1VQ8P

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq8P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq8P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq8P02
3CCMP 1KQSO 1VQLP 3CD6P 1S72P 3OW2O 1M1KQ 3CC4P 3G6EP 3CCLP 2OTJP 1NJIQ 1Q86Q 1Q81Q 1K8AQ 1VQKP 1VQNP 1KC8Q 1YJ9P 2OTLP 3CCRP 1QVFO 3I55P 3CC2P 3CXCO 1VQPP 1YI2P 1KD1Q 1JJ2O 1K9MQ 2QA4P 3CCUP 1QVGO 1VQ4P 1M90Q 1YJWP 1YIJP 3CC7P 1VQOP 3CMAP 3CPWO 3G71P 1W2BO 1VQ8P 1YHQP 3G4SP 1VQMP 2QEXP 3CCEP 1K73Q 3CCJP 1VQ6P 1N8RQ 3I56P 3CCQP 3CCSP 3CMEP 1VQ5P 1VQ7P 1YJNP 1Q7YQ 1Q82Q 1VQ9P 1YITP 3CCVP
chains in the Genus database with same CATH superfamily
4ZKPA 2K94A 2FQ0A 2GZEA 5KKZB 5KLIB 1RF1C 1SFCD 2KI7B 3E2DA 3WUVA 1X0TA 4CPGA 3CL3D 2H89C 1VF5D 4PWVB 2BCCE 2HPCB 1IMQA 1LJ2A 1NTMK 1OW6A 3L72E 2WPVB 3MGEA 1Q7YQ 3RGUA 2K88A 3FWLA 2YO3A 1M56D 2B87B 4H13D 3B71A 3A7OA 3H1KD 4BRYA 3F5HA 3W68A 2ONTA 1NU1K 2NPSA 1OMIA 4KT0J 3H1ID 2H43A 1J2JB 3N7NA 3CXHH 5KP6B 4JF7A 2GZIA 1NTME 2DW3A 2WQYC 1GU5A 1PP9D 3TK1A 5APTA 4UB6H 1DEEG 5KAFE 4PJ0H 3V6IA 5KJ7D 4N78E 2KB7P 2EG5A 1MZ8A 1NU1E 2WSFJ 1FZCC 2KS1B 1DX7A 1KILE 1RQVA 1G1IA 4H2WC 2GA1A 1SQXG 1FDIA 5KKZC 2L0QA 1PGPA 1D1DA 2OGUA 4UB8E 1GL2A 3RL0g 1SQPD 2ZT9B 2WSFH 1ZRTE 1FC2C 2KIKA 3V2QA 3PH0A 3HZQA 3CXHI 3CC4P 3BCCJ 1YQ3C 5DJTB 4U0BA 2N1TC 1QVFO 3JSVC 2MF4A 3AE4C 5CBNA 2FXOA 2FYZA 1P84E 3AE2C 3G71P 3U59A 3RK3D 1J1EB 2IBZI 1S4XA 2DNWA 4DT0A 3L71D 1S2EA 1L4AB 4IL6X 3JC22 1L0LK 3CXCO 1GK6A 1PGQA 2Y9ZA 1WMKA 3HUSA 1Z6MA 3NFQA 3C1LA 1ZMEC 2KGCA 1OVVA 2KG8A 1KB9D 3I56P 5CCHC 2J5UA 1VQ5P 2Q3EA 5H2FE 3LIEA 4XFXA 2ZT9C 3KHUA 2K9YA 4PD4D 4MN4C 2CK3H 1CEIA 1EXJA 4BPHA 2XV5A 3H1KJ 3Q1MA 1SQXD 2WT7B 4C7NB 3SWYA 3MHVA 1SQBJ 3H1IJ 2QJYB 2JU1A 1USDA 1IK7A 3D71A 3B5NA 2Q3IA 2DGYA 1PP9J 1FZAA 3TGUG 4U7JA 3L75G 2D2CD 1J1EC 1EIAA 1X8YA 3BCCE 4XE5B 4W80A 2R5BA 1CSBA 3M1MA 1U7MA 3CCLP 3EJBA 1L4AC 2QJPB 1SP4A 1PEUA 1Q2NA 2FXPA 1EMVA 4D6TG 3KZIE 1YJWP 1AVOA 2XZ1C 1SQPJ 1X9VA 3AE3C 1KILA 1J1DC 3B4SA 1QRJA 3L74G 1T2KD 4IFFA 2Y9YA 3IF4A 2ZAEB 1L0HA 1LP1B 1X22A 2OYHA 4IFDK 3HRNA 1N86A 1AF8A 2QJYC 2Z4EA 5APWA 2JP3A 1IFJA 2WPRA 2L5GB 2QRXA 1YI2P 3H1KE 3USSA 3MUDA 2O3JA 3KYQA 3V2RA 3CC7P 3L71J 3EFGA 1SQBE 1A8OA 2Q7CA 3V2NA 3H1IE 3C9IA 4I7ZB 1VDFA 1JTHA 2FXMA 1OFCX 2JO1A 3M06A 2QJPC 3OW2O 1PP9E 2M8LA 3TDKA 2WITA 3L75D 1SQPK 3M9BA 3G4SP 3CCJP 2OQQA 3DS3A 3EQ2A 2O1JA 1RE4A 2K0XA 1BE3G 4C46A 3HTKB 2OYIB 2N1TD 5TJHA 1SQXJ 2I1JA 4WYMA 4D6TD 3D6YA 1N2DC 1SQPE 2LIUA 2W6BA 1R8EA 1FJKA 3ITKA 3R4YA 1FJPA 1S5LH 1IMPA 4UHPB 2K0YA 2MVVA 1M1JA 2KOPA 3L74D 5AW2B 5BU8B 5AW9B 1SFCC 2KOGA 1AV1A 2XKMA 1KZUB 1HWTC 1KFNA 3OJAB 2E42A 1VF5C 2YXRB 2LF4A 4I7ZC 1LT9A 1QLED 1R5SA 5CCHD 2JWDA 2H8PD 2BEZF 1HUCA 3RK3E 1VL2A 2JR8A 3OAKA 2P9XA 1SQVG 2ZT9D 4YXDC 2L91A 1ZW0A 1PGJA 3E1IA 3L71E 4U0DA 3HE5A 3P32A 2FBWC 3AE7C 2HODA 4BPFA 1ZOYC 3CE7A 3VMZA 2E76B 1GTWA 4LC1A 1SQXK 5CCGC 2QG4A 2BEQD 1OXZA 2OYIC 1KB9E 2BASA 1Q81Q 3AE1C 1LWUB 2IFMA 1NH4A 2YMYA 2IDBA 3NTNA 4PD4E 1VQMP 3HD7A 1Y9BA 2B89A 2P1JA 1BE3D 5HGLA 3FGAD 2V7QH 1L4AD 2O01H 4NPDA 3CXHD 3BATA 1HJ0A 2RMZA 2XXMA 2CPBA 4ASWA 2WSSH 2M8NA 1E5WA 4NPFX 1SQQG 2ITAA 3IAOA 1AUMA 2PAJA 1UJZA 3L75J 1KLPA 2Z45A 3PJSK 2IBZD 2A45I 3TSIA 2N9BA 4PXHB 4DJGA 1YJ9P 2N98A 1YQ4C 2AFDA 1CZQA 4PH1A 4OGQB 2ERHA 5M1BA 1BCCG 2KUBA 5AVWB 3H1JG 2PEIA 2QVAA 1IK9A 1JUNA 3GJNA 4BPGA 1T3JA 1T8KA 2FYNB 4W7YA 2AVAA 1N73A 1LWUC 2KGDA 4O9BA 1AFOA 4XROA 2JDIH 3MGNA 2Z44A 3G3ZA 2JYLA 2FACA 4AQRD 4M3LA 1HQBA 4K35A 4PH0A 2A06G 3L74J 4H0LB 2R3SA 3CX5H 1L0NE 3A0BE 3WU2H 5AW0B 5B5EE 1IFMA 3G29A 2RN0A 1HJBA 2FYUG 3AEDC 2WSCH 1H8AA 1VQKP 4K3AA 5AVRB 1FZBA 3LW5J 2GM4A 2AXTH 3GLMA 1OW7A 3OA7A 3BRVB 2QJKB 5AVUB 4M0IA 2YKOA 3RG6C 4KHXA 