1UJZA

Crystal structure of the e7_c/im7_c complex; a computationally designed interface between the colicin e7 dnase and the im7 immunity protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLYVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Designed Colicin E7 immunity protein
publication title Computational redesign of protein-protein interaction specificity
pubmed doi rcsb
source organism Escherichia coli
total genus 30
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1ujzA00
2VLPA 1ZNVA 1UNKA 2GYKA 2JBGA 2WPTA 1IMPA 2GZEA 1UJZA 2GZJA 2JB0A 1IMQA 2K5XA 2VLOA 3GJNA 2ERHA 1E0HA 5EW5E 1GXGA 1EMVA 2JAZA 2NO8A 2VLQA 4UHPB 7CEIA 1GXHA 2GZGA 2GZFA 2VLNA 1MZ8A 2GZIA 4QKOA 3GKLC 2K0DX 3U43A 1BXIA 1FR2A 4F37A 1CEIA 1AYIA
chains in the Genus database with same CATH superfamily
1D1DA 2L0QA 2WPTA 1K8AQ 3I56P 1VQ9P 1IMQA 2N5IA 2GDWA 4QNBA 2GDYA 2PENA 2E1MA 4H2XC 2OTJP 1VQPP 4BPFA 2PEIA 4IZ6A 4XRQA 5HVCA 4F37A 3G28A 3OW2O 2DNWA 1KD1Q 1K73Q 3GZMA 3HZQA 1ZNVA 2OARA 2JBGA 2KWLA 1T8KA 2KGAA 4IPYA 1E0HA 1GXGA 3H47A 1AUMA 4DG9A 3I55P 3EJEA 2PEOA 1K9MQ 2FQ0A 1BAJA 2QNWA 1YITP 2LF4A 4R0MA 2M8LA 2BUOA 4COPA 5CZDB 5EJDA 1YJWP 3DS2A 3Q20A 1L0HA 3LRYA 2LIWA 5HGOA 2K2QA 5JPAA 3GZLA 3CCEP 2JAZA 2LOLA 2NO8A 3VRLC 2JO0A 1K30A 1M74A 3GKLC 2EIAA 1AYIA 1YI2P 3CCVP 5DCKA 1QVFO 1EIAA 2AF8A 3CD6P 1A43A 1NJIQ 3DS5A 2XXMA 2LPKA 1NQ4A 2VLQA 4UHPB 3G1IA 4GR2A 2JGPA 2M5RA 2FADA 3CCMP 5BS1A 2CG5B 2N6YA 2QEXP 2MR8A 2LIUA 1VQKP 2OTLP 3CMEP 2PEKA 1OR5A 2X2BA 4U0FA 1GXHA 2DGYA 2K94A 4BPGA 3RG2A 3CC7P 4WYMA 1VQNP 2FACA 1M1KQ 2GZJA 1QRJA 1HY8A 2MR7A 2P9XA 2BHVA 2KGCA 2AFDA 1M90Q 2PEQA 1Q86Q 2MVUA 2XT1A 4U0AA 1UNKA 2EHTA 5KP8B 1Q81Q 1F80D 2KGEA 4XFYA 2KOOA 4HKGA 3CCSP 5HGNA 2Z46A 3DPHA 4U0CA 1FR2A 3G21A 2N6ZA 2FQ2A 3LMOA 4PWVB 2KW2A 2XZ1C 2GZGA 1VQ6P 1X3OA 2VSQA 2K93A 2K0DX 2KODA 1DV5A 1VQ4P 1VQLP 2PEJA 3EJBA 4NEOA 1M6EX 2K5XA 5I4TG 1KC8Q 2L9FA 2ERHA 1ZMBA 5EW5E 2N5HA 2FQ1A 1VQOP 1DNYA 2LKIA 1YJNP 2VLNA 1VKUA 5F2OA 2L4BA 3U43A 2MD9A 1VQ7P 3EJDA 3NY7B 2VLPA 3H4EA 2CQ8A 5HGMA 2LL8A 2PNGA 2KG6A 3CCQP 2K0YA 3B4QA 4H2WC 2KR5A 1YJ9P 2EFJA 2JU1A 1YHQP 1M6NA 4U0EA 1RO2A 3P05A 1KLPA 1W2BO 3G4SP 4PXHB 1Q82Q 5HGLA 1RNIA 3RG6C 4GR6A 2MY5A 2KG8A 2GYKA 5KP6B 1L0IA 4BPHA 4U0BA 4M0IA 3DS1A 2JYGA 2ROQA 3G1GA 2K92A 1EMVA 3DTJA 2AVAA 3B5IA 1RO0A 2PY8A 2K0XA 2KG9A 2N98A 4U0DA 3H0DA 2MF4A 2L6EA 1ACPA 1VQ5P 2XZ0D 2GZEA 1IMPA 1QVGO 3GJNA 1YIJP 2KORA 5KP7B 1VHNA 4H2YC 3NTEA 1VQ8P 2KOSA 5F2KA 1VQMP 2GZIA 1Z6MA 3M1MA 2FVEA 3MGEA 2FHSC 2ONTA 3CE7A 3DS3A 