1UJZA

Crystal structure of the e7_c/im7_c complex; a computationally designed interface between the colicin e7 dnase and the im7 immunity protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLYVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational redesign of protein-protein interaction specificity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system
molecule keywords Designed Colicin E7 immunity protein
total genus 30
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1ujzA00
3GJNA 4F37A 1CEIA 4UHPB 3GKLC 2K0DX 2NO8A 4QKOA 2JAZA 2VLNA 1MZ8A 1IMQA 1FR2A 2GYKA 2K5XA 2GZJA 1E0HA 1AYIA 1GXHA 1BXIA 1ZNVA 2ERHA 1UJZA 2VLPA 2GZIA 7CEIA 5EW5E 2VLQA 2GZFA 1IMPA 2WPTA 2GZGA 1UNKA 2GZEA 1GXGA 2JBGA 2VLOA 2JB0A 1EMVA 3U43A
chains in the Genus database with same CATH superfamily
1BAJA 3DS1A 2LTEA 3P05A 4PH0A 5HGMA 3RG6C 2MR8A 2K0XA 1M6NA 3DS5A 2PEOA 2L4BA 2KOSA 1VQKP 5JPAA 2EHSA 1RO2A 2QNWA 4DG9A 3CCQP 2L0QA 5BS1A 1KC8Q 2K92A 3DS3A 2PENA 2EHTA 2BUOA 4U0AA 1E0HA 1L0IA 1Z6MA 2PEIA 1NQ4A 7CEIA 2EFJA 4WYMA 1YJ9P 3G1IA 4GR2A 4NEOA 3EJDA 3CCLP 3MGEA 4U0CA 1VQ6P 1YJWP 3H47A 1IUQA 1YI2P 2K0DX 1K8AQ 1EOQA 4U0FA 1Q86Q 5EJDA 4BPGA 4M0IA 2K2QA 2DGYA 5F2KA 3CCMP 1UNKA 3GZMA 3CCRP 3VRLC 2JQ4A 2LF4A 1Q7YQ 2JAZA 2EIAA 2N6YA 3CXCO 2KGAA 1AYIA 2JU2A 2JO0A 2K93A 2JYLA 2M8PA 2X2BA 3CMAP 3HYBA 5KP7B 1NJIQ 3GJNA 1A8OA 3G1GA 4XRQA 2AFDA 3GZLA 2PNGA 1K73Q 1VQNP 3HZQA 2LL8A 1VQLP 3CC2P 2CGQA 2GDWA 2JB0A 4PWVB 4BPFA 2AFEA 3Q20A 1IMQA 3H4EA 2FACA 2CQ8A 2JYGA 3OW2O 2PEQA 3G4SP 3NY7B 2MVVA 5BS2A 2N98A 2QA4P 4XROA 5HGNA 3EJEA 4PXHB 4UHPB 3GKLC 2FADA 2KWLA 4QKOA 3CE7A 1D1DA 3H0DA 1FR2A 1VQ8P 3CCSP 1ZNVA 2JU1A 2Z44A 1M6EX 5KP8B 4IPYA 1YJNP 2KOOA 3DS4A 3WBHA 2MD9A 2LPKA 5HGLA 4R0MA 3U43A 2N6ZA 1KLPA 4XFYA 1M74A 3LMOA 3G0VA 1MZ8A 3B4QA 1KQSO 1L0HA 1YIJP 2XZ1C 1HY8A 2KGDA 2KOPA 2OARA 3DTJA 1OR5A 2WPTA 2ONTA 2BHVA 5I4TG 4QNBA 2XT1A 2PEMA 4XFZA 1RO0A 2GZJA 1GXHA 2N5HA 2KODA 1EIAA 2MVUA 3CMEP 5HVCA 2EG5A 1AUMA 1VKUA 2ROQA 2FVEA 2ERHA 2PEJA 1M90Q 2FQ2A 2L6EA 3RG2A 2M8LA 3I55P 2GYKA 2N5IA 4H2XC 1VQ9P 2LMLA 2VSQA 4PH1A 2GZIA 2QEXP 4H2WC 3CCUP 4H2YC 1GXGA 2KG8A 2FQ1A 2GDXA 5F2NA 3G29A 1T8KA 1VQOP 2PY8A 1ACPA 2AF8A 3M1MA 2JGPA 2KG9A 2VLQA 2KG6A 2KGCA 1QVFO 2JBGA 1Q82Q 1K30A 2KW2A 4U0EA 1S72P 2FAEA 5HV8A 2M5RA 4MRTC 3I56P 4U0DA 1YITP 1VQ4P 1BXIA 4GR6A 2CNRA 2OTLP 3G28A 2MR7A 1IMPA 1HQBA 2XXMA 1VQPP 1EMVA 5F2OA 1YHQP 3DS0A 3NTEA 2VLNA 3CCVP 2FHSC 1A43A 2K5XA 2M8NA 2KORA 2LOLA 2E1MA 1UJZA 1F80D 1M1KQ 5CZDB 2L22A 4HKGA 4BPHA 1VQMP 