1UJZA

Crystal structure of the e7_c/im7_c complex; a computationally designed interface between the colicin e7 dnase and the im7 immunity protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
b'MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLYVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Designed Colicin E7 immunity protein
publication title Computational redesign of protein-protein interaction specificity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system
total genus 30
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1ujzA00
2GZEA 1ZNVA 1EMVA 4QKOA 1IMPA 1CEIA 2K0DX 2JBGA 2GZJA 3GKLC 2NO8A 2K5XA 2JB0A 2VLQA 4UHPB 5EW5E 1E0HA 2WPTA 1GXHA 1IMQA 2GYKA 1FR2A 1GXGA 2GZGA 2VLNA 2JAZA 1UNKA 1BXIA 1UJZA 2VLOA 2VLPA 7CEIA 3GJNA 1MZ8A 2GZIA 4F37A 3U43A 2GZFA 2ERHA 1AYIA
chains in the Genus database with same CATH superfamily
2JYGA 3CCRP 2KGCA 4U0BA 5F2OA 3DS1A 1VQ7P 2EHTA 3DPHA 3H0DA 3H4EA 1K9MQ 4PH1A 2BUOA 1UNKA 1BXIA 5DCKA 4CA3A 1VQMP 4R0MA 2FADA 1ZNVA 2K0DX 2L4BA 2LOLA 2K2QA 2GDWA 3CMAP 2VSQA 2MR7A 2LTEA 2Z45A 1VQ9P 3DS0A 1EIAA 2KWLA 5HGLA 2KGEA 2KW2A 4U0DA 1GXGA 1DV5A 2VLOA 2BHVA 3E2DA 2CG5B 4XFZA 2XV6A 2FHSC 1AYIA 2CNRA 1YITP 1HQBA 3WBHA 5F2NA 1VQNP 2PEJA 1BAJA 2MF4A 1Q81Q 4XFXA 5HVCA 2M8LA 2MY5A 1M74A 3OW2O 1A43A 1MZ8A 2KOSA 2KGAA 1VQLP 1Q86Q 2JQ4A 4IZ6A 5HGOA 1N8RQ 3GZMA 3DS5A 2L9FA 2GYKA 4BPFA 1QVGO 4PWVB 3CXCO 2VLNA 2EG5A 1VQ5P 2KG8A 3CCLP 2K93A 2KOOA 3G21A 3U43A 3P05A 2K0XA 2FACA 4U0AA 2LKIA 3CCQP 2KG9A 2VLQA 5EW5E 4H2YC 4XFYA 5JPAA 4COPA 4MRTC 2Z46A 3CCEP 2EFJA 1M90Q 2XZ1C 2LL8A 2FVEA 2M5RA 3G6EP 2OTJP 1Q7YQ 2K5XA 2LF4A 2PEOA 1KD1Q 5CZDB 3G1IA 2JAZA 2PEIA 2PNGA 1YJWP 1K73Q 1F80D 2CQ8A 1CEIA 1L0HA 2AVAA 1ZMBA 1GPJA 1D1DA 2K94A 3EJBA 3LRYA 2DGYA 4GR6A 3CC7P 3VRLC 1VQ8P 2WPTA 1GXHA 2FVFA 2M8NA 1AF8A 4NEOA 3RG2A 2PENA 2CWOA 2KG6A 2ERHA 2DNWA 5I4TG 2FQ0A 3Q20A 2N5IA 3CMEP 1M6EX 4QKOA 1AUMA 2PY8A 2KOQA 2K92A 5HGMA 2JU2A 1NJIQ 1KC8Q 4BPHA 1K8AQ 2QEXP 1M1KQ 1IMQA 2LIWA 1Q82Q 4U0FA 2EIAA 2EHSA 1VQ4P 2Z44A 2LMLA 1JJ2O 1RNIA 5HGNA 1IMPA 2AFDA 3NTEA 2JU1A 3HYBA 3MGEA 3LMOA 2JGPA 2ROQA 3I56P 1E6JP 2ONTA 5HV8A 3DS4A 3G71P 3CPWO 1UJZA 3G0VA 1W2BO 2L22A 2M8PA 2KODA 4U0EA 2KOPA 5BS1A 3B4QA 2XZ0D 3DS3A 1VHNA 4QNBA 1EOQA 1X3OA 3H47A 3CCSP 2KGDA 3M1MA 2LIUA 3B5IA 3HZQA 2N6YA 2FQ1A 4U0CA 3EJEA 4M0IA 7CEIA 3G1GA 1KQSO 2GZEA 2MVUA 2PEMA 2QNWA 1YJNP 1RO0A 2XT1A 2JO0A 1IUQA 1ACPA 2PEKA 3GZLA 1VQOP 4H2XC 1K30A 1OR5A 1T8KA 3CC2P 1S72P 5EJDA 1A8OA 2NO8A 4PH0A 1DNYA 2X2BA 2KR5A 3CE7A 5KP8B 1L0IA 1FR2A 2GZGA 