1VQ8P

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq8P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq8P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq8P02
3CCJP 1VQOP 3CCRP 1VQMP 1Q82Q 1NJIQ 1KD1Q 3CC2P 3CPWO 3CD6P 2OTLP 1JJ2O 1VQ7P 1K73Q 3G4SP 3G6EP 3I55P 1VQPP 1Q86Q 1VQ8P 1VQ5P 3I56P 2OTJP 3CMAP 1M1KQ 3CCVP 1Q81Q 1K9MQ 1YIJP 1YJ9P 1YJNP 3CCLP 3CCUP 2QA4P 1QVFO 1VQ6P 3CMEP 3CCMP 1W2BO 1KC8Q 1VQ4P 1VQ9P 1N8RQ 3OW2O 1QVGO 1VQLP 2QEXP 3G71P 1YHQP 1K8AQ 1M90Q 1Q7YQ 1VQKP 3CC7P 3CCQP 3CXCO 3CCEP 1VQNP 1YITP 1YJWP 1S72P 1KQSO 1YI2P 3CCSP 3CC4P
chains in the Genus database with same CATH superfamily
5L8RJ 2KGEA 4GT1A 4HB1A 2AXTE 1BGYE 3H1LG 3CCVP 3H32A 1K8AQ 2I1JA 2JYLA 1AVOA 3A0BE 1Y8AA 4N78E 4C46A 1P84I 1PP9G 1K73Q 2Z5IA 3SWFA 2P67A 4WYMA 1J1EB 1NKZB 2YNYA 2WPRA 3PRJA 1BCCG 2QG4A 1OW6A 4H2WC 1M1JC 3C9IA 4PD4D 1LT9C 1OFCX 4U3FD 2FBWC 3H47A 1JY3N 1HJBA 1UNKA 5AW6B 3M0DA 1G1IA 1JMBA 1FZAA 3U1AA 3TGUG 2Y0EA 3N7NA 4YPCA 1ZN5A 2ZYGA 1NO4A 2MVVA 2QEXP 2Q1KA 5DCKA 1NTMD 3H1KE 1VL2A 1X22A 1BE3J 2P7JA 2JYGA 3H1HD 2K94A 3M9QA 3V2RA 2Q3EA 2WMMA 3S9OA 1GMJA 3GHGB 3HUSA 1M1JA 3PTZA 2CQ8A 3WUUA 3CC2P 3BCCD 3EJBA 1AQTA 1SQXG 2KGAA 2IPPA 4ZKUA 2N1TC 3M1MA 2PEMA 2KP8A 1QGKB 3G9RA 1U7MA 2M8RA 2OARA 2WPVB 4L74A 4IOIH 1DV5A 1IC2A 1SQBD 2B88A 2CNRA 3H0DA 2QE7H 5KLVJ 2CPSA 3CCMP 2A06E 5KAFH 1DD3A 3Q3DA 4I7ZC 3A0HE 2ERHA 2IFMA 2JGPA 2EHSA 4IL6H 2IDBA 1TU3F 3L74G 4AQRD 2IFNA 2CGQA 3WU2E 4NPFX 1WRGA 2AXTH 1RE3C 5APVA 3A5TA 1GD2E 2KR5A 1QVFO 2E74B 2OGUA 2ZVOB 2Y9ZA 4XFJA 1L0LK 5AVXB 2HYNA 3A0BH 4H2YC 1AF8A 1EDKA 3KHUA 1BAJA 2E74D 3JCUE 4OVNF 1U7JA 1ACPA 1OXZA 2LKMA 1L0LG 1PP9D 3V2PA 1VQPP 1FOSE 1SFCB 1M6NA 4PXHB 3ABVC 3DS1A 1L0NG 4PD4E 1EQ7A 1RO0A 1BCCD 4U3FE 1SFCD 1SQPJ 2XV5A 1L4AB 3RL0C 3D6YA 2L91A 1N7SB 1GL2A 1PEOA 3GJNA 5I4TG 2NPSA 3B4QA 1L4AD 3TF5A 1ZLLA 4WVZA 2OYIC 2CK3H 1N7SD 2KG8A 3MUDA 2AVAA 1NTME 1X3OA 2R44A 3CMEP 1VQ9P 2JAZA 3H1HE 1OVRA 2KS1A 2G8YA 1OVUA 1YJWP 3EQ2A 3CE7A 5HVCA 1KB9E 2IBZI 1A02J 5CZDB 1JMMA 5AVUB 2WSFH 3MGEA 3BCCE 2XV6A 3NY7B 3AEFC 5KJ7D 1R8EA 1LWUA 1SQXD 3GF3A 3P32A 3V5BA 1SQBE 1L0IA 2KZIA 4H44B 2BQ1E 3H6PA 4GR6A 1YIJP 4H44D 5DJTB 2Z46A 3LW5H 1JY2P 1A8OA 1GDTA 2MY5A 2LOLA 4I2LC 2FYUJ 1P84D 3H1IJ 2GDYA 2KNCB 3NTEA 2MD9A 2R5DA 3WU2H 1QX8A 2AFDA 2XU6A 3OA7A 5BU8B 3S4RA 1HTLC 1J1EC 2BCCE 2KI7B 2KGCA 1RNIA 1RHZB 1MUUA 3MIWA 4BRYA 1OWAA 3JCUH 1PP9E 3L75D 2K5XA 2LF4A 1JEKA 2WPQA 1HGZA 2OYHA 1FZCC 4PD4H 1BGYG 3G26A 3CCUP 2FFDB 4A7PA 1GK6A 1L0ND 2V7QH 3E1RA 3CWBD 3V4QA 2HR3A 2K93A 1PV3A 1S2EA 5CCHD 1M57D 2FAEA 2NRGA 2KK7A 4DG9A 1N73B 3GHGC 5AW0B 2P58A 1KN7A 2PEKA 1LP1B 4LLHA 2C9LY 2ZVNB 1LGHB 2WSEH 1SQVJ 3MHVA 1BDCA 2XT1A 1KORA 1KD1Q 1MKMA 3EFGA 2JQ4A 5HGNA 3A2AA 4D6TJ 2WT7B 1DH3A 3GW6A 3RG2A 1SQXE 1VQLP 2FVEA 1GW3A 2YMYA 3R2PA 1BXIA 3AE2C 1S72P 1QEXA 2GA1A 3H1KG 2N9BA 3B8EB 1EDLA 4JQ0D 3L71J 2QJYB 5HV8A 4L76A 3PHLA 3AE7C 2VLOA 3T97B 3VMZA 4IFFA 1MZ9A 1ZRTD 5CJ0A 1P84E 3DS3A 4XFZA 2WZ7A 5APSA 1NJIQ 1HVVA 4IFMA 1NWQA 2N9YB 2R32A 3UIAA 1KB9I 1SFCC 5GTHE 3LRYA 2H8PD 1PGQA 4AYCA 5KAIE 1W2BO 4IZ6A 4F37A 1JY3O 3L75E 2O1KA 2K0XA 2RH0A 3AE1C 2A06G 3Q20A 2M0BA 2LXBA 2QJPB 3HD7C 1L0HA 2B9BA 1BE3G 3DPHA 2JU2A 2LTEA 1L0NE 3CWBE 2HODB 1RO2A 2O01H 2IBZD 3MD0A 5GTIE 3EJEA 2E43A 3GZLA 3SSUA 1CEIA 2VLQA 3L70J 2WSCJ 3BRTB 3FX0A 5KJ7C 2R3SA 3HE5B 1L4AA 2W90A 3EJDA 1N7SA 2HPCB 4U3FG 1FOSF 3L73J 1NTZD 2YMKA 1NTMK 2MR7A 3G3ZA 4H44C 4ZMDA 2M3EA 2E5TA 4W80A 2QM7A 1NTMG 2E76B 3RK3B 5F2KA 2WWWA 3H1HG 3V2QA 4PWVB 1FZGA 3SWYA 2W6JH 3B5NA 3EWKA 3H1JJ 1URQB 2CPBA 2EHTA 1ZXGA 2E76D 3P8CD 3RK3D 2OYIB 3CX5I 1ZRTE 2KOGA 5AVVB 2D2CB 2FQ1A 1URQD 2K37A 1NTKJ 3BCCG 1VQ6P 1P84H 2D2CD 3L35A 5HGLA 4U0DA 2JEEA 