1VQ8P

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq8P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq8P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq8P02
3CC7P 1VQLP 3CC4P 3CCLP 3CCSP 3CCUP 3CXCO 1VQ7P 1VQKP 1QVGO 1NJIQ 1S72P 3CCQP 1Q86Q 1M1KQ 3I55P 3G4SP 1VQNP 1Q7YQ 3CD6P 1KC8Q 3CCVP 1VQMP 3CCEP 1KD1Q 1YITP 3CPWO 1VQOP 2QEXP 2QA4P 1VQ8P 1YJ9P 1VQ5P 1W2BO 1Q82Q 1N8RQ 3G71P 1JJ2O 1VQ9P 1VQ6P 3CMAP 1YHQP 1KQSO 1VQ4P 3I56P 1K9MQ 1M90Q 3CC2P 2OTLP 1VQPP 3CCMP 1Q81Q 2OTJP 3G6EP 3CCJP 1YJNP 1YI2P 1K73Q 1K8AQ 3CMEP 1QVFO 3CCRP 1YIJP 1YJWP 3OW2O
chains in the Genus database with same CATH superfamily
3AECC 4C7RA 3CWBE 5AW5B 2NO8A 2RN0A 3TGUE 1G1IA 2H8PD 3CCEP 2E75C 3JCUE 2M5AA 2K92A 1QX8A 5GTHH 2W8ZA 2JYGA 1CSBA 4IZ6A 2WSCJ 3HE4A 4XFYA 1E0HA 4KT0J 3PRJA 1J1DC 2K37A 2WSFH 1HJBA 3RL0C 2K9JB 1VL2A 5B66E 3BRVB 4UB6E 2WPTA 4IFMA 2OYHA 4EI2A 5AVXB 2C0XA 2WQYC 3QH9A 3CX5D 2KGCA 3ITKA 1SQVE 2BCCD 2RH0A 1HUCA 2FYNB 1GL2C 1QL2A 2BUOA 2W90A 4H2WC 1BCCE 5APWA 2HG5D 3U59A 3V4WA 5CCHD 1H8AA 1EMVA 3PLNA 3H32A 4IFFA 7CEIA 3FGAD 3NTNA 3GZMA 4IL6X 3AE1C 5APQA 1ZR2A 1KYOI 1ZP0C 3CWBD 1ZN5A 2QNWA 2B87A 1IFJA 1GU4A 1Y47A 2ROQA 4TT3H 3I55P 3DTJA 2P9XA 1JY3O 3PH0A 4D6TJ 2KIKA 1AA0A 1S5LX 2JO0A 1MFTA 1AVOA 3MHVA 2PGDA 1KB9H 4BPFA 1QVGO 1GK4A 2ZAEB 3GJNA 3L73J 3WU2E 4H2XC 1SQVD 3CL3D 2ZYAA 1QEXA 3CX5I 2JU2A 4GDOA 3P8CD 1BCCD 1OVUA 1EDLA 1FJPA 3RK3D 3G3ZA 1NTMG 5M1BA 2VLPA 1MFZA 3L70J 4CA3A 1M56D 2KOOA 1L0LK 2Q6QA 4H13C 4U0AA 4QKOA 2JJLA 3KPEA 3L71J 1SFCD 1FBMA 2PFXA 1X8YA 3SFDC 2YO3A 5KAFE 1M74A 5KAIE 1URQD 3S4RA 4U0DA 1GL2A 3HD7D 2KODA 1NTKG 3U1AA 5TJHA 4ZMDA 1U57A 2R5DA 3N4XA 3WUVA 1VQ5P 4U3FJ 1M7LA 1LGHB 2Z5IA 3DS1A 3G21A 3FXDA 3MGEA 1OR5A 1YIJP 2AVAA 2IPPA 2KGEA 5F2OA 3G1IA 2AFDA 3A7OA 2NPSC 2GDYA 3BRTB 1PP9G 4M3LA 2CGQA 3DS3A 1M1JB 3H4EA 1BDCA 4N78E 1JMMA 3I56P 2XZ1C 2V4HA 4HKZH 3WBHA 3CCMP 1KILC 2IZ1A 5APSA 3F89A 3CMEP 3IAOA 2WSEH 1ACPA 1YYCA 2KSEA 4TLFA 1J2JB 2FXPA 3CCQP 1FZEA 5KLIB 3IN6A 1YQ4C 2K88A 4PH0A 2K93A 1Z6MA 2P1JA 3L70G 4GODA 3A3YB 1A02F 2N50A 2BEQD 2C9LY 3MUDC 4OH8B 2NRGA 3VMYA 2CG5B 2O01N 1NTZG 3HE5B 2A45I 2KXPB 3L71G 1SQBG 2FYUG 4WY4D 1HWTC 4WWIA 3P32A 1VF5D 2H43A 2UWJE 1L0LJ 4CPGA 1Q7YQ 2GZJA 1IFPA 1HY8A 3OJAB 3B5ND 3H1KG 5CJ4A 1EZVE 3G29A 1E6JP 4RKUJ 1LTTC 1GPJA 5L8RJ 1NTMD 2GDWA 2L22A 5EJDA 1BE3G 1NKNA 2KUBA 4R4MA 3MZWB 4N78D 3V2NA 2Y0CA 4WVZA 5KLVE 2FVAA 3B71A 2KSJA 3O8ZA 5AW6B 1R5LA 2Z5HA 1SQBE 2FYUE 4I7ZB 2N98A 3RK2B 3VP8A 1NTKD 1SFCC 4DJGA 3AE5C 2O1KA 2AEFA 1EXIA 3RK3B 2KG8A 3RL0g 3CXHE 2XZRA 1A8OA 3H1LJ 2Q3EA 4BXLA 2Z4EA 1ZXGA 2N9BA 5K5GB 3HZQA 3DS2A 3L74E 2PP6A 1PEQA 1DX7A 1DV5A 2L5GB 1PP9D 1URQB 2E76D 5CCHA 1OVRA 4XRQA 4U0FA 3HD7B 1BSNA 5AW2B 1L0NE 1K8AQ 4U0CA 2WPSA 2Q9IA 3V5BA 2HFED 1OX3A 1Q86Q 1MZ9A 2AXTE 4NEOA 3NMDA 2N5HA 4PWVB 3H1HG 1RQVA 3L72E 2LTEA 3LW5H 2OYIC 2GZEA 2LKMA 4COCA 1SQBD 2FYUD 2FVEA 1OMIA 1SQVK 1PL5A 3CCUP 1FZAA 2XV6A 1FOSE 2LPKA 2YIUC 1ZW0A 4IOIH 3EJDA 2Y9YA 3EWKA 2D2CC 2PEQA 1RH5B 4AQRD 1CEIA 1CI6B 3H1KD 1N73C 2QJPB 2E74B 3S1KA 2JR8A 3VYIA 3L74D 1KFNA 2BCCJ 5AW1B 1LTBC 2HPCB 3H1IG 1M6NA 3VRLC 1KB9E 1BE3D 1AQ5A 2I1KA 3SWFA 4WY4B 2LF4A 4I6MC 3RGUA 3USSA 1VF5B 1KQSO 1PGOA 5F2NA 2WMMA 3HUSC 1SFCA 3AE3C 2HYNA 4GOEA 2WSCH 3C1LA 3B5NB 2VLNA 1SQQJ 4A7PA 2LIWA 1URQA 2M8RA 1VQNP 5AW8B 1KC8Q 1BGYJ 3MD0A 3L72D 2VLOA 3HD7A 1PEUA 5EW5E 1GXHA 2K9YA 2W6JH 3TGUJ 2IDBA 5HV8A 4ZKPA 4OGQD 1P84H 2M5RA 2IYPA 2Y0DA 2KK7A 1NQ4A 1A02J 4U0EA 2KS1B 5KP8B 1FZBA 2HODB 4HJGH 4NPFX 2XXMA 1DEBA 2AEMA 1J1EC 2XU6A 1VQ6P 1LTGC 5KP6B 1HBWA 2J58A 1RO2A 2OYHC 5E79H 3DS5A 3Q1MA 1Y9BA 1SQVJ 1S1CX 2LR2A 1EQ7A 3BCCG 1KB9D 4OVNF 4PJ0E 3TK1A 1HJ0A 1WT6A 2YMYA 1CI6A 2QJKC 1VQMP 2MR7A 