2Q9IA 2H7HA 2QIWA 4U3FG 1SS1A 2KLUA 2K1AA 2KGEA 1FOSF 2N50A 1EDJA 2VLQA 1HH0A 1KC8Q 2M5AA 5L8RJ 1ACPA 4OGQC 1BGYD 5APYA 5I4TG 1JY2O 1RHZB 2K37A 5BVZA 1Y8AA 2FYNC 3G26A 1X79B 3CX5I 1GPJA 3FXDA 5TISH 1GW4A 2YMKA 5HVCA 1IUQA 1JEKA 2CWOA 5APUA 1HF9A 2AF8A 2GZFA 1N7LA 3AEEC 3SWFA 4IL6H 1NO4A 1JMMA 1BE3J 4H0LC 2BQ1E 3ABVC 3A0HE 3HE4A 4WB4A 3CWBE 4L76A 3GMAA 3HUSB 1AA0A 2KODA 2A06D 1T2KC 1WT6A 2I8DA 1KD1Q 3LMOA 1MV8A 3S9OA 1S9KD 2EHTA 2LIWA 2VRSA 5AW3B 2UWJE 2FVAA 2KNCA 1EZVG 3G1IA 5CCGD 1VKUA 4I1LA 1KQFB 4OWFA 1JY2N 1F80D 5AW4B 3WBHA 4Z1MH 1LT1A 5CJ0A 1GXGA 2B88A 3H1HD 2JBGA 2M8RA 2IFNA 1K9MQ 3GHGA 4B86A 2KOSA 2E43A 1NTZG 2K92A 1YIJP 3Q5SA 3O8ZA 3SWKA 1L0LJ 1RF1A 3L4FA 2KGAA 3AE6C 1RNIA 3B5NB 3TNUB 3CCVP 1H89A 2X2BA 5KLIC 2OTJP 2KZJA 4EYYQ 4JYCA 1OX3A 2LXCB 1YTZI 2KG6A 3O6QA 3L73G 1N7SA 1L0IA 2KYVA 2ZVNB 3GW6A 1LTJA 3HUSC 1A02F 1HTLC 5KP8B 4EOTA 4AYCA 3CXHE 5JPAA 3VP8A 2A45G 4EIJA 2PENA 2E76D 1VQ4P 1KILB 3IR9A 1HY8A 3T97B 1GW3A 4UB6E 1BGYJ 1IO4A 2MD9A 4PJ0E 2QNWA 3DS2A 1KMIZ 2IYPA 1PIXA 1SQVK 4COPA 2YO2A 2KSEA 4XFZA 2IBZE 2OYHB 1MKMA 3VMAA 3AE8C 2JWAA 1PZQA 2PEJA 1NTKG 1DD3A 3JCUH 3VOPA 2W27A 2FY8A 3B5NC 2G3AA 3AE9C 4F37A 3CD6P 2HPCA 1LTAC 3CCRP 1IZNB 1QGKB 3PHLA 1PL5A 2PFXA 1JTHB 1L0LE 1GMJA 1NGMB 3IN6A 1G1JA 5KAIH 1E6JP 1ZV8A 5KLVG 3DS0A 3MIWA 1PEMA 3TF5A 2N1TA 1PV3A 2O1KA 1GDTA 2W6AA 1BDCA 4GOEA 2PY8A 1AQ5A 2ZYDA 2MKVA 3AEGC 3SFDC 5B66H 3NMDA 4OGQD 4BXLA 2CPSA 3H32B 1KORA 2OARA 1AQTA 2BHVA 1JJ2O 1OR5A 1QVGO 4WY4A 2LTEA 4U0CA 1VQOP 4IPYA 3S1KA 1N8RQ 3EJDA 5E79H 4L74A 5HGOA 3H1HJ 3EJEA 3E7KA 2YIUB 1R5LA 3U43A 2ZFCA 2KLVA 3L70G 1S3JA 4JBZA 5BS2A 4I2LC 1JCDA 3DPHA 4H0LD 3H1LG 1WRGA 1BGYE 5DJUB 4YXWH 1M1JB 1RE3A 1UIIA 1DV5A 1YBKA 2C0WA 4GR6A 4N3YB 2E5TA 1Q82Q 5HGMA 2KOOA 2XNDH 4A7PA 2E74B 1HBWA 1LT9B 3AEFC 3D70A 1NTKD 1M8OB 2VLPA 1EXIA 1MFTA 2FVEA 4I6MC 1H0TA 2AXCA 2BCCG 2R3CA 3GF3A 2YXQB 2WVRA 3L72G 3EWKA 3CCSP 1H88A 4BWNA 3B8EB 1YITP 1RY3A 1KQSO 3HE5B 1BDDA 1KTMA 1S72P 2FYUK 3V5BA 2HODB 2JB0A 4DCKA 3AEAC 1RE4C 1FZFA 4L73A 4IFMA 4GR2A 1VPCA 2L4BA 2CQ8A 5APVA 1S9KE 1RO0A 4HB1A 3V4QA 2FADA 4H44B 2QM7A 3M0DC 3PRJA 1OWAA 1NU1G 2EFJA 3MZWB 3I55P 1FBMA 3B4QA 1ZLLA 3HD7B 3UIAA 3TGUD 1GXHA 1M1JC 4TT3H 3H1HE 3CPWO 3DS1A 2Y0EA 2FKWB 1M6NA 3A2AA 1LTIC 2E74C 3L70D 1RO2A 3CX5D 4DZOA 4H13B 4C7NA 3SFEC 1MUUA 2L22A 5GTIH 2C9NY 4OVNF 1CI6A 2V4HA 2GYKA 1XTGB 2AEFA 1URQA 1AYIA 5AVYB 2E5YA 1FR2A 4CA3A 4ZMDA 1KQGB 3WUUA 2BCCD 1DIPA 2JYGA 1N73B 5CJ4A 2C9LY 2ZYGA 2MJZA 3B5ND 1NYHA 2WPTA 4H44C 3D6ZA 2GUVA 1FOSE 2R5DA 2JJLA 1NOHA 3HD7C 1OVRA 2M8PA 2PP6A 2PEKA 1OW8A 2JQ4A 5AVQB 5AVZB 2P7JA 1EZVI 1NTZK 5KP7B 1NWQA 4HJGH 1BSNA 2A45H 4MRTC 1FU1A 1JY2P 1NTKJ 1YJNP 2N5IA 2V7QJ 4COCA 3H6PA 2O01J 3HYBA 3A3YB 2AEMA 1CW5A 4U0AA 2ZJSE 1KILD 4H2YC 1A43A 1A02J 1KQLA 1S5LE 1EOQA 3KDPB 5BU5A 2R44A 2M5AB 4GIFA 4Y28J 1M7LA 2IYOA 1W5CE 5APSA 4ZKUA 1VQ7P 1SFCA 2XV6A 3V4WA 1SQXE 1KYOH 3FWNA 1ZRTD 2OTLP 2WSEH 1QX8A 4XRQA 1W2EA 1Y47A 2YKPA 3BCCG 3Q5PA 3V2PA 1LGHB 1LTTC 1JOCA 1FAVA 3TGUJ 5GTHH 1FDOA 4KJMA 4RKUJ 4NEOA 2M5RA 2NRGA 3GKLC 1P84D 3HE4B 4Y99B 5CCGA 1JB0J 3AE5C 2J58A 1UNKA 2E76C 3L70J 5AW7B 1NTKK 1AJYA 5BS1A 3EFFK 3CCEP 4BRYB 2GZGA 5KJ7A 1DNYA 3G1GA 4H2XC 4D6TJ 1SQVD 3BASA 2NPSB 1VQNP 1D7MA 2LPKA 1LTGC 2WSCJ 3H25A 3PTZA 3GZLA 2KNCB 4JPZB 1KYOI 3G28A 2HYNA 2D2CB 2W6JH 2FQ1A 5CMZA 3VYIA 3LIDA 2IZ1A 1DD4A 1FE6A 5AW1B 3H1KG 1RF0C 1RF1B 2EHSA 3VMYA 4C7RA 3MD0A 1SQBG 2FHSC 2LKMA 3H1IG 4HKGA 1GZLA 1GL2B 4WWIA 1JNMA 2E74D 4XA4A 3Q20A 2K0DX 1PP9G 1USEA 2FFDA 1E79H 4Y99C 1N7SB 1IFNA 5EW5E 1LTJB 1SQQD 2OYOA 3TGUE 1YHQP 3L75E 1KN7A 1KV4A 1PEQA 4JQ0D 2NPSC 1PFIA 2Z5HA 3Q3DA 4IOIH 1L2PA 2ZXEB 3F89A 5AW8B 1FDMA 3L70E 5KAFH 1NAFA 1BCCD 1OIPA 