3RG6C 1VQKP 3GJNA 2N5HA 2KORA 2XXMA 1EMVA 2N98A 3G26A 2OTLP 4GR2A 4BPGA 2K0YA 4WYMA 4XRQA 2N50A 1E0HA 1VQ6P 2E1MA 1QVFO 2L6EA 2VLPA 1HY8A 3EJDA 2GZIA 1VQPP 1RO2A 2CGQA 3CC4P 2L0QA 1VKUA 1QRJA 2MD9A 3G29A 5KP7B 5BS2A 4PXHB 2GDYA 4HKGA 2AFEA 2FQ2A 4H2WC 4XROA 2JBGA 3NY7B 2GZJA 4IPYA 2OARA 2QA4P 2LPKA 2JB0A 4UHPB 2JYLA 1YIJP 3CCUP 1YJ9P 3G28A 3G4SP 1KLPA 2P9XA 2N6ZA 3I55P 2GDXA 4F37A 1NQ4A 1YHQP 3CCMP 2PEQA 2MVVA 1YI2P 3DS2A 5F2KA 3GKLC 5KP6B 3DTJA 3CCVP 1Z6MA 2FAEA 4COCA 2AF8A 1M6NA 3CCJP 2MR8A 3CD6P 2FVAA 4DG9A 2GZFA
chains in the Genus database with same CATH topology
2GZEA 1ZNVA 1EMVA 4QKOA 1IMPA 1CEIA 2K0DX 2JBGA 2GZJA 3GKLC 2NO8A 2K5XA 2JB0A 2VLQA 4UHPB 5EW5E 1E0HA 2WPTA 1GXHA 1IMQA 2GYKA 1FR2A 1GXGA 2GZGA 2VLNA 2JAZA 1UNKA 1BXIA 1UJZA 2VLOA 2VLPA 7CEIA 3GJNA 1MZ8A 2GZIA 4F37A 3U43A 2GZFA 2ERHA 1AYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZE A;  1ZNV A;  1EMV A;  4QKO A;  1IMP A;  1CEI A;  2K0D X;  2JBG A;  2GZJ A;  3GKL C;  2NO8 A;  2K5X A;  2JB0 A;  2VLQ A;  4UHP B;  5EW5 E;  1E0H A;  2WPT A;  1GXH A;  1IMQ A;  2GYK A;  1FR2 A;  1GXG A;  2GZG A;  2VLN A;  2JAZ A;  1UNK A;  1BXI A;  1UJZ A;  2VLO A;  2VLP A;  7CEI A;  3GJN A;  1MZ8 A;  2GZI A;  4F37 A;  3U43 A;  2GZF A;  2ERH A;  1AYI A; 
#chains in the Genus database with same CATH topology
 2JYG A;  3CCR P;  2KGC A;  4U0B A;  5F2O A;  3DS1 A;  1VQ7 P;  2EHT A;  3DPH A;  3H0D A;  3H4E A;  1K9M Q;  4PH1 A;  2BUO A;  1UNK A;  1BXI A;  5DCK A;  4CA3 A;  1VQM P;  4R0M A;  2FAD A;  1ZNV A;  2K0D X;  2L4B A;  2LOL A;  2K2Q A;  2GDW A;  3CMA P;  2VSQ A;  2MR7 A;  2LTE A;  2Z45 A;  1VQ9 P;  3DS0 A;  1EIA A;  2KWL A;  5HGL A;  2KGE A;  2KW2 A;  4U0D A;  1GXG A;  1DV5 A;  2VLO A;  2BHV A;  3E2D A;  2CG5 B;  4XFZ A;  2XV6 A;  2FHS C;  1AYI A;  2CNR A;  1YIT P;  1HQB A;  3WBH A;  5F2N A;  1VQN P;  2PEJ A;  1BAJ A;  2MF4 A;  1Q81 Q;  4XFX A;  5HVC A;  2M8L A;  2MY5 A;  1M74 A;  3OW2 O;  1A43 A;  1MZ8 A;  2KOS A;  2KGA A;  1VQL P;  1Q86 Q;  2JQ4 A;  4IZ6 A;  5HGO A;  1N8R Q;  3GZM A;  3DS5 A;  2L9F A;  2GYK A;  4BPF A;  1QVG O;  4PWV B;  3CXC O;  2VLN A;  2EG5 A;  1VQ5 P;  2KG8 A;  3CCL P;  2K93 A;  2KOO A;  3G21 A;  3U43 A;  3P05 A;  2K0X A;  2FAC A;  4U0A A;  2LKI A;  3CCQ P;  2KG9 A;  2VLQ A;  5EW5 E;  4H2Y C;  4XFY A;  5JPA A;  4COP A;  4MRT C;  2Z46 A;  3CCE P;  2EFJ A;  1M90 Q;  2XZ1 C;  2LL8 A;  2FVE A;  2M5R A;  3G6E P;  2OTJ P;  1Q7Y Q;  2K5X A;  2LF4 A;  2PEO A;  1KD1 Q;  5CZD B;  3G1I A;  2JAZ A;  2PEI A;  2PNG A;  1YJW P;  1K73 Q;  1F80 D;  2CQ8 A;  1CEI