4W80A 1FU1A 3G26A 4OWFA 2KYVA 1RY3A 4WYMA 3IFMA 2OTLP 1IMPA 2V7QJ 1K73Q 2E76B 1NU1G 2M3BA 1H0TB 4ZKUA 2HPCA 5EFWB 1PPJG 4WY4A 1IZNB 3NXSA 2QVAA 1JY2P 3M9BA 1SQQG 4UB8H 1FDOA 3G71P 1OZHA 4KJMA 2EIAA 3B5NA 2KR5A 2IBZG 1MV8A 2WT7B 2BASA 1OIPA 1GK6A 1MKMA 2WTYA 2OTKE 2IFNA 3H1ID 2KOQA 1JO5A 4EIJA 4K3AA 3IR9A 2MVUA 2Q7CA 3H47A 3DS0A 1USDA 1ZNVA 2JB0A 3CMAP 1JY3N 1BSHA 4C7NB 3H1JG 2CPBA 1DEEG 2KP8A 3HRNA 2KS1A 1EOQA 4YXDC 2HODA 3CCLP 3Q20A 2E5TA 2FFDB 1NU1E 1NJIQ 3G4SP 1KB9I 3ZDMA 1IFDA 2FYZA 3KDPB 2ZVNB 5H2FE 4UHPB 1T8ZA 2K0XA 3E1IA 2WPVB 2KB7P 2HR3A 1SQXG 2N6ZA 3L75G 4N3YB 4PD4H 3MGNA 4L74A 1YJWP 2XDJA 3Q5RA 2FYNC 2YXRB 1AUMA 2IBZE 1RQUA 3RG2A 2EFJA 4AYCA 1A43A 4HH2A 2KGDA 3TYYA 3SWYA 3Q5SA 1BXIA 2R3SA 1YHQP 3FWLA 1N7SD 3AEEC 3P8CE 4ASWA 1FDIA 2KG6A 3FX0A 5KLVK 3BCCD 3A0HH 1S2EA 1L2PA 4OGQB 1J1DB 3AEAC 3RK3E 2N1TB 4LGDE 2WPRA 4XFJA 1EXJA 2LKIA 4HYTB 1SQPJ 3GZLA 2JU1A 2M8NA 2Q1KA 1SQBK 2FYUK 1FR2A 1JTHB 1KORA 2JP3A 2MF4A 1IUQA 2KORA 1MUUA 2PAJA 2C9NY 2W6BA 2WT7A 2WVRA 3L75E 1UJZA 1NU1D 3I5CA 1LTJB 1RE4C 1JNMA 3T97A 3EFFK 1BDDA 3M9HA 2KNCB 4JQ0D 4JF7A 2GM4A 2K0YA 1JB0J 2IBZD 2FFDA 1S72P 1HTLC 1L0NK 1NWQA 1LWUB 5CHXA 2W83C 1CW5A 2GZFA 1X22A 2PEKA 2E43A 2ZXXA 2OARA 4GR6A 1RF0C 2K9JA 3LIEA 3RK2D 1RNIA 1OW6A 2M8PA 4NPEA 2ZT9D 3VOPA 1HVVA 1PEMA 2I1JA 2LIUA 3MIWA 1KQLA 2QA4P 1W2BO 1D7MA 2OQQA 5GTIH 1E79H 1EDIA 1SQXD 3L75D 1SQPG 4Y99B 4YXWH 4L75A 2JO1A 2ITAA 1Q90D 2LMLA 1OWAA 2QRXA 1KQFB 1FZCB 1JUNA 5KLVJ 2RKLA 3R2PA 3BVHA 2BHVA 2L6EA 2L91A 5HVCA 3TDKA 1JTHA 1HF9A 1VQ8P 5KJ7D 2PEIA 3FWNA 1NYHA 4D6TG 1M90Q 1LTJA 1M1JC 1T2KD 1PIXA 2GZGA 1DH3A 3V4QA 2IBZI 2KNCA 1NTME 4GKGA 2E1MA 1QGKB 3L74J 1AV1A 1RE4A 5KLIC 3L73G 1AJYA 2CQ8A 5CCGD 1QVFO 1VDFA 3GW6A 3L37A 1S9KE 4PV1D 3RBXA 1W5CE 5CCHC 2J59M 5E79E 2LOLA 3CCSP 1LWUA 1L0NJ 3AEDC 3MP7B 1N7SB 1JCCA 2E74D 1NKZB 3M91A 1NTKE 2DGYA 4H44D 2YO2A 2XZ0D 4EYYQ 4D6TE 1Y8AA 1R8EA 3L72J 2J5UA 2BEZF 3AE8C 2ZFCA 1N2DC 1RF0A 2XKMA 1FC2C 1XTGB 1PGJA 5B5EE 4UB8E 1PP9E 1YBKA 1P84D 1JM0A 1GTWA 5AVQB 4U3FG 1FS0E 2FACA 4RO0A 4MN4C 2XNXA 1DD4A 3DS4A 4I7ZC 5APUA 1FDMA 2SPZA 3RK2C 2YKQA 1S9KD 4N6JA 1VQPP 4BPHA 2MJZA 2QJYB 1PGQA 3L70E 2CPSA 1T8KA 3RK3C 3KZIE 1NTZE 3AEFC 3L71E 2VSQA 2P67A 3B8EB 1X9VA 4L76A 2VLQA 4W7ZA 3TNUB 1M1JA 2KZIA 4IFDK 1OXZA 2KLUA 1UIIA 3D70A 1HH0A 2ZT9B 2JKVA 3L35A 2MY5A 3V2PA 4JYCA 5GTHE 2JGPA 4D6TD 2FAEA 1URQC 3H1KE 1YI2P 4O9BA 5APYA 3GLMA 3HD7C 1N7SA 3GHGB 2ZXEB 2FQ1A 5BU5A 1UNKA 1L0LG 1BE3E 1PGPA 1NU1K 3HE5A 4F37A 4JBZA 2ONTA 4RESB 3E1RA 2H89C 3BATA 1P84I 1IFIA 3D6ZA 3JC22 1DNYA 2V7QH 3PP5A 3A0HE 2OGUA 4GR2A 3P8MC 2Y9ZA 1OW7A 3M9QA 5CCGC 3L70D 3II6A 2W27A 3D71A 2GUSA 1NTZD 3KXDA 1GDTA 2CWOA 3L71D 3A5TA 2QJPC 2QIWA 2E74C 3S9OA 3AE2C 1Z56A 4BRYB 4MRTC 1SS1A 2AEJA 2K3RA 1YITP 3LMOA 4PV1B 5KTBA 3M06A 2I8DA 3EQ2A 4PD4D 4WY4C 1Q81Q 1RHZB 4QMAA 4PXHB 1X79B 1VF5C 1M8OB 3H1LG 1S4XA 4KHXA 4H44B 1SVFA 3TNUA 1LTSC 1KTMA 2ERHA 3B5NC 2N5IA 3BASA 1OFCX 2QM8A 2JEEA 1ZOYC 1VKUA 3H1HE 2ZVOB 3GHGA 3GF3A 2WWWA 3V2RA 2M3EA 4H0LD 1L4AB 2W6AA 2BQ1E 1IJDB 3V6IA 4HKGA 5KAIH 3CWBJ 5I4TG 4WBAA 2GA1A 3H25A 5KJ7A 2P2UA 5KKZB 2N1TD 1AYIA 3OW2O 3RL0D 3HYBA 3AE7C 1AQTA 4R0MA 4PH1A 1FJKA 4EOTA 5TISH 3H1IE 1L0LD 5AVTB 1LJ2A 1K9MQ 3CCJP 4PD4I 2WZ7A 5CCGA 3B4QA 4BRYA 1DIPA 2P10A 1T3JA 2HLOA 5BU8B 1PZQA 1KN7A 2E76C 1BCCJ 1LT1A 5BS2A 1LP1B 1VQOP 4GOFA 2BCCG 1RF1B 3H1HD 3PHLA 4JPZB 1YQ3C 3HE4B 4IL6H 1ZRTE 1IO4A 3PJSK 2FBWC 2FY8A 3CI9A 2LXCB 4WB4A 3CCVP 1USEA 1JY3P 1X0TA 4XA4A 2YXQB 1T6AA 3OA7A 1BGYG 2C0WA 2YMKA 1NTMK 3OAKA 3R4YA 1YJNP 5AVSB 3UIAA 3CWBG 3TGUG 5CBNA 2JYLA 3M0AA 1S5LH 2KWLA 3H1LD 1VQKP 1Q2NA 2O01J 2XV5A 3BCCE 2CNRA 1VPCA 3H32B 3RBZA 5BS1A 2FFDC 2PRRA 1LTAC 1NTKK 3H6PA 2L9FA 