2DNWA 2K0YA 3B5IA 3DPHA 2P9XA 3EJBA 4F37A 3CC4P 1RNIA 1DNYA 2LKIA 2NO8A 1X3OA 1W2BO 2LIWA 5DCKA 2K94A 5HGOA 3CCEP 2VLPA 2OTJP 3G21A 3CPWO 4COPA 2XZ0D 2GZFA 4XFXA 2N50A 2GZGA 1AF8A 1QRJA 2KR5A 3G71P 2Z46A 1JJ2O 2FVFA 4COCA 1N8RQ 2MY5A 3E2DA 3CCJP 4CA3A 1K9MQ 1KD1Q 2PEKA 3G26A 3CD6P 1E6JP 2XV6A 2FVAA 2LIUA 1QVGO 5KP6B 3G6EP 1CEIA 2FQ0A 1GPJA 2GDYA 2KGEA 2MF4A 1DV5A 3DS2A 1VQ7P 1VHNA 1VQ5P 2CG5B 4IZ6A 2CWOA 1ZMBA 1Q81Q 2Z45A 5EW5E 3LRYA 2AVAA 3CC7P 2KOQA 2GZEA 2L9FA 2VLOA 4U0BA
chains in the Genus database with same CATH topology
3GJNA 4F37A 1CEIA 4UHPB 3GKLC 2K0DX 2NO8A 4QKOA 2JAZA 2VLNA 1MZ8A 1IMQA 1FR2A 2GYKA 2K5XA 2GZJA 1E0HA 1AYIA 1GXHA 1BXIA 1ZNVA 2ERHA 1UJZA 2VLPA 2GZIA 7CEIA 5EW5E 2VLQA 2GZFA 1IMPA 2WPTA 2GZGA 1UNKA 2GZEA 1GXGA 2JBGA 2VLOA 2JB0A 1EMVA 3U43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GJN A;  4F37 A;  1CEI A;  4UHP B;  3GKL C;  2K0D X;  2NO8 A;  4QKO A;  2JAZ A;  2VLN A;  1MZ8 A;  1IMQ A;  1FR2 A;  2GYK A;  2K5X A;  2GZJ A;  1E0H A;  1AYI A;  1GXH A;  1BXI A;  1ZNV A;  2ERH A;  1UJZ A;  2VLP A;  2GZI A;  7CEI A;  5EW5 E;  2VLQ A;  2GZF A;  1IMP A;  2WPT A;  2GZG A;  1UNK A;  2GZE A;  1GXG A;  2JBG A;  2VLO A;  2JB0 A;  1EMV A;  3U43 A; 
#chains in the Genus database with same CATH topology
 1BAJ A;  3DS1 A;  2LTE A;  3P05 A;  4PH0 A;  5HGM A;  3RG6 C;  2MR8 A;  2K0X A;  1M6N A;  3DS5 A;  2PEO A;  2L4B A;  2KOS A;  1VQK P;  5JPA A;  2EHS A;  1RO2 A;  2QNW A;  4DG9 A;  3CCQ P;  2L0Q A;  5BS1 A;  1KC8 Q;  2K92 A;  3DS3 A;  2PEN A;  2EHT A;  2BUO A;  4U0A A;  1E0H A;  1L0I A;  1Z6M A;  2PEI A;  1NQ4 A;  7CEI A;  2EFJ A;  4WYM A;  1YJ9 P;  3G1I A;  4GR2 A;  4NEO A;  3EJD A;  3CCL P;  3MGE A;  4U0C A;  1VQ6 P;  1YJW P;  3H47 A;  1IUQ A;  1YI2 P;  2K0D X;  1K8A Q;  1EOQ A;  4U0F A;  1Q86 Q;  5EJD A;  4BPG A;  4M0I A;  2K2Q A;  2DGY A;  5F2K A;  3CCM P;  1UNK A;  3GZM A;  3CCR P;  3VRL C;  2JQ4 A;  2LF4 A;  1Q7Y Q;  2JAZ A;  2EIA A;  2N6Y A;  3CXC O;  2KGA A;  1AYI A;  2JU2 A;  2JO0 A;  2K93 A;  2JYL A;  2M8P A;  2X2B A;  3CMA P;  3HYB A;  5KP7 B;  1NJI Q;  3GJN A;  1A8O A;  3G1G A;  4XRQ A;  2AFD A;  3GZL A;  2PNG A;  1K73 Q;  1VQN P;  3HZQ A;  2LL8 A;  1VQL P;  3CC2 P;  2CGQ A;  2GDW A;  2JB0 A;  4PWV B;  4BPF A;  2AFE A;  3Q20 A;  1IMQ A;  3H4E A;  2FAC A;  2CQ8 A;  2JYG A;  3OW2 O;  2PEQ A;  3G4S P;  3NY7 B;  2MVV A;  5BS2 A;  2N98 A;  2QA4 P;  4XRO A;  5HGN A;  3EJE A;  4PXH B;  4UHP B;  3GKL C;  2FAD A;  2KWL A;  4QKO A;  3CE7 A;  1D1D A;  3H0D A;  1FR2 A;  1VQ8 P;  3CCS