1OMIA 3F89A 5BVZA 1T3UA 3GG2A 4GODA 4QMAA 4YXDC 1SQBG 5JPAA 5GTHH 3P05A 5KAIH 3RG6C 2MR8A 2FFDC 5CCHC 1WMKA 3NMDA 5HGMA 1IFIA 4Y99B 1OZHA 3PP5A 1VQOP 3R4YA 2GZEA 2OQQA 1KYOI 1VQ7P 2FQ2A 1JTHA 2XZ1C 2LPKA 1X9VA 1BE3D 2LL8A 1RF0C 2IBZE 1N73C 1WT6A 1FDIA 3OW2O 2BCCG 2XNXA 5GTIH 3P7KA 1QRJA 5AVRB 5AW9B 2ZJSE 1A02F 1FE6A 4BPFA 2KYVA 3HYBA 2GM4A 4C7NA 3PLNA 4M0IA 1KILB 4WB4A 4R4MA 3L72J 1S4XA 2P9XA 2P2UA 2FXPA 1HGVA 1DEEG 5KLIC 1VQ4P 2H7HA 1KILD 4WY4A 1NTZE 3FWNA 2A45I 3V4WA 1PL5A 2PP6A 1H0TA 5APQA 5KLVD 1IMPA 2Q5UA 1YTZT 2K3RA 1G2CB 3NTNA 2QJYC 2OTJP 1FZCB 3E7KA 1ZR2A 2Z45A 2J5UA 3P8CE 1HY8A 3RK3E 4KT0J 3CCRP 5AVSB 3M9BA 4HYTB 5AW2B 1H88A 2K9YA 1KB9D 1SQXK 4K35A 1AQ5A 4RESB 3B5IA 1LT9A 2YIUB 1SP4A 2K88A 1LJ2A 2L0QA 1T8ZA 1YTZI 2LXCB 1NAYA 3F5HA 1CZQA 1VQMP 2N5HA 2FVAA 2OTKE 1SQQJ 1IFJA 4GKGA 2QJPC 1MV8A 1SQPD 2K0YA 2E5YA 3GKLC 1N7LA 1IFMA 3AE8C 3KDPB 1RF1C 2E1MA 4JYBA 1YQ4C 1RE4C 2YO3A 1G1JA 2BHVA 2FXOA 3G28A 2RMZA 3CC4P 3VMXA 4BPHA 1BE3E 3GF7A 2Q9IA 1OVVA 2QM8A 1SQVG 2N1TA 2I1KA 1N8RQ 1QVGO 3G71P 3GLMA 1KQFB 4D6TG 2BCCD 3AECC 4XE5B 1KQSO 3L75G 2BUOA 1U57A 1S5LX 2AFEA 4H13B 1L0NK 1D1DA 1PGJA 3B71A 5AW3B 2FHSC 1USEA 1KILE 3L71G 4MRTC 1AA0A 4H13D 1NU1J 3GMAA 2WSEJ 1YBKA 3CWBG 1JOCA 1VPCA 5KLVE 1PIXA 4OGQC 2E76C 3RK3C 3HD7B 3CX5D 1RE3A 3DS5A 1PZQA 2AEFA 2B87A 1JNMA 4U0EA 1URQC 2AEMA 3HD7D 4GOEA 4N6JA 1X0TA 2FYUD 3H1ID 5M1BA 2D2CC 2FY8A 3O6QA 2Y0DA 4HKGA 2KSJA 4IL6X 2WQYC 2RKLA 1AFOA 1GTWA 1FZFA 3LIEA 3HE4B 1EDJA 1KFNA 4R4LA 2BEZF 3KPEA 2NO8A 1KV4A 2FADA 3E2DA 4RJTA 2W83C 3NFQA 1LNQA 3W67A 3H1LJ 1KYOD 2QNWA 2OYIA 1SQPE 4Y99C 1LTJB 1Y9BA 3Q5RA 2KG9A 5CMZA 5KKZB 5AVTB 1EZVI 3CLQA 1T3JA 4LC1A 4PH0A 3V2NA 4HH2A 3A0HH 1HF9A 3Q2YA 5B5EE 1PEUA 3D70A 5KP8B 1M7LA 1IUQA 3CCJP 3H4EA 1BCCJ 4PJ0E 3U1CA 1Q2NA 5E79E 2XZRA 1W2EA 3IN6A 1ZR4A 4BPGA 1VKUA 2KG6A 1KILC 1YJNP 1SQVD 4JBZA 1RY3A 1GU5A 3TDKA 3L4FA 1S1CX 3CI9A 1IO4A 4NEOA 4JYCA 2KXPB 2PNGA 3TGUJ 4D6TD 2GDWA 3VRLC 2Z44A 1Q82Q 1GK4A 1LTBC 1GZLA 2W6AA 4PV1B 2WPSA 3I56P 1OX3A 1JCCA 1YJ9P 3L71D 4JPZB 1Q90D 2IBZG 2N50A 3CX5E 3H32B 4EI2A 2OYOA 2PEIA 3D71A 1OW8A 2LKIA 2DW3A 1NHLA 2FYUE 3H1IE 5B66E 3M06A 3CMAP 1NTZK 1SS1A 2FQ0A 2O1JA 5EFWB 4DJGA 2L9FA 1IFNA 2YIUC 1UJZA 2VSQA 1NTZG 1YI2P 1KB9H 2J59M 3TNUB 5KTBA 1ZOYC 1G2CA 1FZCA 1MZ8A 1JY3P 4L73A 5AW4B 3GZMA 1PGPA 3L74J 5KLIB 1RH5B 1K30A 1IZNB 1KYOE 4M3LA 1GXGA 3ZDMA 2ROQA 1R5SA 3L37A 1J2JB 5AW5B 1LTTC 3GHGA 2O3JA 2M3BA 1EMVA 3E1IA 2KWLA 2H88C 3TK1A 3FGAD 3HUSB 2GYKA 5H2FE 1L0LJ 5KP7B 4IL6E 3L70D 1XTCC 1LTSC 2ZXXA 3VP9A 3H25A 5B5EH 2GZIA 2ONTA 1KTMA 3AEBC 3JC22 1NQ4A 1EDIA 5E79H 5AVZB 2PGDA 1EOQA 1SQVE 3I55P 4H13C 1JM0A 4NPEA 4TLFA 3L73D 3JSVC 1KC8Q 4D6TE 3TYYA 2KOPA 5EJDA 4KJMA 3HZQA 3CL3D 1VHNA 5AW1B 2L6EA 3G29A 5HGOA 4JF7A 2AEJA 3L71E 1PFIA 1M1KQ 3AEAC 3VYIA 3BRVB 1RF1B 1Q81Q 2MF4A 1AUMA 4HKZH 3H1JD 1YHQP 3HRNA 4GR2A 3CX5H 3CCQP 1N2DC 2MKVA 1T2KD 1S3JA 4CPGA 1KMIZ 1NTKD 1SFCA 5B66H 5BS2A 3RBZA 1EXJA 2GUVA 2RN0A 3U59A 2ZAEB 4YTPC 5KLVK 3HD7A 4EYYQ 2PEJA 4CA3A 3DS2A 1HUCA 4IFDK 2KORA 5KLVG 2JKVA 1PPJG 2ZFCA 2EIAA 1OIPA 1GL2B 2NPSB 1LTJC 1EZVD 2C9NY 3OJAB 4UB8E 1T6AA 1GL2D 5KKZC 4U0AA 2NPSD 2XKMA 5AW7B 4OGQB 2M5AB 2KS1B 5APWA 1H89A 4NPDA 5KJ7A 3A7OA 4OGQD 2Y9YA 3G21A 2AXCA 2FVFA 1JCDA 3L70E 3PJSK 5H2FH 5CBNA 4ZNCA 5APTA 1SQPK 3CXCO 1VQNP 1SQBK 2B89A 3SFDC 3G1GA 2QIWA 1LWUB 2JO0A 1NU1G 1BGYJ 1S5LE 3L72D 2M8PA 1SQPG 3L73E 3PH0A 3DTJA 2MVUA 1EIAA 2A45H 1JY2N 2XNDH 4PV1C 1FZEA 4XROA 2KUBA 4Z1MH 5CCGD 2KNCA 3IF4A 2QJKB 2JDIH 7CEIA 3CXHI 2ITAA 3H1JE 4DT0A 2UWJE 3Q5SA 4L75A 2M5RA 3OAKA 5KAFE 2BASA 4COCA 2JJLA 1Q7YQ 1FDMA 5F2OA 1NTKE 5APUA 1PGOA 1DD4A 1AYIA 4BRYB 2N5IA 2WVRA 5APYA 2FYNB 1D7MA 1AVYA 4U0CA 2YKOA 2FFDA 