3CX5E 4TLFA 3KPEA 1SQPG 3H1JD 1HGZA 2H88C 2POHA 3WU2E 1DH3A 2R32A 5CHXA 4R4MA 4D6TE 3N4XA 4LLHA 3VTPC 4H44D 2GZJA 3CCMP 2AXTE 5AVTB 3HD7D 3KXDA 2QJKC 3L74E 1NKNA 4UB8H 1GU4A 3S4RA 3FXEA 1T8ZA 5F2KA 1G2CA 1GL2C 1YTZT 1KFMA 2FYUD 2KSJA 1ZN5A 1HVVA 1ZP0C 4DOJA 1N7SC 3L71G 1GD2E 2N1TB 1SQBD 2RH0A 3QH9A 2EIAA 1LTJC 1SQVJ 2XT1A 4U3FD 4RO0A 1JO5A 2PEOA 2JO0A 5TISE 3GZMA 3U1CA 1P84H 4HH2A 3I5CA 3Q2YA 2JEEA 1FZEA 4IL6E 1IFPA 4WY4B 1SLQA 1NJIQ 1K30A 4XFYA 1JY3O 4GT1A 4WVZA 3NTEA 3H47A 4R0MA 2KZIA 1NAYA 2J59M 4LGDE 4EDFA 1EC5A 2KR5A 2KW2A 1LTBC 5EJDA 1BE3E 5H2FH 2Q1KA 2VSQA 2Z5IA 1PPJG 5AW5B 2Q5UA 2PNGA 1K73Q 3AECC 5K5GB 3BRTB 5CZDB 2IZ0A 2K9JA 1ZNVA 1FZCA 1NQ4A 1SQQJ 4QMAA 1H0TB 2GDYA 2JU2A 1P84I 2RKLA 3G9RA 2WMMA 5HGNA 4YTPC 1JY3N 2W83C 2QE7H 2IX7C 3PLNA 1M74A 1EZVD 5F2OA 2ZYAA 1T3UA 1BCCJ 5AVVB 1FZGA 4WY4C 2KWLA 3H1JJ 2JAZA 5CBOA 1SQVE 2L6EA 1DEBA 1NTZD 1YYCA 2FQ2A 2B87A 2XZRA 1L0NG 3DS5A 4L75A 4PV1B 4QNBA 3KZIH 3II6A 4U0EA 1J1DB 1PGOA 1RE3C 3P8CD 3FX0A 2PEQA 2FVFA 1U57A 1PEOA 5APXA 1KILC 2FYUJ 3NXSA 1VHNA 4HKZH 3L73D 3H0DA 3Q5RA 2XDJA 2Z46A 1VQ6P 1MFZA 2GDWA 2ROQA 2E75B 1SQQK 2NPSD 7CEIA 2KS1A 3P05A 1MZ9A 3RBXA 2PEMA 4U3FJ 2W90A 1CI6B 1IFDA 1PPJD 2WPSA 3L36A 2OYHC 3AEBC 3TNUA 1URQB 5CCHA 1M57D 3JCUE 5F2NA 2KORA 3CMAP 4ZNCA 2B9BA 2O01N 1SQQE 3E1RA 3RG2A 5KTBA 3MUDC 2AFEA 1E0HA 1Q86Q 3P8MC 3RL0B 5AVSB 2WTYA 5KAIE 2K5XA 2VLNA 2VLOA 1KYOD 1BCCE 4PV1C 1Z56A 1GL2D 3PP5A 2CG5B 3H1JE 4GODA 3RK2B 1EDLA 3CWBG 1ZXGA 5B66E 4GDOA 3M9QA 3L35A 2CGQA 1FS0E 3T97A 3SSUA 1OVUA 1N7SD 2LL8A 1RQUA 1L0ND 3M0AA 2KOQA 2QA4P 5KLVD 1SQBK 5E79E 3QWOC 2E75C 2HG5D 1L4AA 2A06E 2AEJA 1RH5B 1NKZB 2K2QA 1NTMG 3A5TA 3KQGA 3G0VA 2YIUC 2P58A 2XZ0D 2MR7A 2FYUE 3L37A 5APQA 1URQC 2P2UA 1VQPP 3M9HA 1SFCB 3BVHA 2W8ZA 2P67A 1SVFA 1VF5B 2WWWA 4IZ6A 2L9FA 4U3FE 1NTZJ 2MR8A 4DG9A 1VQLP 2KK7A 1M1KQ 1HGVA 3RL0C 2MY5A 2M3BA 4JYBA 1LT9C 1Q90D 4ASVA 2WT7A 3H1LD 2JGPA 2N5HA 2HLOA 2XNXA 2PGDA 1X3OA 1BSHA 3CI9A 3RK2C 3H32A 1QL1A 1S1CX 4U0FA 3NY7B 4W7ZA 3L73J 2YKQA 3WUTA 2E1MA 2K3RA 1KB9H 3R2PA 2M0BA 1LNQA 3VRLC 1M90Q 4R4LA 3VP9A 3DTJA 3L72D 1LTSC 3M0DA 1W2BO 3CWBD 3RBZA 1NHLA 2I1KA 4PD4H 3W67A 4WY4D 2SPZA 3C8VA 3G6EP 1QEXA 2IBZG 2YNYA 5DCKA 3TYYA 1AVYA 4WBAA 1T6AA 1NTMD 5AVXB 1VQ8P 2JKVA 1ZR2A 1EQ7A 1EZVE 2WZ7A 2MVUA 4N78D 1IJDB 1LP1A 1NU1D 3GF7A 4H13C 5GTIE 1EDIA 2WSEJ 2C0XA 1L0LG 5AW6B 1ZMBA 3MTUE 1XTCC 4GKGA 3B5IA 1NTZE 5C39A 1KB9I 2KG9A 2FFDB 2N6YA 1L0NJ 3RK3B 2HFED 4RJTA 2N6ZA 3IFMA 5KLVJ 1OZHA 2XU6A 4PD4I 5KJ7C 2LOLA 3P8CE 2KXPB 3VN0A 3ZDMA 1N73C 4HYTB 2LKIA 1IFIA 3VMXA 3L73E 4XFJA 3DS4A 1K05A 2GDXA 3A0BH 5B5EH 1BXIA 2ZXXA 3CC2P 1QL2A 3LRYA 2QM8A 2BUOA 1BGYG 1PPJE 4NPEA 4PV1D 3HTKA 2OYIA 2FAEA 1JMBA 3MP7B 1NVOA 3H1LJ 2LXBA 1GK4A 1G2CB 2N9YB 5HV8A 1JY3P 3WMM0 3CCUP 1L0NK 2E75D 2Y0DA 1JCCA 1NTKE 2FFDC 3RK3C 5KLVK 2G8YA 2CNRA 1IC2A 1KYOE 3CCQP 4EI2A 1S5LX 2QSIA 4GOFA 2BCCJ 2PRRA 3GHGB 1L0LD 3L72J 3CWBJ 1URQD 2NZ2A 3U1AA 4AUWA 1TU3F 3M91A 3G21A 2NO8A 5EFWB 1M6EX 2IPPA 5GTHE 2Q6QA 2Y0CA 5KLVE 2LR2A 1JM0A 3A0HH 4N6JA 3RL0D 1NTMJ 1K8AQ 3CLQA 2KP8A 3O6QB 2P10A 1U7JA 3BCCD 4RESB 3H1HG 1NU1J 3RK2D 1LWUA 1EDKA 1K04A 1ZR4A 3P7KA 4YPCA 3CMEP 2M3EA 2HR3A 3H4EA 3LW5H 4QKOA 2ZVOB 2LMLA 1UIXA 2K93A 3GG2A 2K9JB 3H1LE 4OH8B 1FZCB 1BAJA 2D2CC 2GUSA 3K5BA 2QEXP 2OTKE 2WPQA 1RF0A 3GHGC 1VQ9P
chains in the Genus database with same CATH topology
