1VQ8P

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq8P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq8P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq8P02
3G71P 1K73Q 2QEXP 3CCUP 1VQPP 3OW2O 1K8AQ 1S72P 3G6EP 2OTLP 1YHQP 1M90Q 3CC2P 3CCVP 2OTJP 1YJNP 1N8RQ 1KD1Q 1VQ5P 1KQSO 1VQ8P 1VQLP 1YJ9P 3CC4P 1VQOP 3CC7P 1YITP 3I55P 1VQ9P 3CCJP 1VQ6P 1VQ7P 3CCLP 1Q7YQ 1KC8Q 3CCQP 1VQKP 1W2BO 1QVFO 1Q82Q 1VQNP 1Q81Q 3G4SP 3CCRP 1VQMP 3I56P 3CCSP 1NJIQ 1YIJP 3CMEP 1YJWP 1VQ4P 3CCEP 3CCMP 1JJ2O 3CXCO 3CPWO 1YI2P 1M1KQ 3CD6P 1K9MQ 1Q86Q 2QA4P 1QVGO 3CMAP
chains in the Genus database with same CATH superfamily
4N78D 3SSUA 1KB9D 3CCVP 2RN0A 3L71J 2E74D 4BWNA 4GOEA 3NMDA 1DD3A 1PEQA 1FDMA 1HWTC 3TF5A 1ZMBA 3HZQA 3II6A 1EOQA 3GF3A 1LTBC 2K3RA 1BE3J 2HG5D 3PHLA 5CJ4A 2O3JA 1SQXD 2C9NY 2Z5IA 1IFMA 3H1LJ 1L0NG 1N73C 5KP7B 3CCJP 1Q2NA 1GU5A 5AW6B 4PV1B 1L0LE 1PP9J 3A5TA 1SQBG 2LF4A 2R5BA 3H1KD 3HUSC 1Y9BA 2WMMA 2A06G 2AXTH 1ZV8A 1QVGO 4C7NA 2MD9A 1GL2A 1BSHA 1L0NE 5KP6B 1FU1A 2XV5A 1HJBA 5APTA 4XE5B 2WPVB 4PD4E 4O9BA 3BCCE 2IBZG 1SQPJ 5AVSB 1ZR4A 2PY8A 3EJEA 2KGDA 4GR2A 3CX5H 4Y99B 1KILA 2P2UA 5HVCA 1FZAA 2XZRA 2PEMA 1VQ8P 2IZ0A 1NTMJ 2R3CA 2W83C 2WT7A 4JF7A 1USEA 5AVYB 1NJIQ 1NTZG 1EZVG 4H13B 1RE4A 5CCHA 2BCCG 2E42A 2K37A 1UIIA 1ZRTE 1X22A 1X0TA 1LT9A 1NTZK 3L71E 1YJ9P 2KOSA 2Q6QA 2WSFJ 3HUSA 5CCHC 4Y28J 5AVQB 2BCCE 2P10A 1RHZB 2YKQA 2WPTA 1IFPA 2N9BA 4C7NB 2OYHB 3GLMA 1CZQA 3C9IA 4B86A 5APQA 3CXHE 1PPJD 1CW5A 4IOIH 1LTSC 5AVVB 1PFIA 2ZXEB 2FFDA 1KILC 2MVUA 4F37A 4BPGA 1AQ5A 3IR9A 1G2CA 3OJAB 5B66E 2IYPA 1GD2E 3B5ND 3ABVC 1LWUB 1JCDA 2KOOA 4XROA 1KYOE 3GHGA 3HE5B 1LWUC 3H32B 5BU8B 3G9RA 1NTZE 4ZKUA 4WWIA 5DJTB 1JMMA 2BCCD 3H1LG 4UHPB 5JPAA 1SFCC 4BPHA 1YBKA 2H89C 4LLHA 3MIWA 1ZXGA 1ZN5A 1HVVA 2PEQA 1VQPP 1M90Q 1K05A 3RG6C 1S5LX 1U7MA 4RKUJ 1VHNA 3A0HH 3L75J 1OMIA 1IMQA 1OXZA 3PJSK 4BXLA 2ZT9C 2PRRA 3H1IG 3BRTB 3H1KE 3RGUA 2KK7A 1EZVD 2N1TA 3TGUE 5KLVG 1JY2N 5CCGC 2KNCA 1URQC 1J1EC 4U3FE 3HD7B 2NO8A 3MD0A 1RE3C 3H1HG 2FAEA 1VQKP 3CX5E 1E0HA 3M91A 1FDIA 2W8ZA 1EQ7A 5AVUB 2KODA 2FYNB 3L70E 2K0XA 3M06A 5AW1B 2M3BA 1FJKA 1NTMK 3U1CA 3AE5C 2JO0A 3IAOA 4IL6E 2QM8A 2O1KA 4U0EA 1QL1A 4PJ0E 1FZCC 3DS4A 4Y99C 2IZ1A 3CWBG 3CCEP 4N78E 2OARA 3P05A 2ZJSE 2DW3A 3HD7D 5HGNA 1FOSF 1L0LD 3FXDA 3CCUP 3RK2B 2L0QA 3MP7B 1GL2B 3NTNA 2VLNA 2LXBA 1IO4A 4IL6H 4OH8B 2L4BA 1SQPD 4I1LA 2AVAA 5AW3B 1Q90D 2GDWA 1UIXA 3GMAA 3MUDA 1VQ4P 1QLED 1URQA 4HKGA 1X9VA 1ZW0A 4U3FD 3H47A 1NTKG 1Y47A 2ZYDA 1VF5C 2HODB 2WITA 1GXHA 2OTKE 1PZQA 1J1DB 2CPBA 3H1JE 2Y0CA 2E5TA 1NAFA 2XZ0D 1K9MQ 4W80A 2QA4P 1KORA 1JEKA 2WSFH 3G1GA 2M8LA 1URQB 4L74A 4EIJA 5B5EH 2OYIA 5KKZB 1LGHB 1G1JA 1L4AC 3EJDA 3CCMP 3SFEC 1SQQD 4K35A 2D2CB 3H1IE 3FX0A 1NTZD 3LRYA 4QKOA 1G2CB 2K93A 3F5HA 5AW7B 4H13C 2WWWA 2L5GB 1M1JC 3E1IA 7CEIA 1E5WA 2OQQA 3H1JG 2YMYA 1URQD 1ZLLA 3U59A 1FZGA 3WMM0 1DEEG 1D1DA 1GMJA 2LIWA 1E79H 1X8YA 3V2QA 1KD1Q 3QWOC 3T97A 3B5NB 3GW6A 3RL0C 2XXMA 4XFJA 1IFIA 2Q3IA 4GOFA 3D70A 2VLQA 2KOGA 1T2KD 3G21A 4R0MA 3L72E 2KOPA 1P84D 1OW7A 1L0LK 1ZMEC 2OYIC 1NO4A 4AYCA 1ZRTD 3V6IA 2OYIB 3MGNA 1J1DC 1IFNA 2YIUC 1GW4A 2QJPB 3RL0g 1LJ2A 3JSVC 3IFMA 3L72G 5CZDB 1PGQA 3AEBC 2N1TB 1BE3G 1OZHA 1IJDB 1VQOP 1M8OB 4U0FA 3SWKA 5KAFE 3AE2C 3H0DA 3MTUE 4PD4H 1FE6A 5KLVK 4BRYA 2VRSA 1NWQA 1N7LA 4U0CA 1FBMA 2M8NA 1RO2A 1PIXA 5HV8A 3BVHA 2UWJE 1BCCJ 1L0LG 1S3JA 1KYOI 3V4WA 3RL0B 1T3UA 4YTPC 2P7JA 1LTJA 3L73G 4R4MA 1FZFA 1OWAA 4KJMA 1KFNA 3TGUG 2N6YA 1SQXG 4A7PA 3RK2D 2OYOA 3M0DA 1TU3F 1MUUA 2KZJA 3VP8A 5CBNA 4GKGA 3CCSP 1LTTC 3VP9A 5APWA 2HODA 2BUOA 1OW8A 3CXCO 4CA3A 1T8KA 1PV3A 2IBZD 4PWVB 1NTKD 2JKVA 4PV1C 1R8EA 4W7YA 2FACA 1EC5A 1LT9C 2VLOA 3LW5J 1DNYA 