2Y C;  2FAE A;  2AF8 A;  2L22 A;  4CA3 A;  4R0M A;  2CGQ A;  2LL8 A;  4IZ6 A;  4BPH A;  2KG9 A;  2CQ8 A;  2CNR A;  2KGC A;  2MVV A;  2GDW A;  1L0I A;  5EJD A;  2ROQ A;  2JU2 A;  2EHT A;  5HV8 A;  1ACP A;  2MF4 A;  2FHS C;  3EJB A;  2LKI A;  3RG2 A;  4DG9 A;  2MY5 A;  2KOQ A;  2KG6 A;  2FVF A;  2LML A;  4PWV B;  1HQB A;  3GZM A;  2EHS A;  2FQ2 A;  2KGD A;  2CG5 B;  2JU1 A;  5KP7 B;  2LIW A;  2N5H A;  3GZL A;  4BPF A;  1F80 D;  4H2X C;  2LIU A;  3CE7 A;  2K92 A;  2K0X A;  2FQ1 A;  1OR5 A;  2PNG A;  2K2Q A;  2N6Y A;  2N5I A;  2GDY A;  2L0Q A;  2XZ0 D;  5CZD B;  1AF8 A;  2L9F A;  2JGP A;  1L0H A;  2XZ1 C;  2N6Z A;  2GDX A;  5KP6 B;  2KOS A;  2VSQ A;  2FVA A;  2MR7 A; 
#chains in the Genus database with same CATH topology
 2KWL A;  1DV5 A;  5BS2 A;  2WPT A;  3EJD A;  3G1G A;  5HVC A;  1KC8 Q;  4XFX A;  2LF4 A;  2FAC A;  2MVU A;  2DNW A;  2M8N A;  4PXH B;  1NQ4 A;  1BAJ A;  2FQ0 A;  2JO0 A;  3B5I A;  3VRL C;  1W2B O;  2JQ4 A;  2LPK A;  3GKL C;  1M90 Q;  4HKG A;  3NY7 B;  1VKU A;  1YI2 P;  2OTL P;  1VQ8 P;  2VLO A;  4H2Y C;  2Z46 A;  4BPH A;  3E2D A;  1K9M Q;  1ZMB A;  2CQ8 A;  2KGC A;  3H4E A;  2EFJ A;  2PEI A;  2MF4 A;  3B4Q A;  3EJB A;  3CCS P;  2PY8 A;  3RG2 A;  3I55 P;  3G21 A;  3I56 P;  1VQK P;  4PWV B;  3GZM A;  2JU1 A;  3DS0 A;  3GZL A;  2PEQ A;  4H2X C;  2LIU A;  2K92 A;  1VQO P;  2GYK A;  1M1K Q;  4PH1 A;  1VQL P;  2PNG A;  3U43 A;  3DS4 A;  2N5I A;  2XZ0 D;  4COC A;  5CZD B;  1M6E X;  1GXG A;  1EOQ A;  5HGL A;  3G6E P;  4U0A A;  2DGY A;  3G28 A;  1Q82 Q;  1VQ9 P;  2LOL A;  1EMV A;  4BPG A;  3EJE A;  2JB0 A;  1QRJ A;  2X2B A;  2M5R A;  4WYM A;  3Q20 A;  1YJW P;  2M8L A;  2MD9 A;  3DS2 A;  1DNY A;  3CC7 P;  1Q86 Q;  5HGM A;  1VQ4 P;  2KGA A;  3CCV P;  2K94 A;  3LMO A;  2GZJ A;  2AFD A;  5KP8 B;  2E1M A;  5I4T G;  1KLP A;  3GJN A;  2K0Y A;  3CMA P;  4H2W C;  2KOD A;  2FAE A;  2AF8 A;  2CGQ A;  2LL8 A;  1AUM A;  2PEO A;  5DCK A;  2KG9 A;  2PEJ A;  1Z6M A;  4UHP B;  1K73 Q;  1YIJ P;  2OTJ P;  2ROQ A;  2M8P A;  3DS3 A;  3H0D A;  1E6J P;  1VHN A;  2EHT A;  5HV8 A;  2FHS C;  4XRQ A;  2P9X A;  2LML A;  3HZQ A;  1HQB A;  2ERH A;  2EHS A;  2KGD A;  2VLP A;  2CG5 B;  2XT1 A;  2N5H A;  2VLN A;  2Z45 A;  4BPF A;  1F80 D;  2K0X A;  1OR5 A;  2BUO A;  1RO0 A;  3CD6 P;  1RNI A;  2N6Y A;  2L0Q A;  3CCQ P;  4F37 A;  5KP6 B;  2GZG A;  2KOS A;  2KOR A;  1T8K A;  2KOO A;  4U0C A;  2L4B A;  1N8R Q;  4U0F A;  1QVG O;  4MRT C;  1AYI A;  1CEI A;  1UNK A;  2QNW A;  1VQN P;  4U0D A;  2VLQ A;  2FVE A;  2PEK A;  1EIA A;  2AVA A;  2AFE A;  3M1M A;  2XXM A;  2CWO A;  1RO2 A;  3CCL P;  3G26 A;  2MR8 A;  2N50 A;  1A8O A;  3G1I A;  2KOP A;  1UJZ A;  4R0M A;  3P05 A;  