A;  1L0H A;  2AVA A;  1ZMB A;  1GPJ A;  1D1D A;  2K94 A;  3EJB A;  3LRY A;  2DGY A;  4GR6 A;  3CC7 P;  3VRL C;  1VQ8 P;  2WPT A;  1GXH A;  2FVF A;  2M8N A;  1AF8 A;  4NEO A;  3RG2 A;  2PEN A;  2CWO A;  2KG6 A;  2ERH A;  2DNW A;  5I4T G;  2FQ0 A;  3Q20 A;  2N5I A;  3CME P;  1M6E X;  4QKO A;  1AUM A;  2PY8 A;  2KOQ A;  2K92 A;  5HGM A;  2JU2 A;  1NJI Q;  1KC8 Q;  4BPH A;  1K8A Q;  2QEX P;  1M1K Q;  1IMQ A;  2LIW A;  1Q82 Q;  4U0F A;  2EIA A;  2EHS A;  1VQ4 P;  2Z44 A;  2LML A;  1JJ2 O;  1RNI A;  5HGN A;  1IMP A;  2AFD A;  3NTE A;  2JU1 A;  3HYB A;  3MGE A;  3LMO A;  2JGP A;  2ROQ A;  3I56 P;  1E6J P;  2ONT A;  5HV8 A;  3DS4 A;  3G71 P;  3CPW O;  1UJZ A;  3G0V A;  1W2B O;  2L22 A;  2M8P A;  2KOD A;  4U0E A;  2KOP A;  5BS1 A;  3B4Q A;  2XZ0 D;  3DS3 A;  1VHN A;  4QNB A;  1EOQ A;  1X3O A;  3H47 A;  3CCS P;  2KGD A;  3M1M A;  2LIU A;  3B5I A;  3HZQ A;  2N6Y A;  2FQ1 A;  4U0C A;  3EJE A;  4M0I A;  7CEI A;  3G1G A;  1KQS O;  2GZE A;  2MVU A;  2PEM A;  2QNW A;  1YJN P;  1RO0 A;  2XT1 A;  2JO0 A;  1IUQ A;  1ACP A;  2PEK A;  3GZL A;  1VQO P;  4H2X C;  1K30 A;  1OR5 A;  1T8K A;  3CC2 P;  1S72 P;  5EJD A;  1A8O A;  2NO8 A;  4PH0 A;  1DNY A;  2X2B A;  2KR5 A;  3CE7 A;  5KP8 B;  1L0I A;  1FR2 A;  2GZG A;  3RG6 C;  1VQK P;  3GJN A;  2N5H A;  2KOR A;  2XXM A;  1EMV A;  2N98 A;  3G26 A;  2OTL P;  4GR2 A;  4BPG A;  2K0Y A;  4WYM A;  4XRQ A;  2N50 A;  1E0H A;  1VQ6 P;  2E1M A;  1QVF O;  2L6E A;  2VLP A;  1HY8 A;  3EJD A;  2GZI A;  1VQP P;  1RO2 A;  2CGQ A;  3CC4 P;  2L0Q A;  1VKU A;  1QRJ A;  2MD9 A;  3G29 A;  5KP7 B;  5BS2 A;  4PXH B;  2GDY A;  4HKG A;  2AFE A;  2FQ2 A;  4H2W C;  4XRO A;  2JBG A;  3NY7 B;  2GZJ A;  4IPY A;  2OAR A;  2QA4 P;  2LPK A;  2JB0 A;  4UHP B;  2JYL A;  1YIJ P;  3CCU P;  1YJ9 P;  3G28 A;  3G4S P;  1KLP A;  2P9X A;  2N6Z A;  3I55 P;  2GDX A;  4F37 A;  1NQ4 A;  1YHQ P;  3CCM P;  2PEQ A;  2MVV A;  1YI2 P;  3DS2 A;  5F2K A;  3GKL C;  5KP6 B;  3DTJ A;  3CCV P;  1Z6M A;  2FAE A;  4COC A;  2AF8 A;  1M6N A;  3CCJ P;  2MR8 A;  3CD6 P;  2FVA A;  4DG9 A;  2GZF A; 
#chains in the Genus database with same CATH homology
 2GZE A;  1ZNV A;  1EMV A;  4QKO A;  1IMP A;  1CEI A;  2K0D X;  2JBG A;  2GZJ A;  3GKL C;  2NO8 A;  2K5X A;  2JB0 A;  2VLQ A;  4UHP B;  5EW5 E;  1E0H A;  2WPT A;  1GXH A;  1IMQ A;  2GYK A;  1FR2 A;  1GXG A;  2GZG A;  2VLN A;  2JAZ A;  1UNK A;  1BXI A;  1UJZ A;  2VLO A;  2VLP A;  7CEI A;  3GJN A;  1MZ8 A;  2GZI A;  4F37 A;  3U43 A;  2GZF A;  2ERH A;  1AYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...