3M1MA 3CC4P 3CCLP 3G6EP 4COCA 2OTJP 4U0BA 1KC8Q 2L6EA 2XXMA 2EFJA 3HYBA 5DCKA 3I55P 1QVFO 4WYMA 1PEUA 4U0AA 3E2DA 1A43A 2OARA 2EIAA 2BHVA 1JJ2O 2M8NA 2QA4P 3CCUP 1QVGO 2XT1A 5I4TG 1YJWP 4U0CA 3DS5A 1VQOP 1EOQA 4IPYA 3CPWO 3DS1A 3G71P 1VQ8P 2PEOA 2JO0A 1M6NA 1N8RQ 4QNBA 3CCQP 1AUMA 3G26A 5HGOA 1VQ7P 3MGEA 2XV6A 1Q7YQ 3G0VA 2Z45A 4U0EA 3Q20A 1RO2A 1NJIQ 1K30A 4XFYA 1IUQA 2CWOA 1QRJA 2PEQA 1YJ9P 2OTLP 2ONTA 5BS2A 1PEOA 3DPHA 4PH1A 4XRQA 3CXCO 5JPAA 1VQPP 1ZMBA 2PENA 2BQ1E 1VQ4P 3NTEA 3H47A 3H0DA 3G21A 3B5IA 2PEIA 2LF4A 1M6EX 1YHQP 2Z46A 1VQ6P 1PEQA 3I56P 1VQ9P 4GR6A 1VQ5P 3P05A 5HGMA 1Q82Q 3DS2A 1VQLP 2PEMA 1M1KQ 2P9XA 4XFXA 1K8AQ 4COPA 4XROA 4XFZA 2EG5A 2KODA 2Z44A 2JYLA 5HGLA 2JYGA 4U0DA 1YI2P 1KD1Q 5F2NA 2PEJA 4PH0A 3CC7P 3CMAP 5BS1A 1A8OA 3CCEP 4U0FA 1K73Q 3DS4A 3G1IA 3CCSP 3CMEP 3G29A 3G1GA 1YITP 1VQNP 3CCMP 1KQSO 3CD6P 1S72P 3OW2O 1D1DA 1Q86Q 1Q81Q 3H4EA 2E1MA 3WBHA 1VQKP 2M8LA 3CCRP 2M8PA 3CC2P 5HGNA 2PEKA 3LRYA 2DGYA 2BUOA 1K9MQ 3G28A 4M0IA 3VRLC 1M90Q 4GR2A 3RG6C 3DTJA 1YIJP 1E6JP 1BAJA 1M74A 1W2BO 5F2KA 1EIAA 3DS0A 5F2OA 3G4SP 2QEXP 1VQMP 1PEMA 3CCJP 3DS3A 1RO0A 1YJNP 2PY8A 1RNIA 3HZQA 3CCVP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM P;  1KQS O;  1VQL P;  3CD6 P;  1S72 P;  3OW2 O;  1M1K Q;  3CC4 P;  3G6E P;  3CCL P;  2OTJ P;  1NJI Q;  1Q86 Q;  1Q81 Q;  1K8A Q;  1VQK P;  1VQN P;  1KC8 Q;  1YJ9 P;  2OTL P;  3CCR P;  1QVF O;  3I55 P;  3CC2 P;  3CXC O;  1VQP P;  1YI2 P;  1KD1 Q;  1JJ2 O;  1K9M Q;  2QA4 P;  3CCU P;  1QVG O;  1VQ4 P;  1M90 Q;  1YJW P;  1YIJ P;  3CC7 P;  1VQO P;  3CMA P;  3CPW O;  3G71 P;  1W2B O;  1VQ8 P;  1YHQ P;  3G4S P;  1VQM P;  2QEX P;  3CCE P;  1K73 Q;  3CCJ P;  1VQ6 P;  1N8R Q;  3I56 P;  3CCQ P;  3CCS P;  3CME P;  1VQ5 P;  1VQ7 P;  1YJN P;  1Q7Y Q;  1Q82 Q;  1VQ9 P;  1YIT P;  3CCV P; 
#chains in the Genus database with same CATH topology
 4ZKP A;  2K94 A;  2FQ0 A;  2GZE A;  5KKZ B;  5KLI B;  1RF1 C;  1SFC D;  2KI7 B;  3E2D A;  3WUV A;  1X0T A;  4CPG A;  3CL3 D;  2H89 C;  1VF5 D;  4PWV B;  2BCC E;  2HPC B;  1IMQ A;  1LJ2 A;  1NTM K;  1OW6 A;  3L72 E;  2WPV B;  3MGE A;  1Q7Y Q;  3RGU A;  2K88 A;  3FWL A;  2YO3 A;  1M56 D;  2B87 B;  4H13 D;  3B71 A;  3A7O A;  3H1K D;  4BRY A;  3F5H A;  3W68 A;  2ONT A;  1NU1 K;  2NPS A;  1OMI A;  4KT0 J;  3H1I D;  2H43 A;  1J2J B;  3N7N A;  3CXH H;  5KP6 B;  4JF7 A;  2GZI A;  1NTM E;  2DW3 A;  2WQY C;  1GU5 A;  1PP9 D;  3TK1 A;  5APT A;  4UB6 H;  1DEE G;  5KAF E;  4PJ0 H;  3V6I A;  5KJ7 D;  4N78 E;  2KB7 P;  2EG5 A;  1MZ8 A;  1NU1 E;  2WSF J;  1FZC C;  2KS1 B;  1DX7 A;  1KIL E;  1RQV A;  1G1I A;  4H2W C;  2GA1 A;  1SQX G;  1FDI A;  5KKZ C;  2L0Q A;  1PGP A;  1D1D A;  2OGU A;  4UB8 E;  1GL2 A;  3RL0 g;  1SQP D;  2ZT9 B;  2WSF H;  1ZRT E;  1FC2 C;  2KIK A;  3V2Q A;  3PH0 A;  3HZQ A;  3CXH I;  3CC4 P;  3BCC J;  1YQ3 C;  5DJT B;  4U0B A;  2N1T C;  1QVF O;  3JSV C;  2MF4 A;  3AE4 C;  5CBN A;  2FXO A;  2FYZ A;  1P84 E;  3AE2 C;  3G71 P;  3U59 A;  3RK3 D;  1J1E B;  2IBZ I;  1S4X A;  2DNW A;  4DT0 A;  3L71 D;  1S2E A;  1L4A B;  4IL6 X;  3JC2 2;  1L0L K;  3CXC O;  1GK6 A;  1PGQ A;  2Y9Z A;  1WMK A;  3HUS A;  1Z6M A;  3NFQ A;  3C1L A;  1ZME C;  2KGC A;  1OVV A;  2KG8 A;  1KB9 D;  3I56 P;  5CCH C;  2J5U A;  1VQ5 P;  2Q3E A;  5H2F E;  3LIE A;  4XFX A;  2ZT9 C;  3KHU A;  2K9Y A;  4PD4 D;  4MN4 C;  2CK3 H;  1CEI A;  1EXJ A;  4BPH A;  2XV5 A;  3H1K J;  3Q1M A;  1SQX D;  2WT7 B;  4C7N B;  3SWY A;  3MHV A;  1SQB J;  3H1I J;  2QJY B;  2JU1 A;  1USD A;  1IK7 A;  3D71 A;  3B5N A;  2Q3I A;  2DGY A;  1PP9 J;  1FZA A;  3TGU G;  4U7J A;  3L75 G;  2D2C D;  1J1E C;  1EIA A;  1X8Y A;  3BCC E;  4XE5 B;  4W80 A;  2R5B A;  1CSB A;  3M1M A;  1U7M A;  3CCL P;  3EJB A;  1L4A C;  2QJP B;  1SP4 A;  1PEU A;  1Q2N A;  2FXP A;  1EMV A;  4D6T G;  3KZI E;  1YJW P;  1AVO A;  2XZ1 C;  1SQP J;  1X9V A;  3AE3 C;  1KIL A;  1J1D C;  3B4S A;  1QRJ A;  3L74 G;  1T2K D;  4IFF A;  2Y9Y A;  3IF4 A;  2ZAE B;  1L0H A;  1LP1 B;  1X22 A;  2OYH A;  4IFD K;  3HRN A;  1N86 A;  1AF8 A;  