1UJZA

Crystal structure of the e7_c/im7_c complex; a computationally designed interface between the colicin e7 dnase and the im7 immunity protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLYVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational redesign of protein-protein interaction specificity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system
molecule keywords Designed Colicin E7 immunity protein
total genus 30
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2003-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1ujzA00
5EW5E 4QKOA 3GJNA 1E0HA 1EMVA 2JB0A 4F37A 1GXGA 1ZNVA 2GZIA 1IMQA 3U43A 1AYIA 2K5XA 2VLOA 1UNKA 2JBGA 2K0DX 2NO8A 1FR2A 2GZFA 1IMPA 1MZ8A 2VLQA 2WPTA 2GYKA 2GZJA 7CEIA 3GKLC 2GZGA 2JAZA 2VLNA 4UHPB 2VLPA 2GZEA 1CEIA 1BXIA 1GXHA 1UJZA 2ERHA
chains in the Genus database with same CATH superfamily
3G4SP 3CMEP 2KG6A 1VQ9P 2PY8A 2FQ0A 1Q86Q 2QEXP 4COCA 1IMPA 3NY7B 4U0FA 1YITP 1RO0A 2VLNA 5JPAA 1YJWP 5EJDA 4IPYA 2N6ZA 1GXHA 5HVCA 2ERHA 3GJNA 1E0HA 1YIJP 2QA4P 3G1IA 3M1MA 4XFYA 2LL8A 1VQKP 1QRJA 3DS4A 3I56P 3VRLC 3H0DA 4H2WC 3I55P 3G71P 2KGEA 4GR2A 3CCMP 1DV5A 2XT1A 2MD9A 3CCVP 1CEIA 2KWLA 1BXIA 2FVAA 2KGCA 2M8NA 4U0BA 1F80D 3HYBA 2K0DX 5KP7B 3CCSP 3CXCO 3WBHA 1T8KA 2MR8A 2BUOA 2Z45A 2LF4A 3LRYA 1Q81Q 4F37A 1GXGA 2N98A 5F2NA 2EHSA 1AYIA 2FVEA 3B4QA 4COPA 3CE7A 2GZJA 2PEQA 2LKIA 1KC8Q 2X2BA 2CGQA 1A43A 3P05A 1RNIA 2LTEA 2FQ2A 1AUMA 2AFEA 1AF8A 2K2QA 4H2XC 2K94A 3LMOA 2AFDA 2PEKA 2FACA 3EJEA 4U0AA 2VLQA 4QNBA 3HZQA 2PENA 4U0CA 2M5RA 1VQ7P 1VQNP 3DS5A 1HQBA 2OARA 2XXMA 1Q7YQ 3CCJP 1UNKA 3H4EA 4IZ6A 2KGAA 1VKUA 2K0YA 2JAZA 2L4BA 2JU1A 3CCLP 2GDYA 1JJ2O 1E6JP 2KR5A 2JU2A 2KG9A 5EW5E 2ONTA 2QNWA 1EMVA 1ZNVA 1X3OA 1HY8A 2KOOA 3U43A 3CCUP 2K5XA 4BPFA 2OTJP 4NEOA 2KOPA 1GPJA 2CG5B 2GZGA 4PWVB 2L0QA 5F2OA 2N6YA 4PH1A 1YHQP 4HKGA 2PEOA 1OR5A 2EHTA 2L22A 3G21A 3G6EP 1VQLP 2FVFA 2KORA 2EIAA 3Q20A 3CPWO 2VLOA 2KG8A 1EOQA 1M1KQ 2GZFA 2L6EA 3CC2P 1VQOP 1VHNA 5I4TG 1K8AQ 2KODA 2Z46A 2PEIA 4PH0A 2EFJA 1ZMBA 1UJZA 1A8OA 1VQ5P 5HGLA 4PXHB 4R0MA 2NO8A 2LOLA 2M8LA 2CNRA 3EJBA 2P9XA 3G29A 1BAJA 4XRQA 2LIUA 3CD6P 2JB0A 2K93A 4XFXA 2L9FA 1IMQA 2CQ8A 2PEMA 2MY5A 3RG2A 4BPHA 1QVFO 2JBGA 1D1DA 1YJNP 2N50A 3DS2A 1NQ4A 2KOQA 4BPGA 2N5HA 4DG9A 1KD1Q 3DS0A 3RG6C 1VQPP 7CEIA 2PNGA 1K9MQ 2CWOA 2GDWA 4QKOA 5CZDB 3CCRP 2GZIA 3NTEA 2XZ1C 1FR2A 2MR7A 1EIAA 4U0DA 1M6EX 3DTJA 3GKLC 5HGOA 3MGEA 5HV8A 1VQ8P 4UHPB 3CCEP 2FQ1A 5BS2A 2EG5A 1K30A 2LPKA 3DS3A 1W2BO 3CMAP 1L0HA 5BS1A 5KP6B 2DNWA 2GYKA 4M0IA 3GZLA 5HGMA 