3H1KJ 3M0DC 5CCHA 2OYHB 4MN4C 4OH8B 2W8ZA 4GOFA 2KW2A 1SQQD 3IR9A 2FYUK 2Z4EA 1EZVE 2WSFJ 5DJUB 1RF0A 1PPJD 1N73A 3C8VA 2IX7C 4O9BA 4UB8H 2FYUG 3H1IG 1KZUB 2JWAA 1LP1A 3RBXA 1IK9A 3HUSC 4XA4A 3TNUA 1JB0J 1YITP 2DNWA 2G3AA 5BU5A 2E42A 2C0XA 1IK7A 1MFZA 4YXWH 2PENA 1FJPA 3V6IA 4C7RA 2WT7A 1QL1A 1VF5B 3IFMA 3LW5J 1K04A 1QL2A 3MGNA 2WSCH 2K9JB 2HFED 2I8DA 2M8LA 1VF5D 4RO0A 3L72E 3CC7P 2V4HA 2LIWA 1M74A 1USDA 1S5LH 4WWIA 2KSEA 3CD6P 1NU1D 3T97A 4W7YA 1KQGB 1EC5A 2DGYA 4DZOA 4H0LB 4BXLA 3M9HA 1HBWA 2HG5D 2ZT9B 3BASA 1N86A 1T2KC 4H0LD 3AEEC 1SQVK 3AE9C 3BVHA 2JB0A 3WBHA 2ZT9D 1ZMBA 2QVAA 4U3FJ 2N6YA 2V7QJ 3M0AA 2A45G 2KLVA 1DIPA 3NXSA 4W7ZA 1GXHA 2YKQA 3Q1MA 1FBMA 4GDOA 2M8NA 1NTMJ 1RF1A 1Z56A 1RE4A 4UB6E 2HODA 1VQ5P 1GL2C 3H1HJ 2NPSC 3H1LD 1PEQA 1SQQE 4COPA 1JUNA 3FWLA 2N98A 3KZIE 3MUDC 4U0FA 4EIJA 2GZJA 3M91A 1E79H 1PPJE 3BCCJ 1PEMA 5KP6B 1NOHA 1RQVA 4QKOA 1M8OB 3HE5A 2JU1A 3MP7B 2FACA 4GIFA 4U7JA 3ITKA 1KLPA 2L4BA 2HPCA 1SVFA 1IFPA 3KYQA 1SQBJ 1VQKP 1H8AA 2VLPA 4XFYA 5C39A 3I5CA 3HTKB 1LWUC 1VDFA 1UIXA 3LIDA 3TGUD 5CCGC 2CG5B 3RK2C 2M5AA 4AUWA 2NZ2A 5CJ4A 2LR2A 1NU1E 3CXHD 1URQA 1FS0E 5AVWB 1F80D 2PEOA 1DX7A 1FAVA 2QJKC 2BCCJ 2MJZA 3B5NB 1LTAC 3QH9A 2Q6QA 2Z5HA 4Y28J 4BWNA 2WTYA 4OWFA 1K9MQ 2PY8A 2N6ZA 2QA4P 3B5ND 4ZKPA 1UIIA 3DS4A 2LIUA 4H2XC 1PP9J 2H89C 3L70G 3VTPC 3Q5PA 2Q7CA 4QNBA 1CI6B 1NKNA 3B4SA 5CCGA 2E75B 2FYNC 2W6BA 1GU4A 2O01J 3L73G 3G0VA 5EW5E 2KOSA 2E75D 2QSIA 3FXEA 4B86A 2KZJA 4EOTA 2OYHC 1NYHA 4I6MC 2R5BA 3L74D 3CPWO 2BEQD 3H1LE 3U43A 2GDXA 3USSA 1GPJA 3LMOA 2GUSA 4UB6H 2FXMA 2L5GB 1A43A 5AW8B 1JTHB 2EG5A 2K1AA 4PH1A 1NTKK 1Y47A 3H1JG 4PV1D 3AEGC 1HJ0A 3KZIH 2W27A 3CCEP 1E6JP 1DNYA 3AEDC 1RQUA 1NTKG 3L36A 1KILA 1IJDB 1L0LD 2YKPA 4C7NB 1SQXJ 1K05A 1VQ8P 4KHXA 1BCCE 3S1KA 1J1DB 2K2QA 1VF5C 3D6ZA 2L22A 2ZYDA 2LMLA 1NAFA 3DS0A 2KIKA 3SWKA 4WY4B 4TT3H 2YO2A 2IZ1A 1JY2O 3TGUE 1H0TB 1EZVG 4WY4D 2JWDA 3A3YB 3WUTA 2JBGA 3MTUE 2GZFA 2XDJA 4H0LC 3CXHE 2Y0CA 1FR2A 1ZV8A 1LTGC 2KGDA 2YXQB 1CSBA 1E0HA 2PAJA 1BSHA 1SLQA 2ZT9C 5AVYB 4XRQA 2KODA 1M56D 4HJGH 2IYPA 2P1JA 3G6EP 2K9JA 3RL0g 3L75J 2KLUA 1YYCA 1M1JB 4WBAA 2HLOA 1FU1A 1LT9B 1T8KA 4N3YB 2VLNA 1E5WA 3VOPA 3VMAA 3L72G 2XZ0D 3CCSP 2WPTA 4PD4I 5TISE 4PJ0H 1L0NJ 3CWBJ 4DOJA 2O01N 1BSNA 2POHA 1HWTC 2JO1A 4XFXA 3IAOA 1EXIA 4IPYA 5F2NA 1QLED 2E74C 2WSSH 3BATA 1MFTA 3L74E 1JO5A 2GZGA 5K5GB 3AE6C 4ASWA 2IZ0A 1FC2C 2KOQA 1DEBA 1ZMEC 1GW4A 3CCLP 4EDFA 1LTIC 2N1TB 1L4AC 3WMM0 1KQLA 1L0LE 3KXDA 4U0BA 5CHXA 1N7SC 2N1TD 1OW7A 3QWOC 1S9KD 1AV1A 1SQQK 2Q3IA 4DCKA 3G4SP 2X2BA 3II6A 2FKWB 2H43A 2EFJA 2CWOA 1BGYD 4I7ZB 4RKUJ 1HQBA 1SQQG 1XTGB 1HH0A 3SFEC 2K0DX 1W5CE 1ZP0C 3TSIA 3C1LA 3FXDA 2SPZA 2ZYAA 1R5LA 4N78D 3B5NC 2B87B 1X8YA 2P10A 1AJYA 5TJHA 3RGUA 2PFXA 4ASVA 1M6EX 4I1LA 3CXHH 1L2PA 3EFFK 1KYOH 2AF8A 2PRRA 1NGMB 3O6QB 3HTKA 2FYZA 3O8ZA 2QRXA 2JR8A 3HE4A 2OTLP 2VRSA 4LGDE 1X79B 3K5BA 4R0MA 1FDOA 3P8MC 2E75C 1YQ3C 1CW5A 1BDDA 1ZW0A 3AE5C 4K3AA 1NU1K 2YXRB 5APXA 3RL0B 1NVOA 1M90Q 2WITA 1IFDA 5CBOA 1IMQA 3MZWB 3KQGA 1Z6MA 2KOOA 5BS1A 1LTJA 3RL0D 5TISH 3H1KD 2IYOA 1JJ2O 2JP3A 5AVQB 3AE4C 1Q86Q 1NH4A 1KFMA 1LT1A 3RK2B 3N4XA 1OR5A 1CI6A 2K92A 3RK2D 3W68A 4UHPB 3WUVA 2XXMA 3VN0A 3G1IA 3VMYA 1FJKA 1ZNVA 1NTZJ 1J1DC 2KB7P 2R3CA 1FZBA 2C0WA 2PEQA 3VP8A 2A06D 1S9KE 3AE3C 2J58A 2ZXEB 4WY4C
chains in the Genus database with same CATH topology