1NTMG 3CC7P 1VQ9P 2CPSA 2H88C 1A02J 2ZVNB 3L71G 1JY2P 2YIUB 3ZDMA 4OVNF 2K92A 4BPFA 2MY5A 2M5AA 2GZFA 2BASA 1GU4A 1AF8A 2K94A 1OVUA 3K5BA 1BDCA 2QNWA 2K1AA 3CXHH 2FYUE 3DS2A 1S9KE 3M9HA 1XTCC 2XU6A 3VOPA 1RF1A 1RE3A 2MKVA 4LGDE 2Y0DA 4H44B 4OGQD 1EDJA 3Q20A 1ZOYC 1KQLA 2XNDH 2E76D 5APUA 5TISH 1SQVG 2FYUD 1GW3A 2M5AB 2CG5B 2CWOA 1SQXJ 1VF5B 2H43A 2PEKA 1QRJA 5HGLA 1NKZB 2N98A 1AFOA 4OGQC 5BU5A 1IUQA 3LIEA 1JY3N 1NTMD 4U0DA 4OGQB 2G3AA 1OX3A 1VQLP 2NPSD 3H6PA 4PH1A 1A02F 2FVFA 3NXSA 2WSSH 5CMZA 5GTIE 3WUVA 2NRGA 2FFDC 1L0NJ 1FS0E 1JCCA 2O01H 2N1TC 4I7ZC 1YHQP 3PH0A 1P84H 4C7RA 2ONTA 4H2YC 4JYCA 4I6MC 3L73D 1LTIC 3WBHA 3U43A 4NPFX 2FYUJ 2YO2A 1AQTA 2KSJA 2LPKA 5APVA 2A45I 2NPSA 1PGPA 2M8RA 1SFCA 3P32A 1FAVA 2LMLA 2B87B 2WPQA 4U7JA 3AE7C 1KB9H 3H1HE 1X3OA 4PH0A 2NPSC 3RG2A 3SFDC 2WTYA 1KC8Q 2QJPC 1VPCA 3A0BH 1D7MA 4JBZA 4U0BA 3L36A 1JOCA 3M9BA 3LW5H 1EXJA 2W6AA 1N8RQ 3L70G 4N3YB 2IX7C 5KJ7C 3M0DC 1NQ4A 3I56P 4XRQA 5BS1A 1EZVE 2Z45A 1FZBA 5CCHD 5KJ7D 1IFDA 3S9OA 5KAIE 5KP8B 2KYVA 3KYQA 1L4AD 2B87A 1JNMA 2IFMA 5AW4B 3H4EA 1OFCX 1NH4A 5KKZC 1Q81Q 1QL2A 1P84E 1F80D 1DX7A 4L76A 1SQBK 1BXIA 2FYZA 2A45G 5DJUB 3CWBD 1H0TB 1K73Q 4IL6X 4I7ZB 3V2PA 3Q5SA 5AW2B 2KG8A 1RQUA 2AF8A 2E76C 1T8ZA 2FQ2A 4UB8H 2ITAA 3D71A 2C0WA 1QEXA 3BASA 2E75D 3AE6C 2PGDA 3RL0D 3GZMA 3LIDA 1FZEA 3L74J 1FJPA 4H0LC 5BVZA 3CXHD 2IPPA 4DJGA 3WU2E 2MF4A 1J1EB 3H1IJ 1BCCD 1YJWP 2KGEA 2WQYC 3G1IA 1CSBA 3M1MA 3B4SA 1SQPK 2GZGA 2Q5UA 5E79E 2GUSA 4U0AA 2KW2A 2W90A 5AVZB 2ZYAA 1R5LA 2MR8A 1NAYA 1FR2A 1L0IA 3P8MC 4HB1A 3G0VA 1JTHA 2K2QA 4U3FG 3H1JD 2DNWA 1HQBA 3GJNA 1J2JB 3VMYA 1N2DC 1NOHA 1EIAA 1W5CE 2RKLA 1GDTA 3VN0A 2I1KA 3RK3B 3E2DA 2E1MA 4K3AA 2V7QJ 1GTWA 3TSIA 2Z5HA 4DZOA 4EDFA 1M6NA 3JCUH 2N9YB 2L9FA 1ZNVA 2FADA 2FVEA 2KXPB 1YQ3C 1L2PA 3G29A 3EWKA 1SQBJ 4RO0A 1XTGB 2E76B 1YITP 3Q3DA 3PTZA 1SQVE 1BDDA 2P67A 2KUBA 4YPCA 4WBAA 5M1BA 2IYOA 3AEEC 1JUNA 1WMKA 3HD7A 3UIAA 2KLVA 3KZIE 3WUUA 2HLOA 4JPZB 4HKZH 5KLVD 3HTKA 5AW5B 2YKOA 1YJNP 3U1AA 1SFCB 2R3SA 2L91A 3R4YA 4QMAA 1CI6A 1AA0A 1OVVA 1NTKE 4UB6E 2K9JB 2IBZE 2K5XA 4IPYA 3B5NC 3BATA 2G8YA 2I1JA 1Q86Q 1IK9A 1NU1K 2D2CD 2Z4EA 1LWUA 3V2RA 3HE4B 1SQPE 2HPCB 5CCGA 3H1HJ 1JMBA 3DS3A 1SQVJ 1NHLA 3GF7A 1SQBD 3D6YA 3L75D 1HUCA 4DG9A 2AXTE 2BHVA 2FQ0A 3CPWO 3Q1MA 1IK7A 4RJTA 5HGOA 2PNGA 2BQ1E 4BRYB 2N5HA 1VL2A 2N1TD 1N7SA 1FC2C 4EI2A 1PP9E 1SQQK 3VRLC 2K0YA 3CC4P 1WT6A 1L4AB 2SPZA 1KFMA 4JQ0D 2QG4A 1FZCA 4W7ZA 2Y0EA 2GA1A 2PEOA 3H1LE 3AE8C 1EZVI 3L74E 2PENA 2GZJA 3JCUE 5KLIB 1RQVA 4AQRD 3C8VA 4Z1MH 4H44D 1JB0J 2MJZA 3C1LA 2W6JH 3OA7A 1JM0A 2GZEA 1NTKJ 1L0HA 5BS2A 2H7HA 1KYOD 3TGUD 2FXPA 3DS1A 1PEOA 2KNCB 1KLPA 2HYNA 2C9LY 2JB0A 1AVOA 1R5SA 1YTZT 2R5DA 1MZ8A 4ASVA 1MZ9A 1Z56A 4DOJA 4H2WC 1YIJP 2N5IA 2B88A 1EXIA 3USSA 3D6ZA 1K04A 1PEMA 1YQ4C 5GTIH 2DGYA 2QEXP 2BEQD 3O6QB 2VLPA 4DCKA 2N6ZA 1NVOA 1BGYG 1SS1A 3B4QA 1IZNB 2LL8A 1BE3D 5TJHA 1OVRA 2FYNC 2V4HA 5KJ7A 1FZCB 1Z6MA 1L4AA 1JJ2O 1VKUA 3WUTA 4GT1A 2WPSA 2OTLP 1BE3E 5HGMA 2IDBA 2FXOA 2O01N 3EFGA 3H1KJ 4TLFA 3B8EB 4H0LB 1S2EA 2KIKA 3P8CE 2A45H 3H1ID 4OWFA 2K9JA 3HD7C 3CWBE 4H0LD 4NEOA 3BCCD 1M74A 1DV5A 1L0NK 1M7LA 3L71D 2GZIA 2Q3EA 2R32A 2CNRA 1VDFA 5H2FH 1KILD 3L73J 3GZLA 3MGEA 3H32A 4L75A 1CI6B 2K0DX 3W68A 5KAIH 1OW6A 2KP8A 4N6JA 1PGJA 3O6QA 2QIWA 1M1JA 2WPRA 3A2AA 4PJ0H 5APYA 3KDPB 1HGZA 4IFMA 4XA4A 2QJKB 5CBOA 2WT7B 2CQ8A 4L73A 1SQXE 3FGAD 3HUSB 5KLVJ 2HFED 2GDXA 1GK4A 1KILB 4PD4D 5K5GB 2FYUG 2KORA 2OTJP 2ZYGA 2AFDA 1M56D 2GM4A 2Z44A 1VQ6P 1DIPA 1KZUB 1L0ND 1NU1E 2VSQA 3KPEA 3H1HD 4NPEA 1KB9E 1X79B 2MVVA 4ASWA 3SWFA 2XT1A 2FBWC 1N7SB 3KZIH 5I4TG 2FKWB 1S72P 1SQBE 2M0BA 2J59M 2NPSB 2YNYA 1NYHA 5EW5E 2KGAA 1LTJC 2YMKA 2P58A 5AVXB 2KG6A 