2QJY C;  2Z4E A;  5APW A;  2JP3 A;  1IFJ A;  2WPR A;  2L5G B;  2QRX A;  1YI2 P;  3H1K E;  3USS A;  3MUD A;  2O3J A;  3KYQ A;  3V2R A;  3CC7 P;  3L71 J;  3EFG A;  1SQB E;  1A8O A;  2Q7C A;  3V2N A;  3H1I E;  3C9I A;  4I7Z B;  1VDF A;  1JTH A;  2FXM A;  1OFC X;  2JO1 A;  3M06 A;  2QJP C;  3OW2 O;  1PP9 E;  2M8L A;  3TDK A;  2WIT A;  3L75 D;  1SQP K;  3M9B A;  3G4S P;  3CCJ P;  2OQQ A;  3DS3 A;  3EQ2 A;  2O1J A;  1RE4 A;  2K0X A;  1BE3 G;  4C46 A;  3HTK B;  2OYI B;  2N1T D;  5TJH A;  1SQX J;  2I1J A;  4WYM A;  4D6T D;  3D6Y A;  1N2D C;  1SQP E;  2LIU A;  2W6B A;  1R8E A;  1FJK A;  3ITK A;  3R4Y A;  1FJP A;  1S5L H;  1IMP A;  4UHP B;  2K0Y A;  2MVV A;  1M1J A;  2KOP A;  3L74 D;  5AW2 B;  5BU8 B;  5AW9 B;  1SFC C;  2KOG A;  1AV1 A;  2XKM A;  1KZU B;  1HWT C;  1KFN A;  3OJA B;  2E42 A;  1VF5 C;  2YXR B;  2LF4 A;  4I7Z C;  1LT9 A;  1QLE D;  1R5S A;  5CCH D;  2JWD A;  2H8P D;  2BEZ F;  1HUC A;  3RK3 E;  1VL2 A;  2JR8 A;  3OAK A;  2P9X A;  1SQV G;  2ZT9 D;  4YXD C;  2L91 A;  1ZW0 A;  1PGJ A;  3E1I A;  3L71 E;  4U0D A;  3HE5 A;  3P32 A;  2FBW C;  3AE7 C;  2HOD A;  4BPF A;  1ZOY C;  3CE7 A;  3VMZ A;  2E76 B;  1GTW A;  4LC1 A;  1SQX K;  5CCG C;  2QG4 A;  2BEQ D;  1OXZ A;  2OYI C;  1KB9 E;  2BAS A;  1Q81 Q;  3AE1 C;  1LWU B;  2IFM A;  1NH4 A;  2YMY A;  2IDB A;  3NTN A;  4PD4 E;  1VQM P;  3HD7 A;  1Y9B A;  2B89 A;  2P1J A;  1BE3 D;  5HGL A;  3FGA D;  2V7Q H;  1L4A D;  2O01 H;  4NPD A;  3CXH D;  3BAT A;  1HJ0 A;  2RMZ A;  2XXM A;  2CPB A;  4ASW A;  2WSS H;  2M8N A;  1E5W A;  4NPF X;  1SQQ G;  2ITA A;  3IAO A;  1AUM A;  2PAJ A;  1UJZ A;  3L75 J;  1KLP A;  2Z45 A;  3PJS K;  2IBZ D;  2A45 I;  3TSI A;  2N9B A;  4PXH B;  4DJG A;  1YJ9 P;  2N98 A;  1YQ4 C;  2AFD A;  1CZQ A;  4PH1 A;  4OGQ B;  2ERH A;  5M1B A;  1BCC G;  2KUB A;  5AVW B;  3H1J G;  2PEI A;  2QVA A;  1IK9 A;  1JUN A;  3GJN A;  4BPG A;  1T3J A;  1T8K A;  2FYN B;  4W7Y A;  2AVA A;  1N73 A;  1LWU C;  2KGD A;  4O9B A;  1AFO A;  4XRO A;  2JDI H;  3MGN A;  2Z44 A;  3G3Z A;  2JYL A;  2FAC A;  4AQR D;  4M3L A;  1HQB A;  4K35 A;  4PH0 A;  2A06 G;  3L74 J;  4H0L B;  2R3S A;  3CX5 H;  1L0N E;  3A0B E;  3WU2 H;  5AW0 B;  5B5E E;  1IFM A;  3G29 A;  2RN0 A;  1HJB A;  2FYU G;  3AED C;  2WSC H;  1H8A A;  1VQK P;  4K3A A;  5AVR B;  1FZB A;  3LW5 J;  2GM4 A;  2AXT H;  3GLM A;  1OW7 A;  3OA7 A;  3BRV B;  2QJK B;  5AVU B;  4M0I A;  2YKO A;  3RG6 C;  4KHX A;  2Q9I A;  2H7H A;  2QIW A;  4U3F G;  1SS1 A;  2KLU A;  2K1A A;  2KGE A;  1FOS F;  2N50 A;  1EDJ A;  2VLQ A;  1HH0 A;  1KC8 Q;  2M5A A;  5L8R J;  1ACP A;  4OGQ C;  1BGY D;  5APY A;  5I4T G;  1JY2 O;  1RHZ B;  2K37 A;  5BVZ A;  1Y8A A;  2FYN C;  3G26 A;  1X79 B;  3CX5 I;  1GPJ A;  3FXD A;  5TIS H;  1GW4 A;  2YMK A;  5HVC A;  1IUQ A;  1JEK A;  2CWO A;  5APU A;  1HF9 A;  2AF8 A;  2GZF A;  1N7L A;  3AEE C;  3SWF A;  4IL6 H;  1NO4 A;  1JMM A;  1BE3 J;  4H0L C;  2BQ1 E;  3ABV C;  3A0H E;  3HE4 A;  4WB4 A;  3CWB E;  4L76 A;  3GMA A;  3HUS B;  1AA0 A;  2KOD A;  2A06 D;  1T2K C;  1WT6 A;  2I8D A;  1KD1 Q;  3LMO A;  1MV8 A;  3S9O A;  1S9K D;  2EHT A;  2LIW A;  2VRS A;  5AW3 B;  2UWJ E;  2FVA A;  2KNC A;  1EZV G;  3G1I A;  5CCG D;  1VKU A;  4I1L A;  1KQF B;  4OWF A;  1JY2 N;  1F80 D;  5AW4 B;  3WBH A;  4Z1M H;  1LT1 A;  5CJ0 A;  1GXG A;  2B88 A;  3H1H D;  2JBG A;  2M8R A;  2IFN A;  1K9M Q;  3GHG A;  4B86 A;  2KOS A;  2E43 A;  1NTZ G;  2K92 A;  1YIJ P;  3Q5S A;  3O8Z A;  3SWK A;  1L0L J;  1RF1 A;  3L4F A;  2KGA A;  3AE6 C;  1RNI A;  3B5N B;  3TNU B;  3CCV P;  1H89 A;  2X2B A;  5KLI C;  2OTJ P;  2KZJ A;  4EYY Q;  4JYC A;  1OX3 A;  2LXC B;  1YTZ I;  2KG6 A;  3O6Q A;  3L73 G;  1N7S A;  1L0I A;  2KYV A;  2ZVN B;  3GW6 A;  