1Q82Q 3CCRP 4XRQA 2OARA 3DS5A 2KODA 2M8NA 1EOQA 3G6EP 4U0EA 3DPHA 3I55P 3G21A 1VQ5P 3I56P 5JPAA 3MGEA 3H0DA 3G0VA 1PEQA 2XV6A 3CCVP 3B5IA 1YJ9P 4COPA 3P05A 3CCMP 1M6EX 3RG6C 1KC8Q 1RO2A 1K8AQ 2PEKA 3CXCO 3HZQA 1VQNP 4U0FA 2JYLA 1YITP 5HGMA 2PEIA 3G1GA 3CCSP 2XT1A 2JO0A 2PENA 1VQOP 1VQMP 1KD1Q 2OTLP 3CPWO 1PEMA 1VQ7P 1K73Q 2L6EA 2BQ1E 3G29A 2M8PA 3DTJA 5HGOA 4WYMA 1EIAA 1A43A 5HGNA 4GR6A 3CMAP 2EG5A 1M1KQ 4PH1A 1Q81Q 4XFXA 1YIJP 1AUMA 2E1MA 4XROA 1QVFO 4IPYA 5F2NA 2Z46A 2M8LA 3OW2O 1VQLP 1YHQP 1M90Q 4GR2A 3E2DA 1A8OA 1VQKP 3CC7P 3CCQP 1QRJA 3CCEP 1E6JP 1M74A 2BHVA 4XFYA 1S72P 5BS1A 1YI2P 3HYBA 1BAJA 3G28A 3NTEA 3H47A 3CC4P 3CD6P 1JJ2O 5BS2A 4M0IA 1VQPP 1Q86Q 1VQ8P 2DGYA 1M6NA 2P9XA 3DS1A 3CCLP 1K30A 1VQ4P 3DS3A 1RO0A 4PH0A 1QVGO 2QEXP 3G71P 4XFZA 4COCA 1N8RQ 1Q7YQ 1RNIA 5DCKA 5F2OA 5F2KA 3DS0A 2PEJA 3DS2A 1KQSO 2JYGA 2BUOA 1PEUA 2PEOA 1IUQA 3H4EA 4U0BA 3CCJP 3WBHA 5I4TG 1NJIQ 1PEOA 2XXMA 2EIAA 2LF4A 3G1IA 1D1DA 4U0CA 3G4SP 1ZMBA 2OTJP 1K9MQ 2PY8A 3LRYA 3G26A 3CCUP 2QA4P 1YJNP 2EFJA 4U0AA 3CMEP 2CWOA 1W2BO 1VQ6P 1VQ9P 3CC2P 2PEQA 2Z45A 3DS4A 5HGLA 4QNBA 1YJWP 4U0DA 2ONTA 3Q20A 3VRLC 3M1MA 2PEMA 2Z44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ P;  1VQO P;  3CCR P;  1VQM P;  1Q82 Q;  1NJI Q;  1KD1 Q;  3CC2 P;  3CPW O;  3CD6 P;  2OTL P;  1JJ2 O;  1VQ7 P;  1K73 Q;  3G4S P;  3G6E P;  3I55 P;  1VQP P;  1Q86 Q;  1VQ8 P;  1VQ5 P;  3I56 P;  2OTJ P;  3CMA P;  1M1K Q;  3CCV P;  1Q81 Q;  1K9M Q;  1YIJ P;  1YJ9 P;  1YJN P;  3CCL P;  3CCU P;  2QA4 P;  1QVF O;  1VQ6 P;  3CME P;  3CCM P;  1W2B O;  1KC8 Q;  1VQ4 P;  1VQ9 P;  1N8R Q;  3OW2 O;  1QVG O;  1VQL P;  2QEX P;  3G71 P;  1YHQ P;  1K8A Q;  1M90 Q;  1Q7Y Q;  1VQK P;  3CC7 P;  3CCQ P;  3CXC O;  3CCE P;  1VQN P;  1YIT P;  1YJW P;  1S72 P;  1KQS O;  1YI2 P;  3CCS P;  3CC4 P; 
#chains in the Genus database with same CATH topology
 5L8R J;  2KGE A;  4GT1 A;  4HB1 A;  2AXT E;  1BGY E;  3H1L G;  3CCV P;  3H32 A;  1K8A Q;  2I1J A;  2JYL A;  1AVO A;  3A0B E;  1Y8A A;  4N78 E;  4C46 A;  1P84 I;  1PP9 G;  1K73 Q;  2Z5I A;  3SWF A;  2P67 A;  4WYM A;  1J1E B;  1NKZ B;  2YNY A;  2WPR A;  3PRJ A;  1BCC G;  2QG4 A;  1OW6 A;  4H2W C;  1M1J C;  3C9I A;  4PD4 D;  1LT9 C;  1OFC X;  4U3F D;  2FBW C;  3H47 A;  1JY3 N;  1HJB A;  1UNK A;  5AW6 B;  3M0D A;  1G1I A;  1JMB A;  1FZA A;  3U1A A;  3TGU G;  2Y0E A;  3N7N A;  4YPC A;  1ZN5 A;  2ZYG A;  1NO4 A;  2MVV A;  2QEX P;  2Q1K A;  5DCK A;  1NTM D;  3H1K E;  1VL2 A;  1X22 A;  1BE3 J;  2P7J A;  2JYG A;  3H1H D;  2K94 A;  3M9Q A;  3V2R A;  2Q3E A;  2WMM A;  3S9O A;  1GMJ A;  3GHG B;  3HUS A;  1M1J A;  3PTZ A;  2CQ8 A;  3WUU A;  3CC2 P;  3BCC D;  3EJB A;  1AQT A;  1SQX G;  2KGA A;  2IPP A;  4ZKU A;  2N1T C;  3M1M A;  2PEM A;  2KP8 A;  1QGK B;  3G9R A;  1U7M A;  2M8R A;  2OAR A;  2WPV B;  4L74 A;  4IOI H;  1DV5 A;  1IC2 A;  1SQB D;  2B88 A;  2CNR A;  3H0D A;  2QE7 H;  5KLV J;  2CPS A;  3CCM P;  2A06 E;  5KAF H;  1DD3 A;  3Q3D A;  4I7Z C;  3A0H E;  2ERH A;  2IFM A;  2JGP A;  2EHS A;  4IL6 H;  2IDB A;  1TU3 F;  3L74 G;  4AQR D;  2IFN A;  2CGQ A;  3WU2 E;  4NPF X;  1WRG A;  2AXT H;  1RE3 C;  5APV A;  3A5T A;  1GD2 E;  2KR5 A;  1QVF O;  2E74 B;  2OGU A;  2ZVO B;  2Y9Z A;  4XFJ A;  1L0L K;  5AVX B;  2HYN A;  3A0B H;  4H2Y C;  1AF8 A;  1EDK A;  3KHU A;  1BAJ A;  2E74 D;  3JCU E;  4OVN F;  1U7J A;  1ACP A;  1OXZ A;  2LKM A;  1L0L G;  1PP9 D;  3V2P A;  1VQP P;  1FOS E;  1SFC B;  1M6N A;  4PXH B;  3ABV C;  3DS1 A;  1L0N G;  4PD4 E;  1EQ7 A;  1RO0 A;  1BCC D;  4U3F E;  1SFC D;  1SQP J;  2XV5 A;  1L4A B;  3RL0 C;  3D6Y A;  2L91 A;  1N7S B;  1GL2 A;  1PEO A;  3GJN A;  5I4T G;  2NPS A;  3B4Q A;  1L4A D;  3TF5 A;  1ZLL A;  4WVZ A;  2OYI C;  2CK3 H;  1N7S D;  2KG8 A;  3MUD A;  2AVA A;  1NTM E;  1X3O A;  2R44 A;  3CME P;  1VQ9 P;  2JAZ A;  3H1H E;  1OVR A;  2KS1 A;  2G8Y A;  1OVU A;  1YJW P;  3EQ2 A;  3CE7 A;  5HVC A;  1KB9 E;  2IBZ I;  1A02 J;  5CZD B;  1JMM A;  5AVU B;  2WSF H;  3MGE A;  3BCC E;  2XV6 A;  3NY7 B;  3AEF C;  5KJ7 D;  1R8E A;  