1KILE 3B4SA 4YTPC 1SQVG 2YKOA 3G9RA 1PPJE 5APTA 4H13D 1RO0A 5AVRB 3VTPC 1ZRTD 1SQQE 2Z44A 1EIAA 2R5BA 1NHLA 1IFNA 1GU5A 2QM7A 1LT9B 2ZJSE 1FOSF 3TF5A 1LP1A 1JCDA 1OVVA 3CXHH 1H89A 1RF1A 2KGAA 3O6QB 1YJ9P 2A45G 4H0LB 4OGQC 4IPYA 2N1TC 4DZOA 1H0TA 2N6YA 2MR8A 5AVWB 2FXOA 2E75B 3SSUA 2E5YA 3JSVC 3CLQA 3H1JE 2WSSH 1BAJA 2NPSD 1LTJC 1NH4A 3H0DA 1M6EX 1NTZK 2K1AA 3P05A 3RL0B 1NTMJ 2L0QA 2Z45A 1R5SA 1SQXE 1KILD 2AXTH 1VQLP 1E5WA 3CXCO 2GUVA 4I1LA 2DNWA 1PPJD 1GL2B 1SQQD 2KOPA 3Q5PA 2WITA 4C7NA 1EDJA 1LWUC 2RMZA 1VQ4P 1BGYD 3WUTA 4ZNCA 4RJTA 4R4LA 1NTKJ 2P7JA 3TGUD 2JDIH 3CC4P 4YPCA 3KQGA 5C39A 3C9IA 1KQGB 1JY2O 3GMAA 4C46A 2O3JA 2Q3IA 3GF7A 4GIFA 4XFZA 3AE6C 5AW4B 1LT9A 4XFXA 3H1JD 1CZQA 2PEJA 1PP9J 1ZLLA 3KHUA 2AF8A 4Y99C 3VP9A 3TSIA 3O6QA 5AW9B 5AVZB 1FZCC 2PEOA 1U7MA 3GG2A 2QEXP 2FKWB 4B86A 4EDFA 4HB1A 1JEKA 1SLQA 2MKVA 5AW7B 3W68A 3NTEA 2GZIA 2N1TA 3WUUA 4QNBA 4JYBA 2R44A 3CD6P 1NTZJ 3M0DC 3K5BA 1SQBJ 2FYUJ 2B88A 1YTZI 1HGZA 2PNGA 3N7NA 2LXBA 3V2QA 2PENA 1IK9A 4H13B 3CC7P 3FXEA 1ZV8A 5BVZA 1P84E 3H1KJ 4L73A 5APXA 2AFEA 5AVYB 4DT0A 2WSFJ 5APVA 1G1JA 3U43A 1N7SC 1KYOH 3G1GA 5TISE 2KI7B 4PJ0H 2DW3A 4BPGA 1BE3J 2AXCA 3CPWO 2E42A 2NZ2A 1SQPE 2OYOA 5CJ0A 3A0BH 3Q3DA 4M0IA 4BWNA 1L0HA 1EZVG 4NPDA 2EHTA 3MTUE 2K5XA 2FQ0A 5AVVB 1JJ2O 3GKLC 1AF8A 1K05A 5HGOA 2NPSB 3G6EP 2B89A 4IL6E 2ZYGA 3AEGC 1NO4A 3G0VA 4U0BA 2XT1A 4DG9A 1NGMB 2KZJA 5DJTB 5KLVG 2QG4A 3CX5H 2R3CA 1KILB 2GYKA 2D2CD 1TU3F 2MVVA 1DD3A 1FZCA 3EJBA 1L4AD 2KOSA 3L73E 1QRJA 1KMIZ 1H88A 3EJEA 3LIDA 2QJYC 1S5LE 4Z1MH 1YTZT 3SFEC 2EG5A 1LNQA 2X2BA 2WPQA 4XE5B 5DJUB 3VMAA 2R32A 1QLED 4K35A 3L74G 1SQPD 2EHSA 4H2YC 3M0DA 2ZT9C 3C8VA 2YKPA 3H1HJ 1X3OA 3JCUH 1U7JA 5H2FH 1GXGA 1IK7A 3HTKB 1PV3A 1WMKA 4U7JA 2JBGA 1L0NG 3GHGC 3DPHA 1G2CB 2K2QA 3CC2P 5B66H 3VMZA 3AEBC 4UB6H 5AW3B 4PD4E 3NFQA 1ZMBA 1NOHA 1F80D 3NY7B 1LTIC 1QL1A 4U3FE 2M0BA 2PY8A 1MZ8A 3L72G 2IX7C 5KJ7C 2NPSA 3L73D 1T2KC 2FADA 1HQBA 1NVOA 3L4FA 1FZGA 5CBOA 3H1IJ 1IC2A 1SFCB 2IFMA 3E7KA 3P7KA 1K30A 1SQQK 1VQ7P 2A06G 1FE6A 1KILA 1K04A 2QE7H 4DOJA 1PFIA 1RE3C 1EZVD 2GDXA 1JMBA 2A45H 5HGMA 1S3JA 1KV4A 2Q5UA 4PV1C 2JQ4A 1M57D 2CK3H 3MUDA 3ABVC 2YNYA 1W2EA 5DCKA 1IMQA 2FHSC 4ASVA 2JWDA 5KLVD 3VN0A 4H44C 3SWKA 2WSEJ 2O01H 1ZR4A 1N86A 3PTZA 2MD9A 1UIXA 1L0LE 1FAVA 4LC1A 4U3FD 1N7LA 3WU2H 3HTKA 4Y28J 1GD2E 2OYIB 1AVYA 4XROA 3CXHD 1L0IA 2A06E 1SQXK 5KP7B 1G2CA 1KZUB 1Q82Q 3W67A 2KW2A 1L4AC 1NAFA 2O1JA 3BCCJ 1NAYA 2G8YA 2YIUB 2IYOA 2D2CB 3IF4A 1GW4A 2G3AA 3B5IA 1N73B 4DCKA 5KKZC 3QWOC 4AUWA 1EZVI 1L0ND 1NU1J 2E75D 5KAFH 3A2AA 2PEMA 3VMXA 1HGVA 2Z46A 5GTIE 1GW3A 3AE9C 2P58A 3L36A 4COPA 3H1LE 3KYQA 3HUSB 4W7YA 2POHA 1VQ9P 1VHNA 1FZFA 5CMZA 1RE3A 2B9BA 1GL2D 1RF1C 1IFMA 2N9YB 1KLPA 2Y0EA 2JWAA 1JOCA 2A06D 1D1DA 2KG9A 3CXHI 3WMM0 2JAZA 3H1JJ 1EDKA 3EFGA 1WRGA 5HGLA 2M5AB 2H7HA 2OTJP 2IZ0A 4LLHA 1KYOE 1GZLA 2VRSA 2OYIA 3RG6C 1J1EB 2KLVA 1AFOA 1ZMEC 3LRYA 2FXMA 2FVFA 5AW0B 1SQXJ 3L75J 3A0BE 1KD1Q 2OYHB 2M8LA 2H88C 2K0DX 5AVUB 3D6YA 1EC5A 2LL8A 3CCRP 3CE7A 2KOGA 5F2KA 2QJKB 4I2LC 1N73A 1L4AA 5B5EH 1M1KQ 1T3UA 1SP4A 3LW5J 1XTCC 1PEOA 3M1MA 1SQPK 3E2DA 1N8RQ 3Q2YA 3CX5E 4GT1A 2L4BA 3AE4C 2BCCE 5JPAA 5CZDB 2FQ2A 1KFMA 5HGNA 3HUSA 3G28A 2B87B 2XNDH 2QSIA 1OW8A 3F5HA 1GMJA 3T97B 2K94A 1LT9C 1JY2N 3U1CA 3KZIH 1BCCG 1KYOD 4H0LC 1BGYE 2ZYDA
chains in the Genus database with same CATH topology