3CD6P 3V2NA 2PEJA 4WY4C 3TNUA 3KXDA 1SQVK 2JP3A 3CX5D 1KV4A 5F2OA 1A43A 2JWAA 2Q7CA 4GR6A 2KGCA 1LNQA 1HGVA 2IBZI 5DCKA 2LKMA 3A3YB 1YTZI 3PRJA 1DEBA 3BCCG 4ZMDA 2JJLA 4AUWA 3BRVB 3B5IA 2WVRA 1GZLA 5EFWB 3EQ2A 3P8CD 3CX5I 3FXEA 2A06E 4M0IA 1KQGB 1BCCE 3AE3C 2W27A 2WSCJ 1MV8A 1E6JP 2B89A 3V5BA 1NGMB 2JU2A 2YXRB 4D6TE 4GIFA 1UJZA 2AFEA 1UNKA 1KTMA 2BEZF 3T97B 3RBXA 1SP4A 3KHUA 1N7SD 3DPHA 3S4RA 3CXHI 2JGPA 1DD4A 1PPJE 3OW2O 1SQXK 1GL2C 3O8ZA 3JC22 3L70J 2Y9ZA 3CC2P 2WSCH 1DH3A 2E74C 1LP1A 2ZFCA 5CCGD 5CHXA 1PEUA 3I55P 3OAKA 1VQ7P 3H25A 4MN4C 5APSA 2GUVA 3CCRP 1JY3P 1WRGA 2FY8A 2GYKA 2YKPA 3FWLA 2FQ1A 3VMZA 2KI7B 5AVWB 2H8PD 5AW8B 3VMAA 1BCCG 2FVAA 4COCA 1BSNA 4M3LA 1HF9A 4WY4B 2QE7H 1RE4C 4H13D 2RH0A 4KT0J 1L0LJ 4WYMA 1LTAC 3ITKA 2R44A 1FOSE 3FWNA 2ROQA 3I5CA 2JEEA 2FYUK 2WZ7A 3H1JJ 2KS1B 2JYGA 3PLNA 1N73A 3V4QA 1KMIZ 2ZAEB 1Q82Q 2PP6A 3AECC 1VQMP 2PFXA 4D6TG 1GL2D 3RK2C 3N7NA 1ZP0C 3L74D 4H2XC 2CK3H 2EFJA 4ZKPA 4HYTB 4WY4D 3DS5A 1NKNA 1RH5B 2M3EA 2OYHC 3E7KA 4GDOA 1AV1A 1HTLC 1RNIA 1ZR2A 4KHXA 1GK6A 3H1KG 1VF5D 3L4FA 1BAJA 3MUDC 4XFZA 2CGQA 2YO3A 3G3ZA 1M57D 2V7QH 2KS1A 3CI9A 3L75E 2NZ2A 3VTPC 3AE1C 2OGUA 1M6EX 3TNUB 2W6BA 1IFJA 2AEJA 2IFNA 3AEGC 3GHGC 4GODA 4WY4A 3EJBA 1HJ0A 2AXCA 4YXDC 5KTBA 1HH0A 4COPA 3L75G 2FXMA 1N73B 1U7JA 3LMOA 3A7OA 4RESB 1AJYA 5APXA 1VQ5P 1SLQA 3RBZA 2FFDB 1PGOA 3RK3E 4WVZA 5KLVE 1IMPA 1OIPA 1AVYA 3NFQA 1YI2P 4CPGA 2OYHA 3R2PA 1SQQJ 5C39A 2KZIA 4D6TJ 2BCCJ 3G26A 1EDLA 2B9BA 1SQVD 1JTHB 2O1JA 2EG5A 3L73E 2J5UA 1HBWA 2QRXA 3CLQA 1BGYJ 5TISE 1H89A 1MFTA 1YYCA 4IFDK 3B5NA 2K9YA 1LP1B 2C0XA 1KN7A 1SQQE 2K88A 2PAJA 1BGYE 2ZT9B 2KOQA 4HH2A 3IF4A 2P1JA 2JBGA 2ZT9D 3HYBA 2JWDA 2JQ4A 2AEFA 1NTME 4QNBA 5B66H 2KR5A 1Y8AA 4PXHB 1PL5A 3CMEP 3VYIA 1QGKB 3GHGB 3HE5A 4LC1A 1H88A 3TK1A 1LTJB 5AVTB 1P84I 5AVRB 4EOTA 5E79H 2QSIA 1LT1A 3CL3D 1FDOA 5CJ0A 3IN6A 2QJKC 2M5RA 2QVAA 2Q9IA 1HY8A 3GKLC 1BGYD 2J58A 4U3FJ 2ZXXA 1S1CX 2EIAA 1S4XA 1GPJA 3NTEA 1RF0A 3AEFC 3G71P 4PD4I 4XFXA 1S5LH 3G28A 3G6EP 2M8PA 5GTHE 1S9KD 2D2CC 3HTKB 1JY2O 3Q5PA 1H8AA 3Q5RA 3AEDC 1SVFA 2EHSA 4XFYA 3L74G 1SQPG 1G1IA 1LT9B 2I8DA 4JYBA 3RK3D 3AEAC 4NPDA 3P7KA 4UB8E 3MZWB 1N86A 2WSEH 4C46A 2XDJA 2JO1A 3AE9C 1NU1D 1KQSO 3M0AA 2QM7A 1PP9G 2JU1A 1RF1B 1M1KQ 3L70D 5KAFH 3KQGA 1K8AQ 2KB7P 2N50A 4UB6H 4PV1D 2QJYC 4DT0A 1RF0C 3CCLP 1Q7YQ 2L22A 3TDKA 3CE7A 2JAZA 1EDIA 2JDIH 2RMZA 3CMAP 1SQQG 3TYYA 2LOLA 2E75C 2E43A 2KSEA 2LTEA 1K30A 1KILE 3A0HE 1NU1J 3L72J 2HR3A 3CCQP 1T3JA 2E5YA 5GTHH 4YXWH 1RY3A 3L72D 1S5LE 1N7SC 1NTZJ 2Z46A 3A0BE 2HPCA 1QVFO 2WSEJ 2XNXA 5EJDA 5F2KA 2GDYA 2L6EA 2FHSC 1CEIA 2LIUA 2ZVOB 2Q1KA 2XKMA 1KYOH 4HJGH 2KG9A 3DS0A 1T6AA 1VQNP 1LTGC 4H44C 3B71A 3DTJA 3BCCJ 3L35A 1JY3O 1QX8A 1RO0A 3F89A 2XV6A 3EFFK 1RF1C 3PP5A 1KQFB 5F2NA 3HE4A 2LXCB 5H2FE 2JR8A 1H0TA 1SFCD 3HRNA 3QH9A 4D6TD 3TGUJ 2X2BA 1U57A 4IZ6A 2LR2A 4WB4A 2POHA 1USDA 2A06D 3AE4C 1A8OA 2MR7A 1NTKK 2P9XA 3VMXA 5AW9B 3E1RA 3MHVA 4MRTC 1T2KC 2QJYB 5AW0B 4TT3H 3WU2H 3Q2YA 3G4SP 1W2EA 3CWBJ 1PPJG 2YXQB 1AYIA 1JO5A 3SWYA 4I2LC 2E75B 1ACPA 2ERHA 5KLIC 2LKIA 1EMVA 1OR5A 1EDKA 1W2BO 2O01J 1AUMA 3RK3C 3L37A 4EYYQ 2XZ1C 3M9QA 3S1KA 5L8RJ 1IC2A 2KWLA 5B5EE 3H1LD 1M1JB 1MKMA 2EHTA 2PEIA 3N4XA 1PP9D 4IFFA 2JYLA 1GXGA 3W67A 3GG2A 2Y9YA 3NY7B 1MFZA 1KB9I 2KLUA 4R4LA 2AEMA 2E74B 4ZNCA 1NU1G
chains in the Genus database with same CATH topology