1S72P 2KOSA 2GDXA 1N8RQ 5F2KA 1KQSO 4CA3A 4MRTC 2BHVA 2VSQA 3OW2O 2JO0A 1ACPA 3G0VA 1VQMP 3GZMA 2FHSC 1Z6MA 3H47A 2GZEA 3G1GA 2Z44A 1Q82Q 2OTLP 1L0IA 2M8PA 4U0EA 2N5IA 2E1MA 2LIWA 4XROA 4H2YC 1M90Q 1NJIQ 1M6NA 2XV6A 1M74A 1RO2A 2KGDA 2ROQA 1VQ6P 4XFZA 1VQ4P 1DNYA 2AVAA 3B5IA 3DPHA 5HGNA 3CC7P 1K73Q 2FAEA 2KW2A 2DGYA 2LMLA 3G28A 2K0XA 3G26A 1MZ8A 1YJ9P 2K92A 3EJDA 2VLPA 5DCKA 2XZ0D 2JYLA 1YI2P 1QVGO 2JQ4A 2MVUA 3DS1A 4GR6A 5KP8B 4WYMA 2JGPA 2FADA 2MVVA 3CC4P 2WPTA 2MF4A 1KLPA 3E2DA 3CCQP 2PEJA 2JYGA 2AF8A 1IUQA
chains in the Genus database with same CATH topology
5EW5E 4QKOA 3GJNA 1E0HA 1EMVA 2JB0A 4F37A 1GXGA 1ZNVA 2GZIA 1IMQA 3U43A 1AYIA 2K5XA 2VLOA 1UNKA 2JBGA 2K0DX 2NO8A 1FR2A 2GZFA 1IMPA 1MZ8A 2VLQA 2WPTA 2GYKA 2GZJA 7CEIA 3GKLC 2GZGA 2JAZA 2VLNA 4UHPB 2VLPA 2GZEA 1CEIA 1BXIA 1GXHA 1UJZA 2ERHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EW5 E;  4QKO A;  3GJN A;  1E0H A;  1EMV A;  2JB0 A;  4F37 A;  1GXG A;  1ZNV A;  2GZI A;  1IMQ A;  3U43 A;  1AYI A;  2K5X A;  2VLO A;  1UNK A;  2JBG A;  2K0D X;  2NO8 A;  1FR2 A;  2GZF A;  1IMP A;  1MZ8 A;  2VLQ A;  2WPT A;  2GYK A;  2GZJ A;  7CEI A;  3GKL C;  2GZG A;  2JAZ A;  2VLN A;  4UHP B;  2VLP A;  2GZE A;  1CEI A;  1BXI A;  1GXH A;  1UJZ A;  2ERH A; 
#chains in the Genus database with same CATH topology
 3G4S P;  3CME P;  2KG6 A;  1VQ9 P;  2PY8 A;  2FQ0 A;  1Q86 Q;  2QEX P;  4COC A;  1IMP A;  3NY7 B;  4U0F A;  1YIT P;  1RO0 A;  2VLN A;  5JPA A;  1YJW P;  5EJD A;  4IPY A;  2N6Z A;  1GXH A;  5HVC A;  2ERH A;  3GJN A;  1E0H A;  1YIJ P;  2QA4 P;  3G1I A;  3M1M A;  4XFY A;  2LL8 A;  1VQK P;  1QRJ A;  3DS4 A;  3I56 P;  3VRL C;  3H0D A;  4H2W C;  3I55 P;  3G71 P;  2KGE A;  4GR2 A;  3CCM P;  1DV5 A;  2XT1 A;  2MD9 A;  3CCV P;  1CEI A;  2KWL A;  1BXI A;  2FVA A;  2KGC A;  2M8N A;  4U0B A;  1F80 D;  3HYB A;  2K0D X;  5KP7 B;  3CCS P;  3CXC O;  3WBH A;  1T8K A;  2MR8 A;  2BUO A;  2Z45 A;  2LF4 A;  3LRY A;  1Q81 Q;  4F37 A;  1GXG A;  2N98 A;  5F2N A;  2EHS A;  1AYI A;  2FVE A;  3B4Q A;  4COP A;  3CE7 A;  2GZJ A;  2PEQ A;  2LKI A;  1KC8 Q;  2X2B A;  2CGQ A;  1A43 A;  3P05 A;  1RNI A;  2LTE A;  2FQ2 A;  1AUM A;  2AFE A;  1AF8 A;  2K2Q A;  4H2X C;  2K94 A;  3LMO A;  2AFD A;  2PEK A;  2FAC A;  3EJE A;  4U0A A;  2VLQ A;  4QNB A;  3HZQ A;  2PEN A;  4U0C A;  2M5R A;  1VQ7 P;  1VQN P;  3DS5 A;  1HQB A;  2OAR A;  2XXM A;  1Q7Y Q;  3CCJ P;  1UNK A;  3H4E A;  4IZ6 A;  2KGA A;  1VKU A;  2K0Y A;  2JAZ A;  2L4B A;  2JU1 A;  3CCL P;  2GDY A;  1JJ2 O;  1E6J P;  2KR5 A;  2JU2 A;  2KG9 A;  5EW5 