3NTEA 1QVGO 3CCQP 5DCKA 1BAJA 4QNBA 1VQNP 3CD6P 1KC8Q 3CCVP 1PEQA 2EG5A 3H0DA 3CCEP 4PH0A 1D1DA 1M6EX 2E1MA 1PEUA 3P05A 3H47A 4XRQA 2JYGA 3DS0A 4U0FA 5HGLA 3CMAP 4XFYA 2Z45A 2OTJP 1QVFO 1YJNP 1YI2P 1K8AQ 4U0CA 2PENA 1EOQA 2JYLA 3CC7P 1VQLP 4U0EA 3CCLP 3Q20A 3RG6C 3CCSP 3CXCO 1VQKP 1NJIQ 3LRYA 1S72P 1Q86Q 3G4SP 1Q7YQ 4XROA 2BQ1E 4U0AA 2XXMA 1KD1Q 2PEKA 2M8LA 5BS1A 1VQ6P 1Q82Q 2OARA 2DGYA 3DPHA 4GR6A 5I4TG 3G29A 1E6JP 1VQ4P 3CC2P 2BUOA 3G1GA 1RO2A 4COCA 2ONTA 3DS5A 1RNIA 1M74A 3CCRP 1YJWP 5F2KA 1ZMBA 3CPWO 3OW2O 4U0DA 2M8PA 3HYBA 1AUMA 3CC4P 3CCUP 2XV6A 3B5IA 1M1KQ 4M0IA 2KODA 2EFJA 2PY8A 1A43A 4PH1A 1VQMP 1PEMA 2PEQA 1PEOA 4GR2A 2QA4P 3M1MA 1RO0A 1VQ5P 3E2DA 3G26A 1W2BO 1N8RQ 1JJ2O 4XFZA 1YHQP 4WYMA 2PEMA 1K9MQ 2Z44A 3DS1A 5HGOA 2OTLP 1EIAA 3G21A 5JPAA 3MGEA 3G6EP 2Z46A 2CWOA 3CCJP 1K73Q 4XFXA 1YIJP 5F2OA 3G1IA 2PEJA 1K30A 3G0VA 5HGNA 1VQ7P 4U0BA 3G28A 2XT1A 2BHVA 2L6EA 3DTJA 3I55P 1M6NA 2P9XA 2PEOA 3VRLC 4COPA 1QRJA 5BS2A 1YITP 1VQOP 2LF4A 3DS3A 3DS4A 2QEXP 1VQ8P 1YJ9P 2M8NA 1VQ9P 3H4EA 3G71P 2PEIA 5HGMA 1KQSO 4IPYA 1A8OA 2EIAA 5F2NA 1IUQA 3I56P 1M90Q 2JO0A 1VQPP 3WBHA 3CCMP 1Q81Q 3CMEP 3HZQA 3DS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 P;  1VQL P;  3CC4 P;  3CCL P;  3CCS P;  3CCU P;  3CXC O;  1VQ7 P;  1VQK P;  1QVG O;  1NJI Q;  1S72 P;  3CCQ P;  1Q86 Q;  1M1K Q;  3I55 P;  3G4S P;  1VQN P;  1Q7Y Q;  3CD6 P;  1KC8 Q;  3CCV P;  1VQM P;  3CCE P;  1KD1 Q;  1YIT P;  3CPW O;  1VQO P;  2QEX P;  2QA4 P;  1VQ8 P;  1YJ9 P;  1VQ5 P;  1W2B O;  1Q82 Q;  1N8R Q;  3G71 P;  1JJ2 O;  1VQ9 P;  1VQ6 P;  3CMA P;  1YHQ P;  1KQS O;  1VQ4 P;  3I56 P;  1K9M Q;  1M90 Q;  3CC2 P;  2OTL P;  1VQP P;  3CCM P;  1Q81 Q;  2OTJ P;  3G6E P;  3CCJ P;  1YJN P;  1YI2 P;  1K73 Q;  1K8A Q;  3CME P;  1QVF O;  3CCR P;  1YIJ P;  1YJW P;  3OW2 O; 
#chains in the Genus database with same CATH topology
 3AEC C;  4C7R A;  3CWB E;  5AW5 B;  2NO8 A;  2RN0 A;  3TGU E;  1G1I A;  2H8P D;  3CCE P;  2E75 C;  3JCU E;  2M5A A;  2K92 A;  1QX8 A;  5GTH H;  2W8Z A;  2JYG A;  1CSB A;  4IZ6 A;  2WSC J;  3HE4 A;  4XFY A;  1E0H A;  4KT0 J;  3PRJ A;  1J1D C;  2K37 A;  2WSF H;  1HJB A;  3RL0 C;  2K9J B;  1VL2 A;  5B66 E;  3BRV B;  4UB6 E;  2WPT A;  4IFM A;  2OYH A;  4EI2 A;  5AVX B;  2C0X A;  2WQY C;  3QH9 A;  3CX5 D;  2KGC A;  3ITK A;  1SQV E;  2BCC D;  2RH0 A;  1HUC A;  2FYN B;  1GL2 C;  1QL2 A;  2BUO A;  2W90 A;  4H2W C;  1BCC E;  5APW A;  2HG5 D;  3U59 A;  3V4W A;  5CCH D;  1H8A A;  1EMV A;  3PLN A;  3H32 A;  4IFF A;  7CEI A;  3FGA D;  3NTN A;  3GZM A;  4IL6 X;  3AE1 C;  5APQ A;  1ZR2 A;  1KYO I;  1ZP0 C;  3CWB D;  1ZN5 A;  2QNW A;  2B87 A;  1IFJ A;  1GU4 A;  1Y47 A;  2ROQ A;  4TT3 H;  3I55 P;  3DTJ A;  2P9X A;  1JY3 O;  3PH0 A;  4D6T J;  2KIK A;  1AA0 A;  1S5L X;  2JO0 A;  1MFT A;  1AVO A;  3MHV A;  2PGD A;  1KB9 H;  4BPF A;  1QVG O;  1GK4 A;  2ZAE B;  3GJN A;  3L73 J;  3WU2 E;  4H2X C;  1SQV D;  3CL3 D;  2ZYA A;  1QEX A;  3CX5 I;  2JU2 A;  4GDO A;  3P8C D;  1BCC D;  1OVU A;  1EDL A;  1FJP A;  3RK3 D;  3G3Z A;  1NTM G;  5M1B A;  2VLP A;  1MFZ A;  3L70 J;  4CA3 A;  1M56 D;  2KOO A;  1L0L K;  2Q6Q A;  4H13 C;  4U0A A;  4QKO A;  2JJL A;  3KPE A;  3L71 J;  1SFC D;  1FBM A;  2PFX A;  1X8Y A;  3SFD C;  2YO3 A;  5KAF E;  1M74 A;  5KAI E;  1URQ D;  3S4R A;  4U0D A;  1GL2 A;  3HD7 D;  2KOD A;  1NTK G;  3U1A A;  5TJH A;  4ZMD A;  1U57 A;  2R5D A;  3N4X A;  3WUV A;  1VQ5 P;  4U3F J;  1M7L A;  1LGH B;  2Z5I A;  3DS1 A;  3G21 A;  3FXD A;  3MGE A;  1OR5 A;  1YIJ P;  2AVA A;  2IPP A;  2KGE A;  5F2O A;  3G1I A;  2AFD A;  3A7O A;  2NPS C;  2GDY A;  3BRT B;  1PP9 G;  4M3L A;  2CGQ A;  3DS3 A;  1M1J B;  3H4E A;  1BDC A;  4N78 E;  1JMM A;  3I56 P;  2XZ1 C;  2V4H A;  4HKZ H;  3WBH A;  3CCM P;  1KIL C;  2IZ1 A;  5APS A;  3F89 A;  3CME P;  3IAO A;  2WSE H;  1ACP A;  1YYC A;  2KSE A;  4TLF A;  1J2J B;  2FXP A;  3CCQ P;  1FZE A;  5KLI B;  3IN6 A;  1YQ4 C;  2K88 A;  4PH0 A;  2K93 A;  1Z6M A;  2P1J A;  3L70 G;  4GOD A;  3A3Y B;  1A02 F;  2N50 A;  2BEQ D;  2C9L Y;  