3G26A 5F2NA 5DCKA 3G1GA 2EG5A 4PH0A 3CCVP 1YJNP 2JYGA 1KQSO 2M8LA 1YJ9P 3DS2A 1VQOP 1PEQA 1KC8Q 1VQKP 1ZMBA 1Q82Q 3HZQA 4U0FA 1VQMP 1YIJP 4IPYA 1EOQA 1A8OA 1YJWP 3B5IA 2KODA 3CCMP 1M1KQ 2P9XA 1Q86Q 2EFJA 3H0DA 1PEMA 3Q20A 4U0BA 2DGYA 3LRYA 2QEXP 1K8AQ 4M0IA 3G1IA 2OTJP 1N8RQ 3DS5A 3M1MA 2JO0A 1E6JP 3HYBA 3DS3A 4U0CA 2Z44A 1VQ6P 3CCJP 2M8NA 1RNIA 1RO2A 4U0AA 4U0EA 1Q7YQ 4QNBA 3CCLP 3DS4A 3G4SP 3I56P 2CWOA 4XRQA 2BHVA 3CMEP 1BAJA 2LF4A 4XFZA 5BS1A 3CCEP 2PEKA 1QRJA 1JJ2O 2Z45A 5HGLA 2OARA 3CPWO 2XT1A 3P05A 3DPHA 1D1DA 5HGNA 1QVGO 5HGOA 3CMAP 3G0VA 2BQ1E 5I4TG 3CCUP 1IUQA 3OW2O 1S72P 4U0DA 2OTLP 3CC2P 1KD1Q 5HGMA 1M6EX 1K30A 1EIAA 3H4EA 4XROA 1VQLP 3VRLC 3CC4P 1PEUA 3I55P 1VQ7P 3E2DA 2E1MA 4PH1A 3CCQP 1W2BO 1Q81Q 3CCRP 3CCSP 1AUMA 2BUOA 2EIAA 2XXMA 2PEOA 1VQ4P 3CXCO 3NTEA 5JPAA 4COPA 2PENA 1M6NA 3CD6P 2Z46A 2PEJA 2PY8A 1QVFO 4GR2A 3G71P 1K73Q 3G21A 2PEQA 4XFXA 1VQPP 1M74A 3G28A 5F2KA 3G6EP 2L6EA 2M8PA 3G29A 1YHQP 1M90Q 2PEMA 2ONTA 1VQ5P 3H47A 1VQ8P 2PEIA 3CC7P 3RG6C 5BS2A 3WBHA 5F2OA 1YITP 1VQ9P 1A43A 4COCA 4XFYA 3DS0A 1VQNP 2JYLA 3DS1A 1NJIQ 3DTJA 3MGEA 4GR6A 1PEOA 1YI2P 1RO0A 1K9MQ 4WYMA 2QA4P 2XV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 P;  1K73 Q;  2QEX P;  3CCU P;  1VQP P;  3OW2 O;  1K8A Q;  1S72 P;  3G6E P;  2OTL P;  1YHQ P;  1M90 Q;  3CC2 P;  3CCV P;  2OTJ P;  1YJN P;  1N8R Q;  1KD1 Q;  1VQ5 P;  1KQS O;  1VQ8 P;  1VQL P;  1YJ9 P;  3CC4 P;  1VQO P;  3CC7 P;  1YIT P;  3I55 P;  1VQ9 P;  3CCJ P;  1VQ6 P;  1VQ7 P;  3CCL P;  1Q7Y Q;  1KC8 Q;  3CCQ P;  1VQK P;  1W2B O;  1QVF O;  1Q82 Q;  1VQN P;  1Q81 Q;  3G4S P;  3CCR P;  1VQM P;  3I56 P;  3CCS P;  1NJI Q;  1YIJ P;  3CME P;  1YJW P;  1VQ4 P;  3CCE P;  3CCM P;  1JJ2 O;  3CXC O;  3CPW O;  1YI2 P;  1M1K Q;  3CD6 P;  1K9M Q;  1Q86 Q;  2QA4 P;  1QVG O;  3CMA P; 
#chains in the Genus database with same CATH topology
 4N78 D;  3SSU A;  1KB9 D;  3CCV P;  2RN0 A;  3L71 J;  2E74 D;  4BWN A;  4GOE A;  3NMD A;  1DD3 A;  1PEQ A;  1FDM A;  1HWT C;  3TF5 A;  1ZMB A;  3HZQ A;  3II6 A;  1EOQ A;  3GF3 A;  1LTB C;  2K3R A;  1BE3 J;  2HG5 D;  3PHL A;  5CJ4 A;  2O3J A;  1SQX D;  2C9N Y;  2Z5I A;  1IFM A;  3H1L J;  1L0N G;  1N73 C;  5KP7 B;  3CCJ P;  1Q2N A;  1GU5 A;  5AW6 B;  4PV1 B;  1L0L E;  1PP9 J;  3A5T A;  1SQB G;  2LF4 A;  2R5B A;  3H1K D;  3HUS C;  1Y9B A;  2WMM A;  2A06 G;  2AXT H;  1ZV8 A;  1QVG O;  4C7N A;  2MD9 A;  1GL2 A;  1BSH A;  1L0N E;  5KP6 B;  1FU1 A;  2XV5 A;  1HJB A;  5APT A;  4XE5 B;  2WPV B;  4PD4 E;  4O9B A;  3BCC E;  2IBZ G;  1SQP J;  5AVS B;  1ZR4 A;  2PY8 A;  3EJE A;  2KGD A;  4GR2 A;  3CX5 H;  4Y99 B;  1KIL A;  2P2U A;  5HVC A;  1FZA A;  2XZR A;  2PEM A;  1VQ8 P;  2IZ0 A;  1NTM J;  2R3C A;  2W83 C;  2WT7 A;  4JF7 A;  1USE A;  5AVY B;  1NJI Q;  1NTZ G;  1EZV G;  4H13 B;  1RE4 A;  5CCH A;  2BCC G;  2E42 A;  2K37 A;  1UII A;  1ZRT E;  1X22 A;  1X0T A;  1LT9 A;  1NTZ K;  3L71 E;  1YJ9 P;  2KOS A;  2Q6Q A;  2WSF J;  3HUS A;  5CCH C;  4Y28 J;  5AVQ B;  2BCC E;  2P10 A;  1RHZ B;  2YKQ A;  2WPT A;  1IFP A;  2N9B A;  4C7N B;  2OYH B;  3GLM A;  1CZQ A;  3C9I A;  4B86 A;  5APQ A;  3CXH E;  1PPJ D;  1CW5 A;  4IOI H;  1LTS C;  5AVV B;  1PFI A;  2ZXE B;  2FFD A;  1KIL C;  2MVU A;  4F37 A;  4BPG A;  1AQ5 A;  3IR9 A;  1G2C A;  3OJA B;  5B66 E;  2IYP A;  1GD2 E;  3B5N D;  3ABV C;  1LWU B;  1JCD A;  2KOO A;  4XRO A;  1KYO E;  3GHG A;  3HE5 B;  1LWU C;  3H32 B;  5BU8 B;  3G9R A;  1NTZ E;  4ZKU A;  4WWI A;  5DJT B;  1JMM A;  2BCC D;  3H1L G;  4UHP B;  5JPA A;  1SFC C;  4BPH A;  1YBK A;  2H89 C;  4LLH A;  3MIW A;  1ZXG A;  1ZN5 A;  1HVV A;  2PEQ A;  1VQP P;  1M90 Q;  1K05 A;  3RG6 C;  1S5L X;  1U7M A;  4RKU J;  1VHN A;  3A0H H;  3L75 J;  1OMI A;  1IMQ A;  1OXZ A;  3PJS K;  4BXL A;  2ZT9 C;  2PRR A;  3H1I G;  3BRT B;  3H1K E;  3RGU A;  2KK7 A;  1EZV D;  2N1T A;  3TGU E;  5KLV G;  1JY2 N;  5CCG C;  2KNC A;  1URQ C;  1J1E C;  4U3F E;  3HD7 B;  2NO8 A;  3MD0 A;  1RE3 C;  3H1H G;  2FAE A;  1VQK P;  3CX5 E;  1E0H A;  3M91 A;  1FDI A;  2W8Z A;  1EQ7 A;  