1M6N A;  1VQP P;  1KD1 Q;  3DPH A;  3DTJ A;  2GDW A;  2GZF A;  4XFZ A;  2JU2 A;  1M74 A;  5EW5 E;  2QEX P;  2L6E A;  4DG9 A;  2MY5 A;  3RG6 C;  2KOQ A;  3CME P;  4U0E A;  2FVF A;  1ZNV A;  1A43 A;  2NO8 A;  3CCU P;  2BHV A;  1IMQ A;  1YHQ P;  2LIW A;  4GR2 A;  4XRO A;  2PEM A;  2GZI A;  3OW2 O;  2FQ1 A;  3NTE A;  1IMP A;  1YJ9 P;  1D1D A;  3CCM P;  2Z44 A;  5F2K A;  1YIT P;  4COP A;  1K8A Q;  4QKO A;  1E0H A;  2JYG A;  2L9F A;  3HYB A;  3G29 A;  3CXC O;  1FR2 A;  1L0H A;  1KQS O;  2XZ1 C;  2GDX A;  1VQM P;  4QNB A;  3CC2 P;  2VSQ A;  1GPJ A;  2GZE A;  1X3O A;  2KW2 A;  3CCJ P;  2JYL A;  1Q81 Q;  3G0V A;  4NEO A;  2ONT A;  2KGE A;  2KG8 A;  2LTE A;  1K30 A;  1JJ2 O;  1QVF O;  2FAD A;  3CPW O;  1MZ8 A;  4IPY A;  3G4S P;  3WBH A;  3CCE P;  1HY8 A;  2XV6 A;  1YJN P;  2KR5 A;  1S72 P;  2N98 A;  4GR6 A;  1Q7Y Q;  5JPA A;  2K93 A;  4CA3 A;  2L22 A;  4IZ6 A;  2JAZ A;  2JBG A;  1BXI A;  2CNR A;  5F2N A;  2MVV A;  2EIA A;  1VQ7 P;  1L0I A;  5EJD A;  2K0D X;  3LRY A;  1ACP A;  4PH0 A;  2LKI A;  5F2O A;  3CC4 P;  2KG6 A;  1GXH A;  2PEN A;  3G71 P;  3MGE A;  5HGO A;  2FQ2 A;  5HGN A;  4XFY A;  3H47 A;  5KP7 B;  1IUQ A;  2OAR A;  3CE7 A;  1VQ5 P;  3DS1 A;  3DS5 A;  2QA4 P;  2K2Q A;  4U0B A;  2GDY A;  1AF8 A;  2JGP A;  3CCR P;  4M0I A;  1VQ6 P;  2N6Z A;  1NJI Q;  2EG5 A;  5BS1 A;  7CEI A;  2FVA A;  2MR7 A;  2K5X A; 
#chains in the Genus database with same CATH homology
 2KOR A;  1T8K A;  2KOO A;  2KWL A;  1DV5 A;  1X3O A;  2KW2 A;  2LOL A;  4BPG A;  3EJE A;  3EJD A;  2L4B A;  4NEO A;  5HVC A;  2KGE A;  2KG8 A;  4MRT C;  2X2B A;  2M5R A;  2LTE A;  2FAC A;  2MVU A;  2QNW A;  2MD9 A;  2DNW A;  2FAD A;  4PXH B;  2FVE A;  1NQ4 A;  1DNY A;  2AVA A;  2FQ0 A;  2AFE A;  2KGA A;  2K94 A;  3LMO A;  2JQ4 A;  1HY8 A;  2LPK A;  2AFD A;  2KR5 A;  5KP8 B;  4HKG A;  2MR8 A;  3NY7 B;  1VKU A;  2N98 A;  1KLP A;  2K0Y A;  2N50 A;  4H2W C;  2KOP A;  2K93 A;  4H2Y C;  2FAE A;  2AF8 A;  2L22 A;  4CA3 A;  4R0M A;  2CGQ A;  2LL8 A;  4IZ6 A;  4BPH A;  2KG9 A;  2CQ8 A;  2CNR A;  2KGC A;  2MVV A;  2GDW A;  1L0I A;  5EJD A;  2ROQ A;  2JU2 A;  2EHT A;  5HV8 A;  1ACP A;  2MF4 A;  2FHS C;  3EJB A;  2LKI A;  3RG2 A;  4DG9 A;  2MY5 A;  2KOQ A;  2KG6 A;  2FVF A;  2LML A;  4PWV B;  1HQB A;  3GZM A;  2EHS A;  2FQ2 A;  2KGD A;  2CG5 B;  2JU1 A;  5KP7 B;  2LIW A;  2N5H A;  3GZL A;  4BPF A;  1F80 D;  4H2X C;  2LIU A;  3CE7 A;  2K92 A;  2K0X A;  2FQ1 A;  1OR5 A;  2PNG A;  2K2Q A;  2N6Y A;  2N5I A;  2GDY A;  2L0Q A;  2XZ0 D;  5CZD B;  1AF8 A;  2L9F A;  2JGP A;  1L0H A;  2XZ1 C;  2N6Z A;  2GDX A;  5KP6 B;  2KOS A;  2VSQ A;  2FVA A;  2MR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...