3MUD C;  4OH8 B;  2NRG A;  3VMY A;  2CG5 B;  2O01 N;  1NTZ G;  3HE5 B;  2A45 I;  2KXP B;  3L71 G;  1SQB G;  2FYU G;  4WY4 D;  1HWT C;  4WWI A;  3P32 A;  1VF5 D;  2H43 A;  2UWJ E;  1L0L J;  4CPG A;  1Q7Y Q;  2GZJ A;  1IFP A;  1HY8 A;  3OJA B;  3B5N D;  3H1K G;  5CJ4 A;  1EZV E;  3G29 A;  1E6J P;  4RKU J;  1LTT C;  1GPJ A;  5L8R J;  1NTM D;  2GDW A;  2L22 A;  5EJD A;  1BE3 G;  1NKN A;  2KUB A;  4R4M A;  3MZW B;  4N78 D;  3V2N A;  2Y0C A;  4WVZ A;  5KLV E;  2FVA A;  3B71 A;  2KSJ A;  3O8Z A;  5AW6 B;  1R5L A;  2Z5H A;  1SQB E;  2FYU E;  4I7Z B;  2N98 A;  3RK2 B;  3VP8 A;  1NTK D;  1SFC C;  4DJG A;  3AE5 C;  2O1K A;  2AEF A;  1EXI A;  3RK3 B;  2KG8 A;  3RL0 g;  3CXH E;  2XZR A;  1A8O A;  3H1L J;  2Q3E A;  4BXL A;  2Z4E A;  1ZXG A;  2N9B A;  5K5G B;  3HZQ A;  3DS2 A;  3L74 E;  2PP6 A;  1PEQ A;  1DX7 A;  1DV5 A;  2L5G B;  1PP9 D;  1URQ B;  2E76 D;  5CCH A;  1OVR A;  4XRQ A;  4U0F A;  3HD7 B;  1BSN A;  5AW2 B;  1L0N E;  1K8A Q;  4U0C A;  2WPS A;  2Q9I A;  3V5B A;  2HFE D;  1OX3 A;  1Q86 Q;  1MZ9 A;  2AXT E;  4NEO A;  3NMD A;  2N5H A;  4PWV B;  3H1H G;  1RQV A;  3L72 E;  2LTE A;  3LW5 H;  2OYI C;  2GZE A;  2LKM A;  4COC A;  1SQB D;  2FYU D;  2FVE A;  1OMI A;  1SQV K;  1PL5 A;  3CCU P;  1FZA A;  2XV6 A;  1FOS E;  2LPK A;  2YIU C;  1ZW0 A;  4IOI H;  3EJD A;  2Y9Y A;  3EWK A;  2D2C C;  2PEQ A;  1RH5 B;  4AQR D;  1CEI A;  1CI6 B;  3H1K D;  1N73 C;  2QJP B;  2E74 B;  3S1K A;  2JR8 A;  3VYI A;  3L74 D;  1KFN A;  2BCC J;  5AW1 B;  1LTB C;  2HPC B;  3H1I G;  1M6N A;  3VRL C;  1KB9 E;  1BE3 D;  1AQ5 A;  2I1K A;  3SWF A;  4WY4 B;  2LF4 A;  4I6M C;  3RGU A;  3USS A;  1VF5 B;  1KQS O;  1PGO A;  5F2N A;  2WMM A;  3HUS C;  1SFC A;  3AE3 C;  2HYN A;  4GOE A;  2WSC H;  3C1L A;  3B5N B;  2VLN A;  1SQQ J;  4A7P A;  2LIW A;  1URQ A;  2M8R A;  1VQN P;  5AW8 B;  1KC8 Q;  1BGY J;  3MD0 A;  3L72 D;  2VLO A;  3HD7 A;  1PEU A;  5EW5 E;  1GXH A;  2K9Y A;  2W6J H;  3TGU J;  2IDB A;  5HV8 A;  4ZKP A;  4OGQ D;  1P84 H;  2M5R A;  2IYP A;  2Y0D A;  2KK7 A;  1NQ4 A;  1A02 J;  4U0E A;  2KS1 B;  5KP8 B;  1FZB A;  2HOD B;  4HJG H;  4NPF X;  2XXM A;  1DEB A;  2AEM A;  1J1E C;  2XU6 A;  1VQ6 P;  1LTG C;  5KP6 B;  1HBW A;  2J58 A;  1RO2 A;  2OYH C;  5E79 H;  3DS5 A;  3Q1M A;  1Y9B A;  1SQV J;  1S1C X;  2LR2 A;  1EQ7 A;  3BCC G;  1KB9 D;  4OVN F;  4PJ0 E;  3TK1 A;  1HJ0 A;  1WT6 A;  2YMY A;  1CI6 A;  2QJK C;  1VQM P;  2MR7 A;  4W80 A;  1FU1 A;  3G26 A;  4OWF A;  2KYV A;  1RY3 A;  4WYM A;  3IFM A;  2OTL P;  1IMP A;  2V7Q J;  1K73 Q;  2E76 B;  1NU1 G;  2M3B A;  1H0T B;  4ZKU A;  2HPC A;  5EFW B;  1PPJ G;  4WY4 A;  1IZN B;  3NXS A;  2QVA A;  1JY2 P;  3M9B A;  1SQQ G;  4UB8 H;  1FDO A;  3G71 P;  1OZH A;  4KJM A;  2EIA A;  3B5N A;  2KR5 A;  2IBZ G;  1MV8 A;  2WT7 B;  2BAS A;  1OIP A;  1GK6 A;  1MKM A;  2WTY A;  2OTK E;  2IFN A;  3H1I D;  2KOQ A;  1JO5 A;  4EIJ A;  4K3A A;  3IR9 A;  2MVU A;  2Q7C A;  3H47 A;  3DS0 A;  1USD A;  1ZNV A;  2JB0 A;  3CMA P;  1JY3 N;  1BSH A;  4C7N B;  3H1J G;  2CPB A;  1DEE G;  2KP8 A;  3HRN A;  2KS1 A;  1EOQ A;  4YXD C;  2HOD A;  3CCL P;  3Q20 A;  2E5T A;  2FFD B;  1NU1 E;  1NJI Q;  3G4S P;  1KB9 I;  3ZDM A;  1IFD A;  2FYZ A;  3KDP B;  2ZVN B;  5H2F E;  4UHP B;  1T8Z A;  2K0X A;  3E1I A;  2WPV B;  2KB7 P;  2HR3 A;  1SQX G;  2N6Z A;  3L75 G;  4N3Y B;  4PD4 H;  3MGN A;  4L74 A;  1YJW P;  2XDJ A;  3Q5R A;  2FYN C;  2YXR B;  1AUM A;  2IBZ E;  1RQU A;  3RG2 A;  2EFJ A;  4AYC A;  1A43 A;  4HH2 A;  2KGD A;  3TYY A;  3SWY A;  3Q5S A;  1BXI A;  2R3S A;  1YHQ P;  3FWL A;  1N7S D;  3AEE C;  3P8C E;  4ASW A;  1FDI A;  2KG6 A;  3FX0 A;  5KLV K;  3BCC D;  3A0H H;  1S2E A;  1L2P A;  4OGQ B;  1J1D B;  3AEA C;  3RK3 E;  