5AVU B;  2KOD A;  2FYN B;  3L70 E;  2K0X A;  3M06 A;  5AW1 B;  2M3B A;  1FJK A;  1NTM K;  3U1C A;  3AE5 C;  2JO0 A;  3IAO A;  4IL6 E;  2QM8 A;  2O1K A;  4U0E A;  1QL1 A;  4PJ0 E;  1FZC C;  3DS4 A;  4Y99 C;  2IZ1 A;  3CWB G;  3CCE P;  4N78 E;  2OAR A;  3P05 A;  2ZJS E;  2DW3 A;  3HD7 D;  5HGN A;  1FOS F;  1L0L D;  3FXD A;  3CCU P;  3RK2 B;  2L0Q A;  3MP7 B;  1GL2 B;  3NTN A;  2VLN A;  2LXB A;  1IO4 A;  4IL6 H;  4OH8 B;  2L4B A;  1SQP D;  4I1L A;  2AVA A;  5AW3 B;  1Q90 D;  2GDW A;  1UIX A;  3GMA A;  3MUD A;  1VQ4 P;  1QLE D;  1URQ A;  4HKG A;  1X9V A;  1ZW0 A;  4U3F D;  3H47 A;  1NTK G;  1Y47 A;  2ZYD A;  1VF5 C;  2HOD B;  2WIT A;  1GXH A;  2OTK E;  1PZQ A;  1J1D B;  2CPB A;  3H1J E;  2Y0C A;  2E5T A;  1NAF A;  2XZ0 D;  1K9M Q;  4W80 A;  2QA4 P;  1KOR A;  1JEK A;  2WSF H;  3G1G A;  2M8L A;  1URQ B;  4L74 A;  4EIJ A;  5B5E H;  2OYI A;  5KKZ B;  1LGH B;  1G1J A;  1L4A C;  3EJD A;  3CCM P;  3SFE C;  1SQQ D;  4K35 A;  2D2C B;  3H1I E;  3FX0 A;  1NTZ D;  3LRY A;  4QKO A;  1G2C B;  2K93 A;  3F5H A;  5AW7 B;  4H13 C;  2WWW A;  2L5G B;  1M1J C;  3E1I A;  7CEI A;  1E5W A;  2OQQ A;  3H1J G;  2YMY A;  1URQ D;  1ZLL A;  3U59 A;  1FZG A;  3WMM 0;  1DEE G;  1D1D A;  1GMJ A;  2LIW A;  1E79 H;  1X8Y A;  3V2Q A;  1KD1 Q;  3QWO C;  3T97 A;  3B5N B;  3GW6 A;  3RL0 C;  2XXM A;  4XFJ A;  1IFI A;  2Q3I A;  4GOF A;  3D70 A;  2VLQ A;  2KOG A;  1T2K D;  3G21 A;  4R0M A;  3L72 E;  2KOP A;  1P84 D;  1OW7 A;  1L0L K;  1ZME C;  2OYI C;  1NO4 A;  4AYC A;  1ZRT D;  3V6I A;  2OYI B;  3MGN A;  1J1D C;  1IFN A;  2YIU C;  1GW4 A;  2QJP B;  3RL0 g;  1LJ2 A;  3JSV C;  3IFM A;  3L72 G;  5CZD B;  1PGQ A;  3AEB C;  2N1T B;  1BE3 G;  1OZH A;  1IJD B;  1VQO P;  1M8O B;  4U0F A;  3SWK A;  5KAF E;  3AE2 C;  3H0D A;  3MTU E;  4PD4 H;  1FE6 A;  5KLV K;  4BRY A;  2VRS A;  1NWQ A;  1N7L A;  4U0C A;  1FBM A;  2M8N A;  1RO2 A;  1PIX A;  5HV8 A;  3BVH A;  2UWJ E;  1BCC J;  1L0L G;  1S3J A;  1KYO I;  3V4W A;  3RL0 B;  1T3U A;  4YTP C;  2P7J A;  1LTJ A;  3L73 G;  4R4M A;  1FZF A;  1OWA A;  4KJM A;  1KFN A;  3TGU G;  2N6Y A;  1SQX G;  4A7P A;  3RK2 D;  2OYO A;  3M0D A;  1TU3 F;  1MUU A;  2KZJ A;  3VP8 A;  5CBN A;  4GKG A;  3CCS P;  1LTT C;  3VP9 A;  5APW A;  2HOD A;  2BUO A;  1OW8 A;  3CXC O;  4CA3 A;  1T8K A;  1PV3 A;  2IBZ D;  4PWV B;  1NTK D;  2JKV A;  4PV1 C;  1R8E A;  4W7Y A;  2FAC A;  1EC5 A;  1LT9 C;  2VLO A;  3LW5 J;  1DNY A;  1NTM G;  3CC7 P;  1VQ9 P;  2CPS A;  2H88 C;  1A02 J;  2ZVN B;  3L71 G;  1JY2 P;  2YIU B;  3ZDM A;  4OVN F;  2K92 A;  4BPF A;  2MY5 A;  2M5A A;  2GZF A;  2BAS A;  1GU4 A;  1AF8 A;  2K94 A;  1OVU A;  3K5B A;  1BDC A;  2QNW A;  2K1A A;  3CXH H;  2FYU E;  3DS2 A;  1S9K E;  3M9H A;  1XTC C;  2XU6 A;  3VOP A;  1RF1 A;  1RE3 A;  2MKV A;  4LGD E;  2Y0D A;  4H44 B;  4OGQ D;  1EDJ A;  3Q20 A;  1ZOY C;  1KQL A;  2XND H;  2E76 D;  5APU A;  5TIS H;  1SQV G;  2FYU D;  1GW3 A;  2M5A B;  2CG5 B;  2CWO A;  1SQX J;  1VF5 B;  2H43 A;  2PEK A;  1QRJ A;  5HGL A;  1NKZ B;  2N98 A;  1AFO A;  4OGQ C;  5BU5 A;  1IUQ A;  3LIE A;  1JY3 N;  1NTM D;  4U0D A;  4OGQ B;  2G3A A;  1OX3 A;  1VQL P;  2NPS D;  3H6P A;  4PH1 A;  1A02 F;  2FVF A;  3NXS A;  2WSS H;  5CMZ A;  5GTI E;  3WUV A;  2NRG A;  2FFD C;  1L0N J;  1FS0 E;  1JCC A;  2O01 H;  2N1T C;  4I7Z C;  1YHQ P;  3PH0 A;  1P84 H;  4C7R A;  2ONT A;  4H2Y C;  4JYC A;  4I6M C;  3L73 D;  1LTI C;  3WBH A;  3U43 A;  4NPF X;  2FYU J;  2YO2 A;  1AQT A;  2KSJ A;  2LPK A;  5APV A;  2A45 I;  2NPS A;  1PGP A;  2M8R A;  1SFC A;  3P32 A;  1FAV A;  2LML A;  2B87 B;  2WPQ A;  4U7J A;  3AE7 C;  1KB9 H;  3H1H E;  1X3O A;  4PH0 A;  2NPS C;  3RG2 A;  3SFD C;  2WTY A;  1KC8 Q;  2QJP C;  1VPC A;  3A0B H;  