P;  1ZNV A;  2JU1 A;  2Z44 A;  1M6E X;  5KP8 B;  4IPY A;  1YJN P;  2KOO A;  3DS4 A;  3WBH A;  2MD9 A;  2LPK A;  5HGL A;  4R0M A;  3U43 A;  2N6Z A;  1KLP A;  4XFY A;  1M74 A;  3LMO A;  3G0V A;  1MZ8 A;  3B4Q A;  1KQS O;  1L0H A;  1YIJ P;  2XZ1 C;  1HY8 A;  2KGD A;  2KOP A;  2OAR A;  3DTJ A;  1OR5 A;  2WPT A;  2ONT A;  2BHV A;  5I4T G;  4QNB A;  2XT1 A;  2PEM A;  4XFZ A;  1RO0 A;  2GZJ A;  1GXH A;  2N5H A;  2KOD A;  1EIA A;  2MVU A;  3CME P;  5HVC A;  2EG5 A;  1AUM A;  1VKU A;  2ROQ A;  2FVE A;  2ERH A;  2PEJ A;  1M90 Q;  2FQ2 A;  2L6E A;  3RG2 A;  2M8L A;  3I55 P;  2GYK A;  2N5I A;  4H2X C;  1VQ9 P;  2LML A;  2VSQ A;  4PH1 A;  2GZI A;  2QEX P;  4H2W C;  3CCU P;  4H2Y C;  1GXG A;  2KG8 A;  2FQ1 A;  2GDX A;  5F2N A;  3G29 A;  1T8K A;  1VQO P;  2PY8 A;  1ACP A;  2AF8 A;  3M1M A;  2JGP A;  2KG9 A;  2VLQ A;  2KG6 A;  2KGC A;  1QVF O;  2JBG A;  1Q82 Q;  1K30 A;  2KW2 A;  4U0E A;  1S72 P;  2FAE A;  5HV8 A;  2M5R A;  4MRT C;  3I56 P;  4U0D A;  1YIT P;  1VQ4 P;  1BXI A;  4GR6 A;  2CNR A;  2OTL P;  3G28 A;  2MR7 A;  1IMP A;  1HQB A;  2XXM A;  1VQP P;  1EMV A;  5F2O A;  1YHQ P;  3DS0 A;  3NTE A;  2VLN A;  3CCV P;  2FHS C;  1A43 A;  2K5X A;  2M8N A;  2KOR A;  2LOL A;  2E1M A;  1UJZ A;  1F80 D;  1M1K Q;  5CZD B;  2L22 A;  4HKG A;  4BPH A;  1VQM P;  2DNW A;  2K0Y A;  3B5I A;  3DPH A;  2P9X A;  3EJB A;  4F37 A;  3CC4 P;  1RNI A;  1DNY A;  2LKI A;  2NO8 A;  1X3O A;  1W2B O;  2LIW A;  5DCK A;  2K94 A;  5HGO A;  3CCE P;  2VLP A;  2OTJ P;  3G21 A;  3CPW O;  4COP A;  2XZ0 D;  2GZF A;  4XFX A;  2N50 A;  2GZG A;  1AF8 A;  1QRJ A;  2KR5 A;  3G71 P;  2Z46 A;  1JJ2 O;  2FVF A;  4COC A;  1N8R Q;  2MY5 A;  3E2D A;  3CCJ P;  4CA3 A;  1K9M Q;  1KD1 Q;  2PEK A;  3G26 A;  3CD6 P;  1E6J P;  2XV6 A;  2FVA A;  2LIU A;  1QVG O;  5KP6 B;  3G6E P;  1CEI A;  2FQ0 A;  1GPJ A;  2GDY A;  2KGE A;  2MF4 A;  1DV5 A;  3DS2 A;  1VQ7 P;  1VHN A;  1VQ5 P;  2CG5 B;  4IZ6 A;  2CWO A;  1ZMB A;  1Q81 Q;  2Z45 A;  5EW5 E;  3LRY A;  2AVA A;  3CC7 P;  2KOQ A;  2GZE A;  2L9F A;  2VLO A;  4U0B A; 
#chains in the Genus database with same CATH homology
 3GJN A;  4F37 A;  1CEI A;  4UHP B;  3GKL C;  2K0D X;  2NO8 A;  4QKO A;  2JAZ A;  2VLN A;  1MZ8 A;  1IMQ A;  1FR2 A;  2GYK A;  2K5X A;  2GZJ A;  1E0H A;  1AYI A;  1GXH A;  1BXI A;  1ZNV A;  2ERH A;  1UJZ A;  2VLP A;  2GZI A;  7CEI A;  5EW5 E;  2VLQ A;  2GZF A;  1IMP A;  2WPT A;  2GZG A;  1UNK A;  2GZE A;  1GXG A;  2JBG A;  2VLO A;  2JB0 A;  1EMV A;  3U43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...