1LTJ A;  3HUS C;  1A02 F;  1HTL C;  5KP8 B;  4EOT A;  4AYC A;  3CXH E;  5JPA A;  3VP8 A;  2A45 G;  4EIJ A;  2PEN A;  2E76 D;  1VQ4 P;  1KIL B;  3IR9 A;  1HY8 A;  3T97 B;  1GW3 A;  4UB6 E;  1BGY J;  1IO4 A;  2MD9 A;  4PJ0 E;  2QNW A;  3DS2 A;  1KMI Z;  2IYP A;  1PIX A;  1SQV K;  4COP A;  2YO2 A;  2KSE A;  4XFZ A;  2IBZ E;  2OYH B;  1MKM A;  3VMA A;  3AE8 C;  2JWA A;  1PZQ A;  2PEJ A;  1NTK G;  1DD3 A;  3JCU H;  3VOP A;  2W27 A;  2FY8 A;  3B5N C;  2G3A A;  3AE9 C;  4F37 A;  3CD6 P;  2HPC A;  1LTA C;  3CCR P;  1IZN B;  1QGK B;  3PHL A;  1PL5 A;  2PFX A;  1JTH B;  1L0L E;  1GMJ A;  1NGM B;  3IN6 A;  1G1J A;  5KAI H;  1E6J P;  1ZV8 A;  5KLV G;  3DS0 A;  3MIW A;  1PEM A;  3TF5 A;  2N1T A;  1PV3 A;  2O1K A;  1GDT A;  2W6A A;  1BDC A;  4GOE A;  2PY8 A;  1AQ5 A;  2ZYD A;  2MKV A;  3AEG C;  3SFD C;  5B66 H;  3NMD A;  4OGQ D;  4BXL A;  2CPS A;  3H32 B;  1KOR A;  2OAR A;  1AQT A;  2BHV A;  1JJ2 O;  1OR5 A;  1QVG O;  4WY4 A;  2LTE A;  4U0C A;  1VQO P;  4IPY A;  3S1K A;  1N8R Q;  3EJD A;  5E79 H;  4L74 A;  5HGO A;  3H1H J;  3EJE A;  3E7K A;  2YIU B;  1R5L A;  3U43 A;  2ZFC A;  2KLV A;  3L70 G;  1S3J A;  4JBZ A;  5BS2 A;  4I2L C;  1JCD A;  3DPH A;  4H0L D;  3H1L G;  1WRG A;  1BGY E;  5DJU B;  4YXW H;  1M1J B;  1RE3 A;  1UII A;  1DV5 A;  1YBK A;  2C0W A;  4GR6 A;  4N3Y B;  2E5T A;  1Q82 Q;  5HGM A;  2KOO A;  2XND H;  4A7P A;  2E74 B;  1HBW A;  1LT9 B;  3AEF C;  3D70 A;  1NTK D;  1M8O B;  2VLP A;  1EXI A;  1MFT A;  2FVE A;  4I6M C;  1H0T A;  2AXC A;  2BCC G;  2R3C A;  3GF3 A;  2YXQ B;  2WVR A;  3L72 G;  3EWK A;  3CCS P;  1H88 A;  4BWN A;  3B8E B;  1YIT P;  1RY3 A;  1KQS O;  3HE5 B;  1BDD A;  1KTM A;  1S72 P;  2FYU K;  3V5B A;  2HOD B;  2JB0 A;  4DCK A;  3AEA C;  1RE4 C;  1FZF A;  4L73 A;  4IFM A;  4GR2 A;  1VPC A;  2L4B A;  2CQ8 A;  5APV A;  1S9K E;  1RO0 A;  4HB1 A;  3V4Q A;  2FAD A;  4H44 B;  2QM7 A;  3M0D C;  3PRJ A;  1OWA A;  1NU1 G;  2EFJ A;  3MZW B;  3I55 P;  1FBM A;  3B4Q A;  1ZLL A;  3HD7 B;  3UIA A;  3TGU D;  1GXH A;  1M1J C;  4TT3 H;  3H1H E;  3CPW O;  3DS1 A;  2Y0E A;  2FKW B;  1M6N A;  3A2A A;  1LTI C;  2E74 C;  3L70 D;  1RO2 A;  3CX5 D;  4DZO A;  4H13 B;  4C7N A;  3SFE C;  1MUU A;  2L22 A;  5GTI H;  2C9N Y;  4OVN F;  1CI6 A;  2V4H A;  2GYK A;  1XTG B;  2AEF A;  1URQ A;  1AYI A;  5AVY B;  2E5Y A;  1FR2 A;  4CA3 A;  4ZMD A;  1KQG B;  3WUU A;  2BCC D;  1DIP A;  2JYG A;  1N73 B;  5CJ4 A;  2C9L Y;  2ZYG A;  2MJZ A;  3B5N D;  1NYH A;  2WPT A;  4H44 C;  3D6Z A;  2GUV A;  1FOS E;  2R5D A;  2JJL A;  1NOH A;  3HD7 C;  1OVR A;  2M8P A;  2PP6 A;  2PEK A;  1OW8 A;  2JQ4 A;  5AVQ B;  5AVZ B;  2P7J A;  1EZV I;  1NTZ K;  5KP7 B;  1NWQ A;  4HJG H;  1BSN A;  2A45 H;  4MRT C;  1FU1 A;  1JY2 P;  1NTK J;  1YJN P;  2N5I A;  2V7Q J;  4COC A;  3H6P A;  2O01 J;  3HYB A;  3A3Y B;  2AEM A;  1CW5 A;  4U0A A;  2ZJS E;  1KIL D;  4H2Y C;  1A43 A;  1A02 J;  1KQL A;  1S5L E;  1EOQ A;  3KDP B;  5BU5 A;  2R44 A;  2M5A B;  4GIF A;  4Y28 J;  1M7L A;  2IYO A;  1W5C E;  5APS A;  4ZKU A;  1VQ7 P;  1SFC A;  2XV6 A;  3V4W A;  1SQX E;  1KYO H;  3FWN A;  1ZRT D;  2OTL P;  2WSE H;  1QX8 A;  4XRQ A;  1W2E A;  1Y47 A;  2YKP A;  3BCC G;  3Q5P A;  3V2P A;  1LGH B;  1LTT C;  1JOC A;  1FAV A;  3TGU J;  5GTH H;  1FDO A;  4KJM A;  4RKU J;  4NEO A;  2M5R A;  2NRG A;  3GKL C;  1P84 D;  3HE4 B;  4Y99 B;  5CCG A;  1JB0 J;  3AE5 C;  2J58 A;  1UNK A;  2E76 C;  3L70 J;  5AW7 B;  1NTK K;  1AJY A;  5BS1 A;  3EFF K;  3CCE P;  4BRY B;  2GZG A;  5KJ7 A;  1DNY A;  3G1G A;  4H2X C;  4D6T J;  1SQV D;  3BAS A;  2NPS B;  1VQN P;  1D7M A;  2LPK A;  1LTG C;  2WSC J;  3H25 A;  3PTZ A;  3GZL A;  2KNC B;  4JPZ B;  1KYO I;  3G28 A;  2HYN A;  2D2C B;  2W6J H;  