1D7M A;  4JBZ A;  4U0B A;  3L36 A;  1JOC A;  3M9B A;  3LW5 H;  1EXJ A;  2W6A A;  1N8R Q;  3L70 G;  4N3Y B;  2IX7 C;  5KJ7 C;  3M0D C;  1NQ4 A;  3I56 P;  4XRQ A;  5BS1 A;  1EZV E;  2Z45 A;  1FZB A;  5CCH D;  5KJ7 D;  1IFD A;  3S9O A;  5KAI E;  5KP8 B;  2KYV A;  3KYQ A;  1L4A D;  2B87 A;  1JNM A;  2IFM A;  5AW4 B;  3H4E A;  1OFC X;  1NH4 A;  5KKZ C;  1Q81 Q;  1QL2 A;  1P84 E;  1F80 D;  1DX7 A;  4L76 A;  1SQB K;  1BXI A;  2FYZ A;  2A45 G;  5DJU B;  3CWB D;  1H0T B;  1K73 Q;  4IL6 X;  4I7Z B;  3V2P A;  3Q5S A;  5AW2 B;  2KG8 A;  1RQU A;  2AF8 A;  2E76 C;  1T8Z A;  2FQ2 A;  4UB8 H;  2ITA A;  3D71 A;  2C0W A;  1QEX A;  3BAS A;  2E75 D;  3AE6 C;  2PGD A;  3RL0 D;  3GZM A;  3LID A;  1FZE A;  3L74 J;  1FJP A;  4H0L C;  5BVZ A;  3CXH D;  2IPP A;  4DJG A;  3WU2 E;  2MF4 A;  1J1E B;  3H1I J;  1BCC D;  1YJW P;  2KGE A;  2WQY C;  3G1I A;  1CSB A;  3M1M A;  3B4S A;  1SQP K;  2GZG A;  2Q5U A;  5E79 E;  2GUS A;  4U0A A;  2KW2 A;  2W90 A;  5AVZ B;  2ZYA A;  1R5L A;  2MR8 A;  1NAY A;  1FR2 A;  1L0I A;  3P8M C;  4HB1 A;  3G0V A;  1JTH A;  2K2Q A;  4U3F G;  3H1J D;  2DNW A;  1HQB A;  3GJN A;  1J2J B;  3VMY A;  1N2D C;  1NOH A;  1EIA A;  1W5C E;  2RKL A;  1GDT A;  3VN0 A;  2I1K A;  3RK3 B;  3E2D A;  2E1M A;  4K3A A;  2V7Q J;  1GTW A;  3TSI A;  2Z5H A;  4DZO A;  4EDF A;  1M6N A;  3JCU H;  2N9Y B;  2L9F A;  1ZNV A;  2FAD A;  2FVE A;  2KXP B;  1YQ3 C;  1L2P A;  3G29 A;  3EWK A;  1SQB J;  4RO0 A;  1XTG B;  2E76 B;  1YIT P;  3Q3D A;  3PTZ A;  1SQV E;  1BDD A;  2P67 A;  2KUB A;  4YPC A;  4WBA A;  5M1B A;  2IYO A;  3AEE C;  1JUN A;  1WMK A;  3HD7 A;  3UIA A;  2KLV A;  3KZI E;  3WUU A;  2HLO A;  4JPZ B;  4HKZ H;  5KLV D;  3HTK A;  5AW5 B;  2YKO A;  1YJN P;  3U1A A;  1SFC B;  2R3S A;  2L91 A;  3R4Y A;  4QMA A;  1CI6 A;  1AA0 A;  1OVV A;  1NTK E;  4UB6 E;  2K9J B;  2IBZ E;  2K5X A;  4IPY A;  3B5N C;  3BAT A;  2G8Y A;  2I1J A;  1Q86 Q;  1IK9 A;  1NU1 K;  2D2C D;  2Z4E A;  1LWU A;  3V2R A;  3HE4 B;  1SQP E;  2HPC B;  5CCG A;  3H1H J;  1JMB A;  3DS3 A;  1SQV J;  1NHL A;  3GF7 A;  1SQB D;  3D6Y A;  3L75 D;  1HUC A;  4DG9 A;  2AXT E;  2BHV A;  2FQ0 A;  3CPW O;  3Q1M A;  1IK7 A;  4RJT A;  5HGO A;  2PNG A;  2BQ1 E;  4BRY B;  2N5H A;  1VL2 A;  2N1T D;  1N7S A;  1FC2 C;  4EI2 A;  1PP9 E;  1SQQ K;  3VRL C;  2K0Y A;  3CC4 P;  1WT6 A;  1L4A B;  2SPZ A;  1KFM A;  4JQ0 D;  2QG4 A;  1FZC A;  4W7Z A;  2Y0E A;  2GA1 A;  2PEO A;  3H1L E;  3AE8 C;  1EZV I;  3L74 E;  2PEN A;  2GZJ A;  3JCU E;  5KLI B;  1RQV A;  4AQR D;  3C8V A;  4Z1M H;  4H44 D;  1JB0 J;  2MJZ A;  3C1L A;  2W6J H;  3OA7 A;  1JM0 A;  2GZE A;  1NTK J;  1L0H A;  5BS2 A;  2H7H A;  1KYO D;  3TGU D;  2FXP A;  3DS1 A;  1PEO A;  2KNC B;  1KLP A;  2HYN A;  2C9L Y;  2JB0 A;  1AVO A;  1R5S A;  1YTZ T;  2R5D A;  1MZ8 A;  4ASV A;  1MZ9 A;  1Z56 A;  4DOJ A;  4H2W C;  1YIJ P;  2N5I A;  2B88 A;  1EXI A;  3USS A;  3D6Z A;  1K04 A;  1PEM A;  1YQ4 C;  5GTI H;  2DGY A;  2QEX P;  2BEQ D;  3O6Q B;  2VLP A;  4DCK A;  2N6Z A;  1NVO A;  1BGY G;  1SS1 A;  3B4Q A;  1IZN B;  2LL8 A;  1BE3 D;  5TJH A;  1OVR A;  2FYN C;  2V4H A;  5KJ7 A;  1FZC B;  1Z6M A;  1L4A A;  1JJ2 O;  1VKU A;  3WUT A;  4GT1 A;  2WPS A;  2OTL P;  1BE3 E;  5HGM A;  2IDB A;  2FXO A;  2O01 N;  3EFG A;  3H1K J;  4TLF A;  3B8E B;  4H0L B;  1S2E A;  2KIK A;  3P8C E;  2A45 H;  3H1I D;  4OWF A;  2K9J A;  3HD7 C;  3CWB E;  4H0L D;  4NEO A;  3BCC D;  1M74 A;  1DV5 A;  1L0N K;  1M7L A;  3L71 D;  2GZI A;  2Q3E A;  2R32 A;  2CNR A;  1VDF A;  5H2F H;  1KIL D;  3L73 J;  3GZL A;  3MGE A;  3H32 A;  4L75 A;  1CI6 B;  2K0D X;  3W68 A;  5KAI H;  1OW6 A;  2KP8 A;  4N6J A;  1PGJ A;  3O6Q A;  2QIW A;  1M1J A;  2WPR A;  3A2A A;  4PJ0 H;  5APY A;  