2N1T B;  4LGD E;  2WPR A;  4XFJ A;  1EXJ A;  2LKI A;  4HYT B;  1SQP J;  3GZL A;  2JU1 A;  2M8N A;  2Q1K A;  1SQB K;  2FYU K;  1FR2 A;  1JTH B;  1KOR A;  2JP3 A;  2MF4 A;  1IUQ A;  2KOR A;  1MUU A;  2PAJ A;  2C9N Y;  2W6B A;  2WT7 A;  2WVR A;  3L75 E;  1UJZ A;  1NU1 D;  3I5C A;  1LTJ B;  1RE4 C;  1JNM A;  3T97 A;  3EFF K;  1BDD A;  3M9H A;  2KNC B;  4JQ0 D;  4JF7 A;  2GM4 A;  2K0Y A;  1JB0 J;  2IBZ D;  2FFD A;  1S72 P;  1HTL C;  1L0N K;  1NWQ A;  1LWU B;  5CHX A;  2W83 C;  1CW5 A;  2GZF A;  1X22 A;  2PEK A;  2E43 A;  2ZXX A;  2OAR A;  4GR6 A;  1RF0 C;  2K9J A;  3LIE A;  3RK2 D;  1RNI A;  1OW6 A;  2M8P A;  4NPE A;  2ZT9 D;  3VOP A;  1HVV A;  1PEM A;  2I1J A;  2LIU A;  3MIW A;  1KQL A;  2QA4 P;  1W2B O;  1D7M A;  2OQQ A;  5GTI H;  1E79 H;  1EDI A;  1SQX D;  3L75 D;  1SQP G;  4Y99 B;  4YXW H;  4L75 A;  2JO1 A;  2ITA A;  1Q90 D;  2LML A;  1OWA A;  2QRX A;  1KQF B;  1FZC B;  1JUN A;  5KLV J;  2RKL A;  3R2P A;  3BVH A;  2BHV A;  2L6E A;  2L91 A;  5HVC A;  3TDK A;  1JTH A;  1HF9 A;  1VQ8 P;  5KJ7 D;  2PEI A;  3FWN A;  1NYH A;  4D6T G;  1M90 Q;  1LTJ A;  1M1J C;  1T2K D;  1PIX A;  2GZG A;  1DH3 A;  3V4Q A;  2IBZ I;  2KNC A;  1NTM E;  4GKG A;  2E1M A;  1QGK B;  3L74 J;  1AV1 A;  1RE4 A;  5KLI C;  3L73 G;  1AJY A;  2CQ8 A;  5CCG D;  1QVF O;  1VDF A;  3GW6 A;  3L37 A;  1S9K E;  4PV1 D;  3RBX A;  1W5C E;  5CCH C;  2J59 M;  5E79 E;  2LOL A;  3CCS P;  1LWU A;  1L0N J;  3AED C;  3MP7 B;  1N7S B;  1JCC A;  2E74 D;  1NKZ B;  3M91 A;  1NTK E;  2DGY A;  4H44 D;  2YO2 A;  2XZ0 D;  4EYY Q;  4D6T E;  1Y8A A;  1R8E A;  3L72 J;  2J5U A;  2BEZ F;  3AE8 C;  2ZFC A;  1N2D C;  1RF0 A;  2XKM A;  1FC2 C;  1XTG B;  1PGJ A;  5B5E E;  4UB8 E;  1PP9 E;  1YBK A;  1P84 D;  1JM0 A;  1GTW A;  5AVQ B;  4U3F G;  1FS0 E;  2FAC A;  4RO0 A;  4MN4 C;  2XNX A;  1DD4 A;  3DS4 A;  4I7Z C;  5APU A;  1FDM A;  2SPZ A;  3RK2 C;  2YKQ A;  1S9K D;  4N6J A;  1VQP P;  4BPH A;  2MJZ A;  2QJY B;  1PGQ A;  3L70 E;  2CPS A;  1T8K A;  3RK3 C;  3KZI E;  1NTZ E;  3AEF C;  3L71 E;  2VSQ A;  2P67 A;  3B8E B;  1X9V A;  4L76 A;  2VLQ A;  4W7Z A;  3TNU B;  1M1J A;  2KZI A;  4IFD K;  1OXZ A;  2KLU A;  1UII A;  3D70 A;  1HH0 A;  2ZT9 B;  2JKV A;  3L35 A;  2MY5 A;  3V2P A;  4JYC A;  5GTH E;  2JGP A;  4D6T D;  2FAE A;  1URQ C;  3H1K E;  1YI2 P;  4O9B A;  5APY A;  3GLM A;  3HD7 C;  1N7S A;  3GHG B;  2ZXE B;  2FQ1 A;  5BU5 A;  1UNK A;  1L0L G;  1BE3 E;  1PGP A;  1NU1 K;  3HE5 A;  4F37 A;  4JBZ A;  2ONT A;  4RES B;  3E1R A;  2H89 C;  3BAT A;  1P84 I;  1IFI A;  3D6Z A;  3JC2 2;  1DNY A;  2V7Q H;  3PP5 A;  3A0H E;  2OGU A;  4GR2 A;  3P8M C;  2Y9Z A;  1OW7 A;  3M9Q A;  5CCG C;  3L70 D;  3II6 A;  2W27 A;  3D71 A;  2GUS A;  1NTZ D;  3KXD A;  1GDT A;  2CWO A;  3L71 D;  3A5T A;  2QJP C;  2QIW A;  2E74 C;  3S9O A;  3AE2 C;  1Z56 A;  4BRY B;  4MRT C;  1SS1 A;  2AEJ A;  2K3R A;  1YIT P;  3LMO A;  4PV1 B;  5KTB A;  3M06 A;  2I8D A;  3EQ2 A;  4PD4 D;  4WY4 C;  1Q81 Q;  1RHZ B;  4QMA A;  4PXH B;  1X79 B;  1VF5 C;  1M8O B;  3H1L G;  1S4X A;  4KHX A;  4H44 B;  1SVF A;  3TNU A;  1LTS C;  1KTM A;  2ERH A;  3B5N C;  2N5I A;  3BAS A;  1OFC X;  2QM8 A;  2JEE A;  1ZOY C;  1VKU A;  3H1H E;  2ZVO B;  3GHG A;  3GF3 A;  2WWW A;  3V2R A;  2M3E A;  4H0L D;  1L4A B;  2W6A A;  2BQ1 E;  1IJD B;  3V6I A;  4HKG A;  5KAI H;  3CWB J;  5I4T G;  4WBA A;  2GA1 A;  3H25 A;  5KJ7 A;  2P2U A;  5KKZ B;  2N1T D;  1AYI A;  3OW2 O;  3RL0 D;  3HYB A;  3AE7 C;  1AQT A;  4R0M A;  4PH1 A;  1FJK A;  4EOT A;  5TIS H;  3H1I E;  1L0L D;  5AVT B;  1LJ2 A;  1K9M Q;  3CCJ P;  4PD4 I;  2WZ7 A;  5CCG A;  3B4Q A;  4BRY A;  1DIP A;  2P10 A;  1T3J A;  2HLO A;  5BU8 B;  1PZQ A;  1KN7 A;  2E76 C;  1BCC J;  1LT1 A;  