1LWU A;  1SQX D;  3GF3 A;  3P32 A;  3V5B A;  1SQB E;  1L0I A;  2KZI A;  4H44 B;  2BQ1 E;  3H6P A;  4GR6 A;  1YIJ P;  4H44 D;  5DJT B;  2Z46 A;  3LW5 H;  1JY2 P;  1A8O A;  1GDT A;  2MY5 A;  2LOL A;  4I2L C;  2FYU J;  1P84 D;  3H1I J;  2GDY A;  2KNC B;  3NTE A;  2MD9 A;  2R5D A;  3WU2 H;  1QX8 A;  2AFD A;  2XU6 A;  3OA7 A;  5BU8 B;  3S4R A;  1HTL C;  1J1E C;  2BCC E;  2KI7 B;  2KGC A;  1RNI A;  1RHZ B;  1MUU A;  3MIW A;  4BRY A;  1OWA A;  3JCU H;  1PP9 E;  3L75 D;  2K5X A;  2LF4 A;  1JEK A;  2WPQ A;  1HGZ A;  2OYH A;  1FZC C;  4PD4 H;  1BGY G;  3G26 A;  3CCU P;  2FFD B;  4A7P A;  1GK6 A;  1L0N D;  2V7Q H;  3E1R A;  3CWB D;  3V4Q A;  2HR3 A;  2K93 A;  1PV3 A;  1S2E A;  5CCH D;  1M57 D;  2FAE A;  2NRG A;  2KK7 A;  4DG9 A;  1N73 B;  3GHG C;  5AW0 B;  2P58 A;  1KN7 A;  2PEK A;  1LP1 B;  4LLH A;  2C9L Y;  2ZVN B;  1LGH B;  2WSE H;  1SQV J;  3MHV A;  1BDC A;  2XT1 A;  1KOR A;  1KD1 Q;  1MKM A;  3EFG A;  2JQ4 A;  5HGN A;  3A2A A;  4D6T J;  2WT7 B;  1DH3 A;  3GW6 A;  3RG2 A;  1SQX E;  1VQL P;  2FVE A;  1GW3 A;  2YMY A;  3R2P A;  1BXI A;  3AE2 C;  1S72 P;  1QEX A;  2GA1 A;  3H1K G;  2N9B A;  3B8E B;  1EDL A;  4JQ0 D;  3L71 J;  2QJY B;  5HV8 A;  4L76 A;  3PHL A;  3AE7 C;  2VLO A;  3T97 B;  3VMZ A;  4IFF A;  1MZ9 A;  1ZRT D;  5CJ0 A;  1P84 E;  3DS3 A;  4XFZ A;  2WZ7 A;  5APS A;  1NJI Q;  1HVV A;  4IFM A;  1NWQ A;  2N9Y B;  2R32 A;  3UIA A;  1KB9 I;  1SFC C;  5GTH E;  3LRY A;  2H8P D;  1PGQ A;  4AYC A;  5KAI E;  1W2B O;  4IZ6 A;  4F37 A;  1JY3 O;  3L75 E;  2O1K A;  2K0X A;  2RH0 A;  3AE1 C;  2A06 G;  3Q20 A;  2M0B A;  2LXB A;  2QJP B;  3HD7 C;  1L0H A;  2B9B A;  1BE3 G;  3DPH A;  2JU2 A;  2LTE A;  1L0N E;  3CWB E;  2HOD B;  1RO2 A;  2O01 H;  2IBZ D;  3MD0 A;  5GTI E;  3EJE A;  2E43 A;  3GZL A;  3SSU A;  1CEI A;  2VLQ A;  3L70 J;  2WSC J;  3BRT B;  3FX0 A;  5KJ7 C;  2R3S A;  3HE5 B;  1L4A A;  2W90 A;  3EJD A;  1N7S A;  2HPC B;  4U3F G;  1FOS F;  3L73 J;  1NTZ D;  2YMK A;  1NTM K;  2MR7 A;  3G3Z A;  4H44 C;  4ZMD A;  2M3E A;  2E5T A;  4W80 A;  2QM7 A;  1NTM G;  2E76 B;  3RK3 B;  5F2K A;  2WWW A;  3H1H G;  3V2Q A;  4PWV B;  1FZG A;  3SWY A;  2W6J H;  3B5N A;  3EWK A;  3H1J J;  1URQ B;  2CPB A;  2EHT A;  1ZXG A;  2E76 D;  3P8C D;  3RK3 D;  2OYI B;  3CX5 I;  1ZRT E;  2KOG A;  5AVV B;  2D2C B;  2FQ1 A;  1URQ D;  2K37 A;  1NTK J;  3BCC G;  1VQ6 P;  1P84 H;  2D2C D;  3L35 A;  5HGL A;  4U0D A;  2JEE A;  1OMI A;  3F89 A;  5BVZ A;  1T3U A;  3GG2 A;  4GOD A;  4QMA A;  4YXD C;  1SQB G;  5JPA A;  5GTH H;  3P05 A;  5KAI H;  3RG6 C;  2MR8 A;  2FFD C;  5CCH C;  1WMK A;  3NMD A;  5HGM A;  1IFI A;  4Y99 B;  1OZH A;  3PP5 A;  1VQO P;  3R4Y A;  2GZE A;  2OQQ A;  1KYO I;  1VQ7 P;  2FQ2 A;  1JTH A;  2XZ1 C;  2LPK A;  1X9V A;  1BE3 D;  2LL8 A;  1RF0 C;  2IBZ E;  1N73 C;  1WT6 A;  1FDI A;  3OW2 O;  2BCC G;  2XNX A;  5GTI H;  3P7K A;  1QRJ A;  5AVR B;  5AW9 B;  2ZJS E;  1A02 F;  1FE6 A;  4BPF A;  2KYV A;  3HYB A;  2GM4 A;  4C7N A;  3PLN A;  4M0I A;  1KIL B;  4WB4 A;  4R4M A;  3L72 J;  1S4X A;  2P9X A;  2P2U A;  2FXP A;  1HGV A;  1DEE G;  5KLI C;  1VQ4 P;  2H7H A;  1KIL D;  4WY4 A;  1NTZ E;  3FWN A;  2A45 I;  3V4W A;  1PL5 A;  2PP6 A;  1H0T A;  5APQ A;  5KLV D;  1IMP A;  2Q5U A;  1YTZ T;  2K3R A;  1G2C B;  3NTN A;  2QJY C;  2OTJ P;  1FZC B;  3E7K A;  1ZR2 A;  2Z45 A;  2J5U A;  3P8C E;  1HY8 A;  3RK3 E;  4KT0 J;  3CCR P;  5AVS B;  3M9B A;  4HYT B;  5AW2 B;  1H88 A;  2K9Y A;  1KB9 D;  1SQX K;  4K35 A;  1AQ5 A;  4RES B;  3B5I A;  1LT9 A;  2YIU B;  1SP4 A;  2K88 A;  1LJ2 A;  2L0Q A;  1T8Z A;  1YTZ I;  2LXC B;  1NAY A;  3F5H A;  1CZQ A;  1VQM P;  2N5H A;  2FVA A;  2OTK E;  1SQQ J;  1IFJ A;  4GKG A;  2QJP C;  1MV8 A;  1SQP D;  