2PEMA 2M8PA 1GPJA 2MVVA 4MRTC 2CNRA 5F2NA 3CXCO 1EOQA 2QA4P 3WBHA 2CGQA 2FAEA 3CMAP 3CC2P 2GZFA 2GDXA 1BXIA 2EHSA 2M8NA 2N50A 1KQSO 2JU2A 2LMLA 4XROA 4CA3A 2L22A 5HV8A 2KOPA 5BS2A 1UJZA 2JB0A 3G26A 4COCA 1AF8A 3CCRP 4XFXA 3G0VA 1S72P 2Z44A 4XFZA 1N8RQ 4PH0A 2Z45A 4PH1A 1E6JP 1MZ8A 4QKOA 3DS4A 1Q7YQ 1CEIA 1JJ2O 1A8OA 3CCJP 3CCLP 3G71P 1HQBA 2FVAA 2VLOA 2LTEA 2EG5A 3HYBA 2JYLA 2KGDA 2AFEA 2FVFA 3G29A 3CPWO 7CEIA 2XV6A 2KOQA 3CCUP 2JQ4A 3E2DA 3G6EP 3CC4P 1IUQA 2CWOA 3DS0A
chains in the Genus database with same CATH topology
2VLPA 1ZNVA 1UNKA 2GYKA 2JBGA 2WPTA 1IMPA 2GZEA 1UJZA 2GZJA 2JB0A 1IMQA 2K5XA 2VLOA 3GJNA 2ERHA 1E0HA 5EW5E 1GXGA 1EMVA 2JAZA 2NO8A 2VLQA 4UHPB 7CEIA 1GXHA 2GZGA 2GZFA 2VLNA 1MZ8A 2GZIA 4QKOA 3GKLC 2K0DX 3U43A 1BXIA 1FR2A 4F37A 1CEIA 1AYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLP A;  1ZNV A;  1UNK A;  2GYK A;  2JBG A;  2WPT A;  1IMP A;  2GZE A;  1UJZ A;  2GZJ A;  2JB0 A;  1IMQ A;  2K5X A;  2VLO A;  3GJN A;  2ERH A;  1E0H A;  5EW5 E;  1GXG A;  1EMV A;  2JAZ A;  2NO8 A;  2VLQ A;  4UHP B;  7CEI A;  1GXH A;  2GZG A;  2GZF A;  2VLN A;  1MZ8 A;  2GZI A;  4QKO A;  3GKL C;  2K0D X;  3U43 A;  1BXI A;  1FR2 A;  4F37 A;  1CEI A;  1AYI A; 
#chains in the Genus database with same CATH topology
 1D1D A;  2L0Q A;  2WPT A;  1K8A Q;  3I56 P;  1VQ9 P;  1IMQ A;  2N5I A;  2GDW A;  4QNB A;  2GDY A;  2PEN A;  2E1M A;  4H2X C;  2OTJ P;  1VQP P;  4BPF A;  2PEI A;  4IZ6 A;  4XRQ A;  5HVC A;  4F37 A;  3G28 A;  3OW2 O;  2DNW A;  1KD1 Q;  1K73 Q;  3GZM A;  3HZQ A;  1ZNV A;  2OAR A;  2JBG A;  2KWL A;  1T8K A;  2KGA A;  4IPY A;  1E0H A;  1GXG A;  3H47 A;  1AUM A;  4DG9 A;  3I55 P;  3EJE A;  2PEO A;  1K9M Q;  2FQ0 A;  1BAJ A;  2QNW A;  1YIT P;  2LF4 A;  4R0M A;  2M8L A;  2BUO A;  4COP A;  5CZD B;  5EJD A;  1YJW P;  3DS2 A;  3Q20 A;  1L0H A;  3LRY A;  2LIW A;  5HGO A;  2K2Q A;  5JPA A;  3GZL A;  3CCE P;  2JAZ A;  2LOL A;  2NO8 A;  3VRL C;  2JO0 A;  1K30 A;  1M74 A;  3GKL C;  2EIA A;  1AYI A;  1YI2 P;  3CCV P;  5DCK A;  1QVF O;  1EIA A;  2AF8 A;  3CD6 P;  1A43 A;  1NJI Q;  3DS5 A;  2XXM A;  2LPK A;  1NQ4 A;  2VLQ A;  4UHP B;  3G1I A;  4GR2 A;  2JGP A;  2M5R A;  2FAD A;  3CCM P;  5BS1 A;  2CG5 B;  2N6Y A;  2QEX P;  2MR8 A;  2LIU A;  1VQK P;  2OTL P;  3CME P;  2PEK A;  1OR5 A;  2X2B A;  4U0F A;  1GXH A;  2DGY A;  2K94 A;  4BPG A;  3RG2 A;  3CC7 P;  4WYM A;  1VQN P;  2FAC A;  1M1K Q;  2GZJ A;  1QRJ A;  1HY8 A;  2MR7 A;  2P9X A;  2BHV A;  2KGC A;  2AFD A;  1M90 Q;  2PEQ A;  1Q86 Q;  2MVU A;  2XT1 A;  