E;  2ONT A;  2QNW A;  1EMV A;  1ZNV A;  1X3O A;  1HY8 A;  2KOO A;  3U43 A;  3CCU P;  2K5X A;  4BPF A;  2OTJ P;  4NEO A;  2KOP A;  1GPJ A;  2CG5 B;  2GZG A;  4PWV B;  2L0Q A;  5F2O A;  2N6Y A;  4PH1 A;  1YHQ P;  4HKG A;  2PEO A;  1OR5 A;  2EHT A;  2L22 A;  3G21 A;  3G6E P;  1VQL P;  2FVF A;  2KOR A;  2EIA A;  3Q20 A;  3CPW O;  2VLO A;  2KG8 A;  1EOQ A;  1M1K Q;  2GZF A;  2L6E A;  3CC2 P;  1VQO P;  1VHN A;  5I4T G;  1K8A Q;  2KOD A;  2Z46 A;  2PEI A;  4PH0 A;  2EFJ A;  1ZMB A;  1UJZ A;  1A8O A;  1VQ5 P;  5HGL A;  4PXH B;  4R0M A;  2NO8 A;  2LOL A;  2M8L A;  2CNR A;  3EJB A;  2P9X A;  3G29 A;  1BAJ A;  4XRQ A;  2LIU A;  3CD6 P;  2JB0 A;  2K93 A;  4XFX A;  2L9F A;  1IMQ A;  2CQ8 A;  2PEM A;  2MY5 A;  3RG2 A;  4BPH A;  1QVF O;  2JBG A;  1D1D A;  1YJN P;  2N50 A;  3DS2 A;  1NQ4 A;  2KOQ A;  4BPG A;  2N5H A;  4DG9 A;  1KD1 Q;  3DS0 A;  3RG6 C;  1VQP P;  7CEI A;  2PNG A;  1K9M Q;  2CWO A;  2GDW A;  4QKO A;  5CZD B;  3CCR P;  2GZI A;  3NTE A;  2XZ1 C;  1FR2 A;  2MR7 A;  1EIA A;  4U0D A;  1M6E X;  3DTJ A;  3GKL C;  5HGO A;  3MGE A;  5HV8 A;  1VQ8 P;  4UHP B;  3CCE P;  2FQ1 A;  5BS2 A;  2EG5 A;  1K30 A;  2LPK A;  3DS3 A;  1W2B O;  3CMA P;  1L0H A;  5BS1 A;  5KP6 B;  2DNW A;  2GYK A;  4M0I A;  3GZL A;  5HGM A;  1S72 P;  2KOS A;  2GDX A;  1N8R Q;  5F2K A;  1KQS O;  4CA3 A;  4MRT C;  2BHV A;  2VSQ A;  3OW2 O;  2JO0 A;  1ACP A;  3G0V A;  1VQM P;  3GZM A;  2FHS C;  1Z6M A;  3H47 A;  2GZE A;  3G1G A;  2Z44 A;  1Q82 Q;  2OTL P;  1L0I A;  2M8P A;  4U0E A;  2N5I A;  2E1M A;  2LIW A;  4XRO A;  4H2Y C;  1M90 Q;  1NJI Q;  1M6N A;  2XV6 A;  1M74 A;  1RO2 A;  2KGD A;  2ROQ A;  1VQ6 P;  4XFZ A;  1VQ4 P;  1DNY A;  2AVA A;  3B5I A;  3DPH A;  5HGN A;  3CC7 P;  1K73 Q;  2FAE A;  2KW2 A;  2DGY A;  2LML A;  3G28 A;  2K0X A;  3G26 A;  1MZ8 A;  1YJ9 P;  2K92 A;  3EJD A;  2VLP A;  5DCK A;  2XZ0 D;  2JYL A;  1YI2 P;  1QVG O;  2JQ4 A;  2MVU A;  3DS1 A;  4GR6 A;  5KP8 B;  4WYM A;  2JGP A;  2FAD A;  2MVV A;  3CC4 P;  2WPT A;  2MF4 A;  1KLP A;  3E2D A;  3CCQ P;  2PEJ A;  2JYG A;  2AF8 A;  1IUQ A; 
#chains in the Genus database with same CATH homology
 5EW5 E;  4QKO A;  3GJN A;  1E0H A;  1EMV A;  2JB0 A;  4F37 A;  1GXG A;  1ZNV A;  2GZI A;  1IMQ A;  3U43 A;  1AYI A;  2K5X A;  2VLO A;  1UNK A;  2JBG A;  2K0D X;  2NO8 A;  1FR2 A;  2GZF A;  1IMP A;  1MZ8 A;  2VLQ A;  2WPT A;  2GYK A;  2GZJ A;  7CEI A;  3GKL C;  2GZG A;  2JAZ A;  2VLN A;  4UHP B;  2VLP A;  2GZE A;  1CEI A;  1BXI A;  1GXH A;  1UJZ A;  2ERH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...