2K0Y A;  2E5Y A;  3GKL C;  1N7L A;  1IFM A;  3AE8 C;  3KDP B;  1RF1 C;  2E1M A;  4JYB A;  1YQ4 C;  1RE4 C;  2YO3 A;  1G1J A;  2BHV A;  2FXO A;  3G28 A;  2RMZ A;  3CC4 P;  3VMX A;  4BPH A;  1BE3 E;  3GF7 A;  2Q9I A;  1OVV A;  2QM8 A;  1SQV G;  2N1T A;  2I1K A;  1N8R Q;  1QVG O;  3G71 P;  3GLM A;  1KQF B;  4D6T G;  2BCC D;  3AEC C;  4XE5 B;  1KQS O;  3L75 G;  2BUO A;  1U57 A;  1S5L X;  2AFE A;  4H13 B;  1L0N K;  1D1D A;  1PGJ A;  3B71 A;  5AW3 B;  2FHS C;  1USE A;  1KIL E;  3L71 G;  4MRT C;  1AA0 A;  4H13 D;  1NU1 J;  3GMA A;  2WSE J;  1YBK A;  3CWB G;  1JOC A;  1VPC A;  5KLV E;  1PIX A;  4OGQ C;  2E76 C;  3RK3 C;  3HD7 B;  3CX5 D;  1RE3 A;  3DS5 A;  1PZQ A;  2AEF A;  2B87 A;  1JNM A;  4U0E A;  1URQ C;  2AEM A;  3HD7 D;  4GOE A;  4N6J A;  1X0T A;  2FYU D;  3H1I D;  5M1B A;  2D2C C;  2FY8 A;  3O6Q A;  2Y0D A;  4HKG A;  2KSJ A;  4IL6 X;  2WQY C;  2RKL A;  1AFO A;  1GTW A;  1FZF A;  3LIE A;  3HE4 B;  1EDJ A;  1KFN A;  4R4L A;  2BEZ F;  3KPE A;  2NO8 A;  1KV4 A;  2FAD A;  3E2D A;  4RJT A;  2W83 C;  3NFQ A;  1LNQ A;  3W67 A;  3H1L J;  1KYO D;  2QNW A;  2OYI A;  1SQP E;  4Y99 C;  1LTJ B;  1Y9B A;  3Q5R A;  2KG9 A;  5CMZ A;  5KKZ B;  5AVT B;  1EZV I;  3CLQ A;  1T3J A;  4LC1 A;  4PH0 A;  3V2N A;  4HH2 A;  3A0H H;  1HF9 A;  3Q2Y A;  5B5E E;  1PEU A;  3D70 A;  5KP8 B;  1M7L A;  1IUQ A;  3CCJ P;  3H4E A;  1BCC J;  4PJ0 E;  3U1C A;  1Q2N A;  5E79 E;  2XZR A;  1W2E A;  3IN6 A;  1ZR4 A;  4BPG A;  1VKU A;  2KG6 A;  1KIL C;  1YJN P;  1SQV D;  4JBZ A;  1RY3 A;  1GU5 A;  3TDK A;  3L4F A;  1S1C X;  3CI9 A;  1IO4 A;  4NEO A;  4JYC A;  2KXP B;  2PNG A;  3TGU J;  4D6T D;  2GDW A;  3VRL C;  2Z44 A;  1Q82 Q;  1GK4 A;  1LTB C;  1GZL A;  2W6A A;  4PV1 B;  2WPS A;  3I56 P;  1OX3 A;  1JCC A;  1YJ9 P;  3L71 D;  4JPZ B;  1Q90 D;  2IBZ G;  2N50 A;  3CX5 E;  3H32 B;  4EI2 A;  2OYO A;  2PEI A;  3D71 A;  1OW8 A;  2LKI A;  2DW3 A;  1NHL A;  2FYU E;  3H1I E;  5B66 E;  3M06 A;  3CMA P;  1NTZ K;  1SS1 A;  2FQ0 A;  2O1J A;  5EFW B;  4DJG A;  2L9F A;  1IFN A;  2YIU C;  1UJZ A;  2VSQ A;  1NTZ G;  1YI2 P;  1KB9 H;  2J59 M;  3TNU B;  5KTB A;  1ZOY C;  1G2C A;  1FZC A;  1MZ8 A;  1JY3 P;  4L73 A;  5AW4 B;  3GZM A;  1PGP A;  3L74 J;  5KLI B;  1RH5 B;  1K30 A;  1IZN B;  1KYO E;  4M3L A;  1GXG A;  3ZDM A;  2ROQ A;  1R5S A;  3L37 A;  1J2J B;  5AW5 B;  1LTT C;  3GHG A;  2O3J A;  2M3B A;  1EMV A;  3E1I A;  2KWL A;  2H88 C;  3TK1 A;  3FGA D;  3HUS B;  2GYK A;  5H2F E;  1L0L J;  5KP7 B;  4IL6 E;  3L70 D;  1XTC C;  1LTS C;  2ZXX A;  3VP9 A;  3H25 A;  5B5E H;  2GZI A;  2ONT A;  1KTM A;  3AEB C;  3JC2 2;  1NQ4 A;  1EDI A;  5E79 H;  5AVZ B;  2PGD A;  1EOQ A;  1SQV E;  3I55 P;  4H13 C;  1JM0 A;  4NPE A;  4TLF A;  3L73 D;  3JSV C;  1KC8 Q;  4D6T E;  3TYY A;  2KOP A;  5EJD A;  4KJM A;  3HZQ A;  3CL3 D;  1VHN A;  5AW1 B;  2L6E A;  3G29 A;  5HGO A;  4JF7 A;  2AEJ A;  3L71 E;  1PFI A;  1M1K Q;  3AEA C;  3VYI A;  3BRV B;  1RF1 B;  1Q81 Q;  2MF4 A;  1AUM A;  4HKZ H;  3H1J D;  1YHQ P;  3HRN A;  4GR2 A;  3CX5 H;  3CCQ P;  1N2D C;  2MKV A;  1T2K D;  1S3J A;  4CPG A;  1KMI Z;  1NTK D;  1SFC A;  5B66 H;  5BS2 A;  3RBZ A;  1EXJ A;  2GUV A;  2RN0 A;  3U59 A;  2ZAE B;  4YTP C;  5KLV K;  3HD7 A;  4EYY Q;  2PEJ A;  4CA3 A;  3DS2 A;  1HUC A;  4IFD K;  2KOR A;  5KLV G;  2JKV A;  1PPJ G;  2ZFC A;  2EIA A;  1OIP A;  1GL2 B;  2NPS B;  1LTJ C;  1EZV D;  2C9N Y;  3OJA B;  4UB8 E;  1T6A A;  1GL2 D;  5KKZ C;  4U0A A;  2NPS D;  2XKM A;  5AW7 B;  4OGQ B;  2M5A B;  2KS1 B;  5APW A;  1H89 A;  4NPD A;  5KJ7 A;  3A7O A;  4OGQ D;  2Y9Y A;  3G21 A;  2AXC A;  2FVF A;  1JCD A;  3L70 E;  3PJS K;  5H2F H;  5CBN A;  4ZNC A;  5APT A;  1SQP K;  3CXC O;  1VQN P;  1SQB K;  2B89 A;  