3KDP B;  1HGZ A;  4IFM A;  4XA4 A;  2QJK B;  5CBO A;  2WT7 B;  2CQ8 A;  4L73 A;  1SQX E;  3FGA D;  3HUS B;  5KLV J;  2HFE D;  2GDX A;  1GK4 A;  1KIL B;  4PD4 D;  5K5G B;  2FYU G;  2KOR A;  2OTJ P;  2ZYG A;  2AFD A;  1M56 D;  2GM4 A;  2Z44 A;  1VQ6 P;  1DIP A;  1KZU B;  1L0N D;  1NU1 E;  2VSQ A;  3KPE A;  3H1H D;  4NPE A;  1KB9 E;  1X79 B;  2MVV A;  4ASW A;  3SWF A;  2XT1 A;  2FBW C;  1N7S B;  3KZI H;  5I4T G;  2FKW B;  1S72 P;  1SQB E;  2M0B A;  2J59 M;  2NPS B;  2YNY A;  1NYH A;  5EW5 E;  2KGA A;  1LTJ C;  2YMK A;  2P58 A;  5AVX B;  2KG6 A;  3CD6 P;  3V2N A;  2PEJ A;  4WY4 C;  3TNU A;  3KXD A;  1SQV K;  2JP3 A;  3CX5 D;  1KV4 A;  5F2O A;  1A43 A;  2JWA A;  2Q7C A;  4GR6 A;  2KGC A;  1LNQ A;  1HGV A;  2IBZ I;  5DCK A;  2LKM A;  3A3Y B;  1YTZ I;  3PRJ A;  1DEB A;  3BCC G;  4ZMD A;  2JJL A;  4AUW A;  3BRV B;  3B5I A;  2WVR A;  1GZL A;  5EFW B;  3EQ2 A;  3P8C D;  3CX5 I;  3FXE A;  2A06 E;  4M0I A;  1KQG B;  1BCC E;  3AE3 C;  2W27 A;  2WSC J;  1MV8 A;  1E6J P;  2B89 A;  3V5B A;  1NGM B;  2JU2 A;  2YXR B;  4D6T E;  4GIF A;  1UJZ A;  2AFE A;  1UNK A;  1KTM A;  2BEZ F;  3T97 B;  3RBX A;  1SP4 A;  3KHU A;  1N7S D;  3DPH A;  3S4R A;  3CXH I;  2JGP A;  1DD4 A;  1PPJ E;  3OW2 O;  1SQX K;  1GL2 C;  3O8Z A;  3JC2 2;  3L70 J;  2Y9Z A;  3CC2 P;  2WSC H;  1DH3 A;  2E74 C;  1LP1 A;  2ZFC A;  5CCG D;  5CHX A;  1PEU A;  3I55 P;  3OAK A;  1VQ7 P;  3H25 A;  4MN4 C;  5APS A;  2GUV A;  3CCR P;  1JY3 P;  1WRG A;  2FY8 A;  2GYK A;  2YKP A;  3FWL A;  2FQ1 A;  3VMZ A;  2KI7 B;  5AVW B;  2H8P D;  5AW8 B;  3VMA A;  1BCC G;  2FVA A;  4COC A;  1BSN A;  4M3L A;  1HF9 A;  4WY4 B;  2QE7 H;  1RE4 C;  4H13 D;  2RH0 A;  4KT0 J;  1L0L J;  4WYM A;  1LTA C;  3ITK A;  2R44 A;  1FOS E;  3FWN A;  2ROQ A;  3I5C A;  2JEE A;  2FYU K;  2WZ7 A;  3H1J J;  2KS1 B;  2JYG A;  3PLN A;  1N73 A;  3V4Q A;  1KMI Z;  2ZAE B;  1Q82 Q;  2PP6 A;  3AEC C;  1VQM P;  2PFX A;  4D6T G;  1GL2 D;  3RK2 C;  3N7N A;  1ZP0 C;  3L74 D;  4H2X C;  2CK3 H;  2EFJ A;  4ZKP A;  4HYT B;  4WY4 D;  3DS5 A;  1NKN A;  1RH5 B;  2M3E A;  2OYH C;  3E7K A;  4GDO A;  1AV1 A;  1HTL C;  1RNI A;  1ZR2 A;  4KHX A;  1GK6 A;  3H1K G;  1VF5 D;  3L4F A;  1BAJ A;  3MUD C;  4XFZ A;  2CGQ A;  2YO3 A;  3G3Z A;  1M57 D;  2V7Q H;  2KS1 A;  3CI9 A;  3L75 E;  2NZ2 A;  3VTP C;  3AE1 C;  2OGU A;  1M6E X;  3TNU B;  2W6B A;  1IFJ A;  2AEJ A;  2IFN A;  3AEG C;  3GHG C;  4GOD A;  4WY4 A;  3EJB A;  1HJ0 A;  2AXC A;  4YXD C;  5KTB A;  1HH0 A;  4COP A;  3L75 G;  2FXM A;  1N73 B;  1U7J A;  3LMO A;  3A7O A;  4RES B;  1AJY A;  5APX A;  1VQ5 P;  1SLQ A;  3RBZ A;  2FFD B;  1PGO A;  3RK3 E;  4WVZ A;  5KLV E;  1IMP A;  1OIP A;  1AVY A;  3NFQ A;  1YI2 P;  4CPG A;  2OYH A;  3R2P A;  1SQQ J;  5C39 A;  2KZI A;  4D6T J;  2BCC J;  3G26 A;  1EDL A;  2B9B A;  1SQV D;  1JTH B;  2O1J A;  2EG5 A;  3L73 E;  2J5U A;  1HBW A;  2QRX A;  3CLQ A;  1BGY J;  5TIS E;  1H89 A;  1MFT A;  1YYC A;  4IFD K;  3B5N A;  2K9Y A;  1LP1 B;  2C0X A;  1KN7 A;  1SQQ E;  2K88 A;  2PAJ A;  1BGY E;  2ZT9 B;  2KOQ A;  4HH2 A;  3IF4 A;  2P1J A;  2JBG A;  2ZT9 D;  3HYB A;  2JWD A;  2JQ4 A;  2AEF A;  1NTM E;  4QNB A;  5B66 H;  2KR5 A;  1Y8A A;  4PXH B;  1PL5 A;  3CME P;  3VYI A;  1QGK B;  3GHG B;  3HE5 A;  4LC1 A;  1H88 A;  3TK1 A;  1LTJ B;  5AVT B;  1P84 I;  5AVR B;  4EOT A;  5E79 H;  2QSI A;  1LT1 A;  3CL3 D;  1FDO A;  5CJ0 A;  3IN6 A;  2QJK C;  2M5R A;  2QVA A;  2Q9I A;  1HY8 A;  3GKL C;  1BGY D;  2J58 A;  4U3F J;  2ZXX A;  1S1C X;  2EIA A;  1S4X A;  1GPJ A;  3NTE A;  1RF0 A;  3AEF C;  3G71 P;  4PD4 I;  4XFX A;  1S5L H;  3G28 A;  3G6E P;  2M8P A;  5GTH E;  1S9K D;  2D2C C;  3HTK B;  1JY2 O;  3Q5P A;  1H8A A;  3Q5R A;  3AED C;  1SVF