4U0A A;  1UNK A;  2EHT A;  5KP8 B;  1Q81 Q;  1F80 D;  2KGE A;  4XFY A;  2KOO A;  4HKG A;  3CCS P;  5HGN A;  2Z46 A;  3DPH A;  4U0C A;  1FR2 A;  3G21 A;  2N6Z A;  2FQ2 A;  3LMO A;  4PWV B;  2KW2 A;  2XZ1 C;  2GZG A;  1VQ6 P;  1X3O A;  2VSQ A;  2K93 A;  2K0D X;  2KOD A;  1DV5 A;  1VQ4 P;  1VQL P;  2PEJ A;  3EJB A;  4NEO A;  1M6E X;  2K5X A;  5I4T G;  1KC8 Q;  2L9F A;  2ERH A;  1ZMB A;  5EW5 E;  2N5H A;  2FQ1 A;  1VQO P;  1DNY A;  2LKI A;  1YJN P;  2VLN A;  1VKU A;  5F2O A;  2L4B A;  3U43 A;  2MD9 A;  1VQ7 P;  3EJD A;  3NY7 B;  2VLP A;  3H4E A;  2CQ8 A;  5HGM A;  2LL8 A;  2PNG A;  2KG6 A;  3CCQ P;  2K0Y A;  3B4Q A;  4H2W C;  2KR5 A;  1YJ9 P;  2EFJ A;  2JU1 A;  1YHQ P;  1M6N A;  4U0E A;  1RO2 A;  3P05 A;  1KLP A;  1W2B O;  3G4S P;  4PXH B;  1Q82 Q;  5HGL A;  1RNI A;  3RG6 C;  4GR6 A;  2MY5 A;  2KG8 A;  2GYK A;  5KP6 B;  1L0I A;  4BPH A;  4U0B A;  4M0I A;  3DS1 A;  2JYG A;  2ROQ A;  3G1G A;  2K92 A;  1EMV A;  3DTJ A;  2AVA A;  3B5I A;  1RO0 A;  2PY8 A;  2K0X A;  2KG9 A;  2N98 A;  4U0D A;  3H0D A;  2MF4 A;  2L6E A;  1ACP A;  1VQ5 P;  2XZ0 D;  2GZE A;  1IMP A;  1QVG O;  3GJN A;  1YIJ P;  2KOR A;  5KP7 B;  1VHN A;  4H2Y C;  3NTE A;  1VQ8 P;  2KOS A;  5F2K A;  1VQM P;  2GZI A;  1Z6M A;  3M1M A;  2FVE A;  3MGE A;  2FHS C;  2ONT A;  3CE7 A;  3DS3 A;  2PEM A;  2M8P A;  1GPJ A;  2MVV A;  4MRT C;  2CNR A;  5F2N A;  3CXC O;  1EOQ A;  2QA4 P;  3WBH A;  2CGQ A;  2FAE A;  3CMA P;  3CC2 P;  2GZF A;  2GDX A;  1BXI A;  2EHS A;  2M8N A;  2N50 A;  1KQS O;  2JU2 A;  2LML A;  4XRO A;  4CA3 A;  2L22 A;  5HV8 A;  2KOP A;  5BS2 A;  1UJZ A;  2JB0 A;  3G26 A;  4COC A;  1AF8 A;  3CCR P;  4XFX A;  3G0V A;  1S72 P;  2Z44 A;  4XFZ A;  1N8R Q;  4PH0 A;  2Z45 A;  4PH1 A;  1E6J P;  1MZ8 A;  4QKO A;  3DS4 A;  1Q7Y Q;  1CEI A;  1JJ2 O;  1A8O A;  3CCJ P;  3CCL P;  3G71 P;  1HQB A;  2FVA A;  2VLO A;  2LTE A;  2EG5 A;  3HYB A;  2JYL A;  2KGD A;  2AFE A;  2FVF A;  3G29 A;  3CPW O;  7CEI A;  2XV6 A;  2KOQ A;  3CCU P;  2JQ4 A;  3E2D A;  3G6E P;  3CC4 P;  1IUQ A;  2CWO A;  3DS0 A; 
#chains in the Genus database with same CATH homology
 2VLP A;  1ZNV A;  1UNK A;  2GYK A;  2JBG A;  2WPT A;  1IMP A;  2GZE A;  1UJZ A;  2GZJ A;  2JB0 A;  1IMQ A;  2K5X A;  2VLO A;  3GJN A;  2ERH A;  1E0H A;  5EW5 E;  1GXG A;  1EMV A;  2JAZ A;  2NO8 A;  2VLQ A;  4UHP B;  7CEI A;  1GXH A;  2GZG A;  2GZF A;  2VLN A;  1MZ8 A;  2GZI A;  4QKO A;  3GKL C;  2K0D X;  3U43 A;  1BXI A;  1FR2 A;  4F37 A;  1CEI A;  1AYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...