3SFD C;  3G1G A;  2QIW A;  1LWU B;  2JO0 A;  1NU1 G;  1BGY J;  1S5L E;  3L72 D;  2M8P A;  1SQP G;  3L73 E;  3PH0 A;  3DTJ A;  2MVU A;  1EIA A;  2A45 H;  1JY2 N;  2XND H;  4PV1 C;  1FZE A;  4XRO A;  2KUB A;  4Z1M H;  5CCG D;  2KNC A;  3IF4 A;  2QJK B;  2JDI H;  7CEI A;  3CXH I;  2ITA A;  3H1J E;  4DT0 A;  2UWJ E;  3Q5S A;  4L75 A;  2M5R A;  3OAK A;  5KAF E;  2BAS A;  4COC A;  2JJL A;  1Q7Y Q;  1FDM A;  5F2O A;  1NTK E;  5APU A;  1PGO A;  1DD4 A;  1AYI A;  4BRY B;  2N5I A;  2WVR A;  5APY A;  2FYN B;  1D7M A;  1AVY A;  4U0C A;  2YKO A;  2FFD A;  3H1K J;  3M0D C;  5CCH A;  2OYH B;  4MN4 C;  4OH8 B;  2W8Z A;  4GOF A;  2KW2 A;  1SQQ D;  3IR9 A;  2FYU K;  2Z4E A;  1EZV E;  2WSF J;  5DJU B;  1RF0 A;  1PPJ D;  1N73 A;  3C8V A;  2IX7 C;  4O9B A;  4UB8 H;  2FYU G;  3H1I G;  1KZU B;  2JWA A;  1LP1 A;  3RBX A;  1IK9 A;  3HUS C;  4XA4 A;  3TNU A;  1JB0 J;  1YIT P;  2DNW A;  2G3A A;  5BU5 A;  2E42 A;  2C0X A;  1IK7 A;  1MFZ A;  4YXW H;  2PEN A;  1FJP A;  3V6I A;  4C7R A;  2WT7 A;  1QL1 A;  1VF5 B;  3IFM A;  3LW5 J;  1K04 A;  1QL2 A;  3MGN A;  2WSC H;  2K9J B;  2HFE D;  2I8D A;  2M8L A;  1VF5 D;  4RO0 A;  3L72 E;  3CC7 P;  2V4H A;  2LIW A;  1M74 A;  1USD A;  1S5L H;  4WWI A;  2KSE A;  3CD6 P;  1NU1 D;  3T97 A;  4W7Y A;  1KQG B;  1EC5 A;  2DGY A;  4DZO A;  4H0L B;  4BXL A;  3M9H A;  1HBW A;  2HG5 D;  2ZT9 B;  3BAS A;  1N86 A;  1T2K C;  4H0L D;  3AEE C;  1SQV K;  3AE9 C;  3BVH A;  2JB0 A;  3WBH A;  2ZT9 D;  1ZMB A;  2QVA A;  4U3F J;  2N6Y A;  2V7Q J;  3M0A A;  2A45 G;  2KLV A;  1DIP A;  3NXS A;  4W7Z A;  1GXH A;  2YKQ A;  3Q1M A;  1FBM A;  4GDO A;  2M8N A;  1NTM J;  1RF1 A;  1Z56 A;  1RE4 A;  4UB6 E;  2HOD A;  1VQ5 P;  1GL2 C;  3H1H J;  2NPS C;  3H1L D;  1PEQ A;  1SQQ E;  4COP A;  1JUN A;  3FWL A;  2N98 A;  3KZI E;  3MUD C;  4U0F A;  4EIJ A;  2GZJ A;  3M91 A;  1E79 H;  1PPJ E;  3BCC J;  1PEM A;  5KP6 B;  1NOH A;  1RQV A;  4QKO A;  1M8O B;  3HE5 A;  2JU1 A;  3MP7 B;  2FAC A;  4GIF A;  4U7J A;  3ITK A;  1KLP A;  2L4B A;  2HPC A;  1SVF A;  1IFP A;  3KYQ A;  1SQB J;  1VQK P;  1H8A A;  2VLP A;  4XFY A;  5C39 A;  3I5C A;  3HTK B;  1LWU C;  1VDF A;  1UIX A;  3LID A;  3TGU D;  5CCG C;  2CG5 B;  3RK2 C;  2M5A A;  4AUW A;  2NZ2 A;  5CJ4 A;  2LR2 A;  1NU1 E;  3CXH D;  1URQ A;  1FS0 E;  5AVW B;  1F80 D;  2PEO A;  1DX7 A;  1FAV A;  2QJK C;  2BCC J;  2MJZ A;  3B5N B;  1LTA C;  3QH9 A;  2Q6Q A;  2Z5H A;  4Y28 J;  4BWN A;  2WTY A;  4OWF A;  1K9M Q;  2PY8 A;  2N6Z A;  2QA4 P;  3B5N D;  4ZKP A;  1UII A;  3DS4 A;  2LIU A;  4H2X C;  1PP9 J;  2H89 C;  3L70 G;  3VTP C;  3Q5P A;  2Q7C A;  4QNB A;  1CI6 B;  1NKN A;  3B4S A;  5CCG A;  2E75 B;  2FYN C;  2W6B A;  1GU4 A;  2O01 J;  3L73 G;  3G0V A;  5EW5 E;  2KOS A;  2E75 D;  2QSI A;  3FXE A;  4B86 A;  2KZJ A;  4EOT A;  2OYH C;  1NYH A;  4I6M C;  2R5B A;  3L74 D;  3CPW O;  2BEQ D;  3H1L E;  3U43 A;  2GDX A;  3USS A;  1GPJ A;  3LMO A;  2GUS A;  4UB6 H;  2FXM A;  2L5G B;  1A43 A;  5AW8 B;  1JTH B;  2EG5 A;  2K1A A;  4PH1 A;  1NTK K;  1Y47 A;  3H1J G;  4PV1 D;  3AEG C;  1HJ0 A;  3KZI H;  2W27 A;  3CCE P;  1E6J P;  1DNY A;  3AED C;  1RQU A;  1NTK G;  3L36 A;  1KIL A;  1IJD B;  1L0L D;  2YKP A;  4C7N B;  1SQX J;  1K05 A;  1VQ8 P;  4KHX A;  1BCC E;  3S1K A;  1J1D B;  2K2Q A;  1VF5 C;  3D6Z A;  2L22 A;  2ZYD A;  2LML A;  1NAF A;  3DS0 A;  2KIK A;  3SWK A;  4WY4 B;  4TT3 H;  2YO2 A;  2IZ1 A;  1JY2 O;  3TGU E;  1H0T B;  1EZV G;  4WY4 D;  2JWD A;  3A3Y B;  3WUT A;  2JBG A;  3MTU E;  2GZF A;  2XDJ A;  4H0L C;  3CXH E;  2Y0C A;  1FR2 A;  1ZV8 A;  1LTG C;  2KGD A;  2YXQ B;  1CSB A;  1E0H A;  2PAJ A;  1BSH A;  1SLQ A;  2ZT9 C;  5AVY B;  4XRQ A;  2KOD A;  1M56 D;  4HJG H;  2IYP A;  2P1J A;  