A;  2EHS A;  4XFY A;  3L74 G;  1SQP G;  1G1I A;  1LT9 B;  2I8D A;  4JYB A;  3RK3 D;  3AEA C;  4NPD A;  3P7K A;  4UB8 E;  3MZW B;  1N86 A;  2WSE H;  4C46 A;  2XDJ A;  2JO1 A;  3AE9 C;  1NU1 D;  1KQS O;  3M0A A;  2QM7 A;  1PP9 G;  2JU1 A;  1RF1 B;  1M1K Q;  3L70 D;  5KAF H;  3KQG A;  1K8A Q;  2KB7 P;  2N50 A;  4UB6 H;  4PV1 D;  2QJY C;  4DT0 A;  1RF0 C;  3CCL P;  1Q7Y Q;  2L22 A;  3TDK A;  3CE7 A;  2JAZ A;  1EDI A;  2JDI H;  2RMZ A;  3CMA P;  1SQQ G;  3TYY A;  2LOL A;  2E75 C;  2E43 A;  2KSE A;  2LTE A;  1K30 A;  1KIL E;  3A0H E;  1NU1 J;  3L72 J;  2HR3 A;  3CCQ P;  1T3J A;  2E5Y A;  5GTH H;  4YXW H;  1RY3 A;  3L72 D;  1S5L E;  1N7S C;  1NTZ J;  2Z46 A;  3A0B E;  2HPC A;  1QVF O;  2WSE J;  2XNX A;  5EJD A;  5F2K A;  2GDY A;  2L6E A;  2FHS C;  1CEI A;  2LIU A;  2ZVO B;  2Q1K A;  2XKM A;  1KYO H;  4HJG H;  2KG9 A;  3DS0 A;  1T6A A;  1VQN P;  1LTG C;  4H44 C;  3B71 A;  3DTJ A;  3BCC J;  3L35 A;  1JY3 O;  1QX8 A;  1RO0 A;  3F89 A;  2XV6 A;  3EFF K;  1RF1 C;  3PP5 A;  1KQF B;  5F2N A;  3HE4 A;  2LXC B;  5H2F E;  2JR8 A;  1H0T A;  1SFC D;  3HRN A;  3QH9 A;  4D6T D;  3TGU J;  2X2B A;  1U57 A;  4IZ6 A;  2LR2 A;  4WB4 A;  2POH A;  1USD A;  2A06 D;  3AE4 C;  1A8O A;  2MR7 A;  1NTK K;  2P9X A;  3VMX A;  5AW9 B;  3E1R A;  3MHV A;  4MRT C;  1T2K C;  2QJY B;  5AW0 B;  4TT3 H;  3WU2 H;  3Q2Y A;  3G4S P;  1W2E A;  3CWB J;  1PPJ G;  2YXQ B;  1AYI A;  1JO5 A;  3SWY A;  4I2L C;  2E75 B;  1ACP A;  2ERH A;  5KLI C;  2LKI A;  1EMV A;  1OR5 A;  1EDK A;  1W2B O;  2O01 J;  1AUM A;  3RK3 C;  3L37 A;  4EYY Q;  2XZ1 C;  3M9Q A;  3S1K A;  5L8R J;  1IC2 A;  2KWL A;  5B5E E;  3H1L D;  1M1J B;  1MKM A;  2EHT A;  2PEI A;  3N4X A;  1PP9 D;  4IFF A;  2JYL A;  1GXG A;  3W67 A;  3GG2 A;  2Y9Y A;  3NY7 B;  1MFZ A;  1KB9 I;  2KLU A;  4R4L A;  2AEM A;  2E74 B;  4ZNC A;  1NU1 G; 
#chains in the Genus database with same CATH homology
 3G26 A;  5F2N A;  5DCK A;  3G1G A;  2EG5 A;  4PH0 A;  3CCV P;  1YJN P;  2JYG A;  1KQS O;  2M8L A;  1YJ9 P;  3DS2 A;  1VQO P;  1PEQ A;  1KC8 Q;  1VQK P;  1ZMB A;  1Q82 Q;  3HZQ A;  4U0F A;  1VQM P;  1YIJ P;  4IPY A;  1EOQ A;  1A8O A;  1YJW P;  3B5I A;  2KOD A;  3CCM P;  1M1K Q;  2P9X A;  1Q86 Q;  2EFJ A;  3H0D A;  1PEM A;  3Q20 A;  4U0B A;  2DGY A;  3LRY A;  2QEX P;  1K8A Q;  4M0I A;  3G1I A;  2OTJ P;  1N8R Q;  3DS5 A;  3M1M A;  2JO0 A;  1E6J P;  3HYB A;  3DS3 A;  4U0C A;  2Z44 A;  1VQ6 P;  3CCJ P;  2M8N A;  1RNI A;  1RO2 A;  4U0A A;  4U0E A;  1Q7Y Q;  4QNB A;  3CCL P;  3DS4 A;  3G4S P;  3I56 P;  2CWO A;  4XRQ A;  2BHV A;  3CME P;  1BAJ A;  2LF4 A;  4XFZ A;  5BS1 A;  3CCE P;  2PEK A;  1QRJ A;  1JJ2 O;  2Z45 A;  5HGL A;  2OAR A;  3CPW O;  2XT1 A;  3P05 A;  3DPH A;  1D1D A;  5HGN A;  1QVG O;  5HGO A;  3CMA P;  3G0V A;  2BQ1 E;  5I4T G;  3CCU P;  1IUQ A;  3OW2 O;  1S72 P;  4U0D A;  2OTL P;  3CC2 P;  1KD1 Q;  5HGM A;  1M6E X;  1K30 A;  1EIA A;  3H4E A;  4XRO A;  1VQL P;  3VRL C;  3CC4 P;  1PEU A;  3I55 P;  1VQ7 P;  3E2D A;  2E1M A;  4PH1 A;  3CCQ P;  1W2B O;  1Q81 Q;  3CCR P;  3CCS P;  1AUM A;  2BUO A;  2EIA A;  2XXM A;  2PEO A;  1VQ4 P;  3CXC O;  3NTE A;  5JPA A;  4COP A;  2PEN A;  1M6N A;  3CD6 P;  2Z46 A;  2PEJ A;  2PY8 A;  1QVF O;  4GR2 A;  3G71 P;  1K73 Q;  3G21 A;  2PEQ A;  4XFX A;  1VQP P;  1M74 A;  3G28 A;  5F2K A;  3G6E P;  2L6E A;  2M8P A;  3G29 A;  1YHQ P;  1M90 Q;  2PEM A;  2ONT A;  1VQ5 P;  3H47 A;  1VQ8 P;  2PEI A;  3CC7 P;  3RG6 C;  5BS2 A;  3WBH A;  5F2O A;  1YIT P;  1VQ9 P;  1A43 A;  4COC A;  4XFY A;  3DS0 A;  1VQN P;  2JYL A;  3DS1 A;  1NJI Q;  3DTJ A;  3MGE A;  4GR6 A;  1PEO A;  1YI2 P;  1RO0 A;  1K9M Q;  4WYM A;  2QA4 P;  2XV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...