2FQ1 A;  5CMZ A;  3VYI A;  3LID A;  2IZ1 A;  1DD4 A;  1FE6 A;  5AW1 B;  3H1K G;  1RF0 C;  1RF1 B;  2EHS A;  3VMY A;  4C7R A;  3MD0 A;  1SQB G;  2FHS C;  2LKM A;  3H1I G;  4HKG A;  1GZL A;  1GL2 B;  4WWI A;  1JNM A;  2E74 D;  4XA4 A;  3Q20 A;  2K0D X;  1PP9 G;  1USE A;  2FFD A;  1E79 H;  4Y99 C;  1N7S B;  1IFN A;  5EW5 E;  1LTJ B;  1SQQ D;  2OYO A;  3TGU E;  1YHQ P;  3L75 E;  1KN7 A;  1KV4 A;  1PEQ A;  4JQ0 D;  2NPS C;  1PFI A;  2Z5H A;  3Q3D A;  4IOI H;  1L2P A;  2ZXE B;  3F89 A;  5AW8 B;  1FDM A;  3L70 E;  5KAF H;  1NAF A;  1BCC D;  1OIP A;  3CX5 E;  4TLF A;  3KPE A;  1SQP G;  3H1J D;  1HGZ A;  2H88 C;  2POH A;  3WU2 E;  1DH3 A;  2R32 A;  5CHX A;  4R4M A;  4D6T E;  3N4X A;  4LLH A;  3VTP C;  4H44 D;  2GZJ A;  3CCM P;  2AXT E;  5AVT B;  3HD7 D;  3KXD A;  2QJK C;  3L74 E;  1NKN A;  4UB8 H;  1GU4 A;  3S4R A;  3FXE A;  1T8Z A;  5F2K A;  1G2C A;  1GL2 C;  1YTZ T;  1KFM A;  2FYU D;  2KSJ A;  1ZN5 A;  1HVV A;  1ZP0 C;  4DOJ A;  1N7S C;  3L71 G;  1GD2 E;  2N1T B;  1SQB D;  2RH0 A;  3QH9 A;  2EIA A;  1LTJ C;  1SQV J;  2XT1 A;  4U3F D;  4RO0 A;  1JO5 A;  2PEO A;  2JO0 A;  5TIS E;  3GZM A;  3U1C A;  1P84 H;  4HH2 A;  3I5C A;  3Q2Y A;  2JEE A;  1FZE A;  4IL6 E;  1IFP A;  4WY4 B;  1SLQ A;  1NJI Q;  1K30 A;  4XFY A;  1JY3 O;  4GT1 A;  4WVZ A;  3NTE A;  3H47 A;  4R0M A;  2KZI A;  1NAY A;  2J59 M;  4LGD E;  4EDF A;  1EC5 A;  2KR5 A;  2KW2 A;  1LTB C;  5EJD A;  1BE3 E;  5H2F H;  2Q1K A;  2VSQ A;  2Z5I A;  1PPJ G;  5AW5 B;  2Q5U A;  2PNG A;  1K73 Q;  3AEC C;  5K5G B;  3BRT B;  5CZD B;  2IZ0 A;  2K9J A;  1ZNV A;  1FZC A;  1NQ4 A;  1SQQ J;  4QMA A;  1H0T B;  2GDY A;  2JU2 A;  1P84 I;  2RKL A;  3G9R A;  2WMM A;  5HGN A;  4YTP C;  1JY3 N;  2W83 C;  2QE7 H;  2IX7 C;  3PLN A;  1M74 A;  1EZV D;  5F2O A;  2ZYA A;  1T3U A;  1BCC J;  5AVV B;  1FZG A;  4WY4 C;  2KWL A;  3H1J J;  2JAZ A;  5CBO A;  1SQV E;  2L6E A;  1DEB A;  1NTZ D;  1YYC A;  2FQ2 A;  2B87 A;  2XZR A;  1L0N G;  3DS5 A;  4L75 A;  4PV1 B;  4QNB A;  3KZI H;  3II6 A;  4U0E A;  1J1D B;  1PGO A;  1RE3 C;  3P8C D;  3FX0 A;  2PEQ A;  2FVF A;  1U57 A;  1PEO A;  5APX A;  1KIL C;  2FYU J;  3NXS A;  1VHN A;  4HKZ H;  3L73 D;  3H0D A;  3Q5R A;  2XDJ A;  2Z46 A;  1VQ6 P;  1MFZ A;  2GDW A;  2ROQ A;  2E75 B;  1SQQ K;  2NPS D;  7CEI A;  2KS1 A;  3P05 A;  1MZ9 A;  3RBX A;  2PEM A;  4U3F J;  2W90 A;  1CI6 B;  1IFD A;  1PPJ D;  2WPS A;  3L36 A;  2OYH C;  3AEB C;  3TNU A;  1URQ B;  5CCH A;  1M57 D;  3JCU E;  5F2N A;  2KOR A;  3CMA P;  4ZNC A;  2B9B A;  2O01 N;  1SQQ E;  3E1R A;  3RG2 A;  5KTB A;  3MUD C;  2AFE A;  1E0H A;  1Q86 Q;  3P8M C;  3RL0 B;  5AVS B;  2WTY A;  5KAI E;  2K5X A;  2VLN A;  2VLO A;  1KYO D;  1BCC E;  4PV1 C;  1Z56 A;  1GL2 D;  3PP5 A;  2CG5 B;  3H1J E;  4GOD A;  3RK2 B;  1EDL A;  3CWB G;  1ZXG A;  5B66 E;  4GDO A;  3M9Q A;  3L35 A;  2CGQ A;  1FS0 E;  3T97 A;  3SSU A;  1OVU A;  1N7S D;  2LL8 A;  1RQU A;  1L0N D;  3M0A A;  2KOQ A;  2QA4 P;  5KLV D;  1SQB K;  5E79 E;  3QWO C;  2E75 C;  2HG5 D;  1L4A A;  2A06 E;  2AEJ A;  1RH5 B;  1NKZ B;  2K2Q A;  1NTM G;  3A5T A;  3KQG A;  3G0V A;  2YIU C;  2P58 A;  2XZ0 D;  2MR7 A;  2FYU E;  3L37 A;  5APQ A;  1URQ C;  2P2U A;  1VQP P;  3M9H A;  1SFC B;  3BVH A;  2W8Z A;  2P67 A;  1SVF A;  1VF5 B;  2WWW A;  4IZ6 A;  2L9F A;  4U3F E;  1NTZ J;  2MR8 A;  4DG9 A;  1VQL P;  2KK7 A;  1M1K Q;  1HGV A;  3RL0 C;  2MY5 A;  2M3B A;  4JYB A;  1LT9 C;  1Q90 D;  4ASV A;  2WT7 A;  3H1L D;  2JGP A;  2N5H A;  2HLO A;  2XNX A;  2PGD A;  1X3O A;  1BSH A;  3CI9 A;  3RK2 C;  3H32 A;  1QL1 A;  1S1C X;  4U0F A;  3NY7 B;  4W7Z A;  3L73 J;  2YKQ A;  3WUT A;  2E1M A;  2K3R A;  1KB9 H;  3R2P A;  2M0B A;  1LNQ A;  3VRL C;  1M90 Q;  4R4L A;  