5BS2 A;  1LP1 B;  1VQO P;  4GOF A;  2BCC G;  1RF1 B;  3H1H D;  3PHL A;  4JPZ B;  1YQ3 C;  3HE4 B;  4IL6 H;  1ZRT E;  1IO4 A;  3PJS K;  2FBW C;  2FY8 A;  3CI9 A;  2LXC B;  4WB4 A;  3CCV P;  1USE A;  1JY3 P;  1X0T A;  4XA4 A;  2YXQ B;  1T6A A;  3OA7 A;  1BGY G;  2C0W A;  2YMK A;  1NTM K;  3OAK A;  3R4Y A;  1YJN P;  5AVS B;  3UIA A;  3CWB G;  3TGU G;  5CBN A;  2JYL A;  3M0A A;  1S5L H;  2KWL A;  3H1L D;  1VQK P;  1Q2N A;  2O01 J;  2XV5 A;  3BCC E;  2CNR A;  1VPC A;  3H32 B;  3RBZ A;  5BS1 A;  2FFD C;  2PRR A;  1LTA C;  1NTK K;  3H6P A;  2L9F A;  1KIL E;  3B4S A;  4YTP C;  1SQV G;  2YKO A;  3G9R A;  1PPJ E;  5APT A;  4H13 D;  1RO0 A;  5AVR B;  3VTP C;  1ZRT D;  1SQQ E;  2Z44 A;  1EIA A;  2R5B A;  1NHL A;  1IFN A;  1GU5 A;  2QM7 A;  1LT9 B;  2ZJS E;  1FOS F;  3TF5 A;  1LP1 A;  1JCD A;  1OVV A;  3CXH H;  1H89 A;  1RF1 A;  2KGA A;  3O6Q B;  1YJ9 P;  2A45 G;  4H0L B;  4OGQ C;  4IPY A;  2N1T C;  4DZO A;  1H0T A;  2N6Y A;  2MR8 A;  5AVW B;  2FXO A;  2E75 B;  3SSU A;  2E5Y A;  3JSV C;  3CLQ A;  3H1J E;  2WSS H;  1BAJ A;  2NPS D;  1LTJ C;  1NH4 A;  3H0D A;  1M6E X;  1NTZ K;  2K1A A;  3P05 A;  3RL0 B;  1NTM J;  2L0Q A;  2Z45 A;  1R5S A;  1SQX E;  1KIL D;  2AXT H;  1VQL P;  1E5W A;  3CXC O;  2GUV A;  4I1L A;  2DNW A;  1PPJ D;  1GL2 B;  1SQQ D;  2KOP A;  3Q5P A;  2WIT A;  4C7N A;  1EDJ A;  1LWU C;  2RMZ A;  1VQ4 P;  1BGY D;  3WUT A;  4ZNC A;  4RJT A;  4R4L A;  1NTK J;  2P7J A;  3TGU D;  2JDI H;  3CC4 P;  4YPC A;  3KQG A;  5C39 A;  3C9I A;  1KQG B;  1JY2 O;  3GMA A;  4C46 A;  2O3J A;  2Q3I A;  3GF7 A;  4GIF A;  4XFZ A;  3AE6 C;  5AW4 B;  1LT9 A;  4XFX A;  3H1J D;  1CZQ A;  2PEJ A;  1PP9 J;  1ZLL A;  3KHU A;  2AF8 A;  4Y99 C;  3VP9 A;  3TSI A;  3O6Q A;  5AW9 B;  5AVZ B;  1FZC C;  2PEO A;  1U7M A;  3GG2 A;  2QEX P;  2FKW B;  4B86 A;  4EDF A;  4HB1 A;  1JEK A;  1SLQ A;  2MKV A;  5AW7 B;  3W68 A;  3NTE A;  2GZI A;  2N1T A;  3WUU A;  4QNB A;  4JYB A;  2R44 A;  3CD6 P;  1NTZ J;  3M0D C;  3K5B A;  1SQB J;  2FYU J;  2B88 A;  1YTZ I;  1HGZ A;  2PNG A;  3N7N A;  2LXB A;  3V2Q A;  2PEN A;  1IK9 A;  4H13 B;  3CC7 P;  3FXE A;  1ZV8 A;  5BVZ A;  1P84 E;  3H1K J;  4L73 A;  5APX A;  2AFE A;  5AVY B;  4DT0 A;  2WSF J;  5APV A;  1G1J A;  3U43 A;  1N7S C;  1KYO H;  3G1G A;  5TIS E;  2KI7 B;  4PJ0 H;  2DW3 A;  4BPG A;  1BE3 J;  2AXC A;  3CPW O;  2E42 A;  2NZ2 A;  1SQP E;  2OYO A;  5CJ0 A;  3A0B H;  3Q3D A;  4M0I A;  4BWN A;  1L0H A;  1EZV G;  4NPD A;  2EHT A;  3MTU E;  2K5X A;  2FQ0 A;  5AVV B;  1JJ2 O;  3GKL C;  1AF8 A;  1K05 A;  5HGO A;  2NPS B;  3G6E P;  2B89 A;  4IL6 E;  2ZYG A;  3AEG C;  1NO4 A;  3G0V A;  4U0B A;  2XT1 A;  4DG9 A;  1NGM B;  2KZJ A;  5DJT B;  5KLV G;  2QG4 A;  3CX5 H;  2R3C A;  1KIL B;  2GYK A;  2D2C D;  1TU3 F;  2MVV A;  1DD3 A;  1FZC A;  3EJB A;  1L4A D;  2KOS A;  3L73 E;  1QRJ A;  1KMI Z;  1H88 A;  3EJE A;  3LID A;  2QJY C;  1S5L E;  4Z1M H;  1YTZ T;  3SFE C;  2EG5 A;  1LNQ A;  2X2B A;  2WPQ A;  4XE5 B;  5DJU B;  3VMA A;  2R32 A;  1QLE D;  4K35 A;  3L74 G;  1SQP D;  2EHS A;  4H2Y C;  3M0D A;  2ZT9 C;  3C8V A;  2YKP A;  3H1H J;  1X3O A;  3JCU H;  1U7J A;  5H2F H;  1GXG A;  1IK7 A;  3HTK B;  1PV3 A;  1WMK A;  4U7J A;  2JBG A;  1L0N G;  3GHG C;  3DPH A;  1G2C B;  2K2Q A;  3CC2 P;  5B66 H;  3VMZ A;  3AEB C;  4UB6 H;  5AW3 B;  4PD4 E;  3NFQ A;  1ZMB A;  1NOH A;  1F80 D;  3NY7 B;  1LTI C;  1QL1 A;  4U3F E;  2M0B A;  2PY8 A;  1MZ8 A;  3L72 G;  2IX7 C;  5KJ7 C;  2NPS A;  3L73 D;  1T2K C;  2FAD A;  1HQB A;  1NVO A;  3L4F A;  1FZG A;  5CBO A;  3H1I J;  1IC2 A;  1SFC B;  2IFM A;  3E7K A;  3P7K A;  1K30 A;  1SQQ K;  1VQ7 P;  2A06 G;  1FE6 A;  1KIL A;  1K04 A;  2QE7 H;  4DOJ A;  1PFI A;  1RE3 C;  1EZV