3G6E P;  2K9J A;  3RL0 g;  3L75 J;  2KLU A;  1YYC A;  1M1J B;  4WBA A;  2HLO A;  1FU1 A;  1LT9 B;  1T8K A;  4N3Y B;  2VLN A;  1E5W A;  3VOP A;  3VMA A;  3L72 G;  2XZ0 D;  3CCS P;  2WPT A;  4PD4 I;  5TIS E;  4PJ0 H;  1L0N J;  3CWB J;  4DOJ A;  2O01 N;  1BSN A;  2POH A;  1HWT C;  2JO1 A;  4XFX A;  3IAO A;  1EXI A;  4IPY A;  5F2N A;  1QLE D;  2E74 C;  2WSS H;  3BAT A;  1MFT A;  3L74 E;  1JO5 A;  2GZG A;  5K5G B;  3AE6 C;  4ASW A;  2IZ0 A;  1FC2 C;  2KOQ A;  1DEB A;  1ZME C;  1GW4 A;  3CCL P;  4EDF A;  1LTI C;  2N1T B;  1L4A C;  3WMM 0;  1KQL A;  1L0L E;  3KXD A;  4U0B A;  5CHX A;  1N7S C;  2N1T D;  1OW7 A;  3QWO C;  1S9K D;  1AV1 A;  1SQQ K;  2Q3I A;  4DCK A;  3G4S P;  2X2B A;  3II6 A;  2FKW B;  2H43 A;  2EFJ A;  2CWO A;  1BGY D;  4I7Z B;  4RKU J;  1HQB A;  1SQQ G;  1XTG B;  1HH0 A;  3SFE C;  2K0D X;  1W5C E;  1ZP0 C;  3TSI A;  3C1L A;  3FXD A;  2SPZ A;  2ZYA A;  1R5L A;  4N78 D;  3B5N C;  2B87 B;  1X8Y A;  2P10 A;  1AJY A;  5TJH A;  3RGU A;  2PFX A;  4ASV A;  1M6E X;  4I1L A;  3CXH H;  1L2P A;  3EFF K;  1KYO H;  2AF8 A;  2PRR A;  1NGM B;  3O6Q B;  3HTK A;  2FYZ A;  3O8Z A;  2QRX A;  2JR8 A;  3HE4 A;  2OTL P;  2VRS A;  4LGD E;  1X79 B;  3K5B A;  4R0M A;  1FDO A;  3P8M C;  2E75 C;  1YQ3 C;  1CW5 A;  1BDD A;  1ZW0 A;  3AE5 C;  4K3A A;  1NU1 K;  2YXR B;  5APX A;  3RL0 B;  1NVO A;  1M90 Q;  2WIT A;  1IFD A;  5CBO A;  1IMQ A;  3MZW B;  3KQG A;  1Z6M A;  2KOO A;  5BS1 A;  1LTJ A;  3RL0 D;  5TIS H;  3H1K D;  2IYO A;  1JJ2 O;  2JP3 A;  5AVQ B;  3AE4 C;  1Q86 Q;  1NH4 A;  1KFM A;  1LT1 A;  3RK2 B;  3N4X A;  1OR5 A;  1CI6 A;  2K92 A;  3RK2 D;  3W68 A;  4UHP B;  3WUV A;  2XXM A;  3VN0 A;  3G1I A;  3VMY A;  1FJK A;  1ZNV A;  1NTZ J;  1J1D C;  2KB7 P;  2R3C A;  1FZB A;  2C0W A;  2PEQ A;  3VP8 A;  2A06 D;  1S9K E;  3AE3 C;  2J58 A;  2ZXE B;  4WY4 C; 
#chains in the Genus database with same CATH homology
 1Q82 Q;  3CCR P;  4XRQ A;  2OAR A;  3DS5 A;  2KOD A;  2M8N A;  1EOQ A;  3G6E P;  4U0E A;  3DPH A;  3I55 P;  3G21 A;  1VQ5 P;  3I56 P;  5JPA A;  3MGE A;  3H0D A;  3G0V A;  1PEQ A;  2XV6 A;  3CCV P;  3B5I A;  1YJ9 P;  4COP A;  3P05 A;  3CCM P;  1M6E X;  3RG6 C;  1KC8 Q;  1RO2 A;  1K8A Q;  2PEK A;  3CXC O;  3HZQ A;  1VQN P;  4U0F A;  2JYL A;  1YIT P;  5HGM A;  2PEI A;  3G1G A;  3CCS P;  2XT1 A;  2JO0 A;  2PEN A;  1VQO P;  1VQM P;  1KD1 Q;  2OTL P;  3CPW O;  1PEM A;  1VQ7 P;  1K73 Q;  2L6E A;  2BQ1 E;  3G29 A;  2M8P A;  3DTJ A;  5HGO A;  4WYM A;  1EIA A;  1A43 A;  5HGN A;  4GR6 A;  3CMA P;  2EG5 A;  1M1K Q;  4PH1 A;  1Q81 Q;  4XFX A;  1YIJ P;  1AUM A;  2E1M A;  4XRO A;  1QVF O;  4IPY A;  5F2N A;  2Z46 A;  2M8L A;  3OW2 O;  1VQL P;  1YHQ P;  1M90 Q;  4GR2 A;  3E2D A;  1A8O A;  1VQK P;  3CC7 P;  3CCQ P;  1QRJ A;  3CCE P;  1E6J P;  1M74 A;  2BHV A;  4XFY A;  1S72 P;  5BS1 A;  1YI2 P;  3HYB A;  1BAJ A;  3G28 A;  3NTE A;  3H47 A;  3CC4 P;  3CD6 P;  1JJ2 O;  5BS2 A;  4M0I A;  1VQP P;  1Q86 Q;  1VQ8 P;  2DGY A;  1M6N A;  2P9X A;  3DS1 A;  3CCL P;  1K30 A;  1VQ4 P;  3DS3 A;  1RO0 A;  4PH0 A;  1QVG O;  2QEX P;  3G71 P;  4XFZ A;  4COC A;  1N8R Q;  1Q7Y Q;  1RNI A;  5DCK A;  5F2O A;  5F2K A;  3DS0 A;  2PEJ A;  3DS2 A;  1KQS O;  2JYG A;  2BUO A;  1PEU A;  2PEO A;  1IUQ A;  3H4E A;  4U0B A;  3CCJ P;  3WBH A;  5I4T G;  1NJI Q;  1PEO A;  2XXM A;  2EIA A;  2LF4 A;  3G1I A;  1D1D A;  4U0C A;  3G4S P;  1ZMB A;  2OTJ P;  1K9M Q;  2PY8 A;  3LRY A;  3G26 A;  3CCU P;  2QA4 P;  1YJN P;  2EFJ A;  4U0A A;  3CME P;  2CWO A;  1W2B O;  1VQ6 P;  1VQ9 P;  3CC2 P;  2PEQ A;  2Z45 A;  3DS4 A;  5HGL A;  4QNB A;  1YJW P;  4U0D A;  2ONT A;  3Q20 A;  3VRL C;  3M1M A;  2PEM A;  2Z44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...