3VP9 A;  3DTJ A;  3L72 D;  1LTS C;  3M0D A;  1W2B O;  3CWB D;  3RBZ A;  1NHL A;  2I1K A;  4PD4 H;  3W67 A;  4WY4 D;  2SPZ A;  3C8V A;  3G6E P;  1QEX A;  2IBZ G;  2YNY A;  5DCK A;  3TYY A;  1AVY A;  4WBA A;  1T6A A;  1NTM D;  5AVX B;  1VQ8 P;  2JKV A;  1ZR2 A;  1EQ7 A;  1EZV E;  2WZ7 A;  2MVU A;  4N78 D;  1IJD B;  1LP1 A;  1NU1 D;  3GF7 A;  4H13 C;  5GTI E;  1EDI A;  2WSE J;  2C0X A;  1L0L G;  5AW6 B;  1ZMB A;  3MTU E;  1XTC C;  4GKG A;  3B5I A;  1NTZ E;  5C39 A;  1KB9 I;  2KG9 A;  2FFD B;  2N6Y A;  1L0N J;  3RK3 B;  2HFE D;  4RJT A;  2N6Z A;  3IFM A;  5KLV J;  1OZH A;  2XU6 A;  4PD4 I;  5KJ7 C;  2LOL A;  3P8C E;  2KXP B;  3VN0 A;  3ZDM A;  1N73 C;  4HYT B;  2LKI A;  1IFI A;  3VMX A;  3L73 E;  4XFJ A;  3DS4 A;  1K05 A;  2GDX A;  3A0B H;  5B5E H;  1BXI A;  2ZXX A;  3CC2 P;  1QL2 A;  3LRY A;  2QM8 A;  2BUO A;  1BGY G;  1PPJ E;  4NPE A;  4PV1 D;  3HTK A;  2OYI A;  2FAE A;  1JMB A;  3MP7 B;  1NVO A;  3H1L J;  2LXB A;  1GK4 A;  1G2C B;  2N9Y B;  5HV8 A;  1JY3 P;  3WMM 0;  3CCU P;  1L0N K;  2E75 D;  2Y0D A;  1JCC A;  1NTK E;  2FFD C;  3RK3 C;  5KLV K;  2G8Y A;  2CNR A;  1IC2 A;  1KYO E;  3CCQ P;  4EI2 A;  1S5L X;  2QSI A;  4GOF A;  2BCC J;  2PRR A;  3GHG B;  1L0L D;  3L72 J;  3CWB J;  1URQ D;  2NZ2 A;  3U1A A;  4AUW A;  1TU3 F;  3M91 A;  3G21 A;  2NO8 A;  5EFW B;  1M6E X;  2IPP A;  5GTH E;  2Q6Q A;  2Y0C A;  5KLV E;  2LR2 A;  1JM0 A;  3A0H H;  4N6J A;  3RL0 D;  1NTM J;  1K8A Q;  3CLQ A;  2KP8 A;  3O6Q B;  2P10 A;  1U7J A;  3BCC D;  4RES B;  3H1H G;  1NU1 J;  3RK2 D;  1LWU A;  1EDK A;  1K04 A;  1ZR4 A;  3P7K A;  4YPC A;  3CME P;  2M3E A;  2HR3 A;  3H4E A;  3LW5 H;  4QKO A;  2ZVO B;  2LML A;  1UIX A;  2K93 A;  3GG2 A;  2K9J B;  3H1L E;  4OH8 B;  1FZC B;  1BAJ A;  2D2C C;  2GUS A;  3K5B A;  2QEX P;  2OTK E;  2WPQ A;  1RF0 A;  3GHG C;  1VQ9 P; 
#chains in the Genus database with same CATH homology
 3M1M A;  3CC4 P;  3CCL P;  3G6E P;  4COC A;  2OTJ P;  4U0B A;  1KC8 Q;  2L6E A;  2XXM A;  2EFJ A;  3HYB A;  5DCK A;  3I55 P;  1QVF O;  4WYM A;  1PEU A;  4U0A A;  3E2D A;  1A43 A;  2OAR A;  2EIA A;  2BHV A;  1JJ2 O;  2M8N A;  2QA4 P;  3CCU P;  1QVG O;  2XT1 A;  5I4T G;  1YJW P;  4U0C A;  3DS5 A;  1VQO P;  1EOQ A;  4IPY A;  3CPW O;  3DS1 A;  3G71 P;  1VQ8 P;  2PEO A;  2JO0 A;  1M6N A;  1N8R Q;  4QNB A;  3CCQ P;  1AUM A;  3G26 A;  5HGO A;  1VQ7 P;  3MGE A;  2XV6 A;  1Q7Y Q;  3G0V A;  2Z45 A;  4U0E A;  3Q20 A;  1RO2 A;  1NJI Q;  1K30 A;  4XFY A;  1IUQ A;  2CWO A;  1QRJ A;  2PEQ A;  1YJ9 P;  2OTL P;  2ONT A;  5BS2 A;  1PEO A;  3DPH A;  4PH1 A;  4XRQ A;  3CXC O;  5JPA A;  1VQP P;  1ZMB A;  2PEN A;  2BQ1 E;  1VQ4 P;  3NTE A;  3H47 A;  3H0D A;  3G21 A;  3B5I A;  2PEI A;  2LF4 A;  1M6E X;  1YHQ P;  2Z46 A;  1VQ6 P;  1PEQ A;  3I56 P;  1VQ9 P;  4GR6 A;  1VQ5 P;  3P05 A;  5HGM A;  1Q82 Q;  3DS2 A;  1VQL P;  2PEM A;  1M1K Q;  2P9X A;  4XFX A;  1K8A Q;  4COP A;  4XRO A;  4XFZ A;  2EG5 A;  2KOD A;  2Z44 A;  2JYL A;  5HGL A;  2JYG A;  4U0D A;  1YI2 P;  1KD1 Q;  5F2N A;  2PEJ A;  4PH0 A;  3CC7 P;  3CMA P;  5BS1 A;  1A8O A;  3CCE P;  4U0F A;  1K73 Q;  3DS4 A;  3G1I A;  3CCS P;  3CME P;  3G29 A;  3G1G A;  1YIT P;  1VQN P;  3CCM P;  1KQS O;  3CD6 P;  1S72 P;  3OW2 O;  1D1D A;  1Q86 Q;  1Q81 Q;  3H4E A;  2E1M A;  3WBH A;  1VQK P;  2M8L A;  3CCR P;  2M8P A;  3CC2 P;  5HGN A;  2PEK A;  3LRY A;  2DGY A;  2BUO A;  1K9M Q;  3G28 A;  4M0I A;  3VRL C;  1M90 Q;  4GR2 A;  3RG6 C;  3DTJ A;  1YIJ P;  1E6J P;  1BAJ A;  1M74 A;  1W2B O;  5F2K A;  1EIA A;  3DS0 A;  5F2O A;  3G4S P;  2QEX P;  1VQM P;  1PEM A;  3CCJ P;  3DS3 A;  1RO0 A;  1YJN P;  2PY8 A;  1RNI A;  3HZQ A;  3CCV P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...