D;  2GDX A;  1JMB A;  2A45 H;  5HGM A;  1S3J A;  1KV4 A;  2Q5U A;  4PV1 C;  2JQ4 A;  1M57 D;  2CK3 H;  3MUD A;  3ABV C;  2YNY A;  1W2E A;  5DCK A;  1IMQ A;  2FHS C;  4ASV A;  2JWD A;  5KLV D;  3VN0 A;  4H44 C;  3SWK A;  2WSE J;  2O01 H;  1ZR4 A;  1N86 A;  3PTZ A;  2MD9 A;  1UIX A;  1L0L E;  1FAV A;  4LC1 A;  4U3F D;  1N7L A;  3WU2 H;  3HTK A;  4Y28 J;  1GD2 E;  2OYI B;  1AVY A;  4XRO A;  3CXH D;  1L0I A;  2A06 E;  1SQX K;  5KP7 B;  1G2C A;  1KZU B;  1Q82 Q;  3W67 A;  2KW2 A;  1L4A C;  1NAF A;  2O1J A;  3BCC J;  1NAY A;  2G8Y A;  2YIU B;  2IYO A;  2D2C B;  3IF4 A;  1GW4 A;  2G3A A;  3B5I A;  1N73 B;  4DCK A;  5KKZ C;  3QWO C;  4AUW A;  1EZV I;  1L0N D;  1NU1 J;  2E75 D;  5KAF H;  3A2A A;  2PEM A;  3VMX A;  1HGV A;  2Z46 A;  5GTI E;  1GW3 A;  3AE9 C;  2P58 A;  3L36 A;  4COP A;  3H1L E;  3KYQ A;  3HUS B;  4W7Y A;  2POH A;  1VQ9 P;  1VHN A;  1FZF A;  5CMZ A;  1RE3 A;  2B9B A;  1GL2 D;  1RF1 C;  1IFM A;  2N9Y B;  1KLP A;  2Y0E A;  2JWA A;  1JOC A;  2A06 D;  1D1D A;  2KG9 A;  3CXH I;  3WMM 0;  2JAZ A;  3H1J J;  1EDK A;  3EFG A;  1WRG A;  5HGL A;  2M5A B;  2H7H A;  2OTJ P;  2IZ0 A;  4LLH A;  1KYO E;  1GZL A;  2VRS A;  2OYI A;  3RG6 C;  1J1E B;  2KLV A;  1AFO A;  1ZME C;  3LRY A;  2FXM A;  2FVF A;  5AW0 B;  1SQX J;  3L75 J;  3A0B E;  1KD1 Q;  2OYH B;  2M8L A;  2H88 C;  2K0D X;  5AVU B;  3D6Y A;  1EC5 A;  2LL8 A;  3CCR P;  3CE7 A;  2KOG A;  5F2K A;  2QJK B;  4I2L C;  1N73 A;  1L4A A;  5B5E H;  1M1K Q;  1T3U A;  1SP4 A;  3LW5 J;  1XTC C;  1PEO A;  3M1M A;  1SQP K;  3E2D A;  1N8R Q;  3Q2Y A;  3CX5 E;  4GT1 A;  2L4B A;  3AE4 C;  2BCC E;  5JPA A;  5CZD B;  2FQ2 A;  1KFM A;  5HGN A;  3HUS A;  3G28 A;  2B87 B;  2XND H;  2QSI A;  1OW8 A;  3F5H A;  1GMJ A;  3T97 B;  2K94 A;  1LT9 C;  1JY2 N;  3U1C A;  3KZI H;  1BCC G;  1KYO D;  4H0L C;  1BGY E;  2ZYD A; 
#chains in the Genus database with same CATH homology
 3NTE A;  1QVG O;  3CCQ P;  5DCK A;  1BAJ A;  4QNB A;  1VQN P;  3CD6 P;  1KC8 Q;  3CCV P;  1PEQ A;  2EG5 A;  3H0D A;  3CCE P;  4PH0 A;  1D1D A;  1M6E X;  2E1M A;  1PEU A;  3P05 A;  3H47 A;  4XRQ A;  2JYG A;  3DS0 A;  4U0F A;  5HGL A;  3CMA P;  4XFY A;  2Z45 A;  2OTJ P;  1QVF O;  1YJN P;  1YI2 P;  1K8A Q;  4U0C A;  2PEN A;  1EOQ A;  2JYL A;  3CC7 P;  1VQL P;  4U0E A;  3CCL P;  3Q20 A;  3RG6 C;  3CCS P;  3CXC O;  1VQK P;  1NJI Q;  3LRY A;  1S72 P;  1Q86 Q;  3G4S P;  1Q7Y Q;  4XRO A;  2BQ1 E;  4U0A A;  2XXM A;  1KD1 Q;  2PEK A;  2M8L A;  5BS1 A;  1VQ6 P;  1Q82 Q;  2OAR A;  2DGY A;  3DPH A;  4GR6 A;  5I4T G;  3G29 A;  1E6J P;  1VQ4 P;  3CC2 P;  2BUO A;  3G1G A;  1RO2 A;  4COC A;  2ONT A;  3DS5 A;  1RNI A;  1M74 A;  3CCR P;  1YJW P;  5F2K A;  1ZMB A;  3CPW O;  3OW2 O;  4U0D A;  2M8P A;  3HYB A;  1AUM A;  3CC4 P;  3CCU P;  2XV6 A;  3B5I A;  1M1K Q;  4M0I A;  2KOD A;  2EFJ A;  2PY8 A;  1A43 A;  4PH1 A;  1VQM P;  1PEM A;  2PEQ A;  1PEO A;  4GR2 A;  2QA4 P;  3M1M A;  1RO0 A;  1VQ5 P;  3E2D A;  3G26 A;  1W2B O;  1N8R Q;  1JJ2 O;  4XFZ A;  1YHQ P;  4WYM A;  2PEM A;  1K9M Q;  2Z44 A;  3DS1 A;  5HGO A;  2OTL P;  1EIA A;  3G21 A;  5JPA A;  3MGE A;  3G6E P;  2Z46 A;  2CWO A;  3CCJ P;  1K73 Q;  4XFX A;  1YIJ P;  5F2O A;  3G1I A;  2PEJ A;  1K30 A;  3G0V A;  5HGN A;  1VQ7 P;  4U0B A;  3G28 A;  2XT1 A;  2BHV A;  2L6E A;  3DTJ A;  3I55 P;  1M6N A;  2P9X A;  2PEO A;  3VRL C;  4COP A;  1QRJ A;  5BS2 A;  1YIT P;  1VQO P;  2LF4 A;  3DS3 A;  3DS4 A;  2QEX P;  1VQ8 P;  1YJ9 P;  2M8N A;  1VQ9 P;  3H4E A;  3G71 P;  2PEI A;  5HGM A;  1KQS O;  4IPY A;  1A8O A;  2EIA A;  5F2N A;  1IUQ A;  3I56 P;  1M90 Q;  2JO0 A;  1VQP P;  3WBH A;  3CCM P;  1Q81 Q;  3CME P;  3HZQ A;  3DS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...