1VQ8P

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq8P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq8P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq8P02
3CCLP 3CCRP 1S72P 1KC8Q 1YIJP 3CMEP 3CXCO 1N8RQ 3CD6P 1YI2P 3CCSP 3G71P 2QA4P 3G4SP 3CCEP 1YJ9P 1VQ4P 1W2BO 1KD1Q 1VQNP 1Q82Q 3CCVP 1NJIQ 1VQ7P 3CC2P 1VQ5P 1YJNP 1VQ8P 3CCMP 3CMAP 3I55P 3G6EP 1YJWP 3I56P 1M90Q 3CCQP 1VQLP 1K8AQ 3CC4P 1VQ6P 1QVFO 1M1KQ 3CPWO 3CCJP 1KQSO 2OTLP 1Q81Q 1QVGO 1K73Q 1VQOP 1Q7YQ 1YITP 1Q86Q 1K9MQ 3CCUP 3CC7P 2OTJP 1YHQP 1JJ2O 1VQPP 1VQKP 1VQMP 2QEXP 3OW2O 1VQ9P
chains in the Genus database with same CATH superfamily
3CCRP 1S9KE 1JTHB 4HKGA 5KKZB 3WUTA 1X3OA 2IDBA 2E75C 4CPGA 3VMZA 2Z44A 3F89A 2PEOA 5DJTB 1SQPG 1NYHA 2PFXA 2KI7B 2WT7A 5TISH 2PENA 2E1MA 1JOCA 3KQGA 1URQA 3G1IA 1L0LG 1SP4A 3TSIA 5BU8B 1RQVA 1K8AQ 3A7OA 3C1LA 1VF5C 3I5CA 3FXDA 3L4FA 2BHVA 1KQLA 1NHLA 1VDFA 1S72P 1FU1A 3AE3C 2WSSH 1VF5B 2A06D 1NJIQ 1KILB 5APWA 3V2NA 3NTEA 3L75D 4WWIA 2GYKA 3M1MA 3RK2C 1KV4A 2MF4A 2NO8A 1GXGA 1M1KQ 3L73J 1M56D 2ZT9D 5KLVG 5B66E 3H1HG 4D6TD 2ZXEB 4EOTA 1PGQA 2BEQD 5AW5B 1KFMA 1RE4A 5AVRB 2Y0DA 1NGMB 3BCCJ 2I8DA 3MD0A 3B5NA 4GT1A 1SQBG 2L6EA 3BRVB 2E74B 1NTMG 4IFFA 2WSCJ 2WZ7A 2Q3EA 3A2AA 3GW6A 1SLQA 5E79E 1FOSF 3GG2A 2WSEH 3FWLA 1PPJE 2FADA 4U0BA 1EDKA 2YO2A 3FGAD 2KK7A 3RGUA 4JPZB 2KOOA 3Q2YA 4I2LC 3CCQP 1GW4A 5GTHE 1YYCA 4UHPB 2N5IA 3GZLA 1L4AC 1N7LA 1JUNA 2KZJA 1BCCG 3VYIA 2I1KA 5APTA 2L9FA 3DS5A 3L37A 1SQXG 3CX5E 3L71D 3H1ID 2PRRA 3U43A 2LL8A 2VLOA 1CEIA 1BDCA 3GKLC 2VLNA 7CEIA 4L75A 1KILA 4R4LA 1BDDA 2NPSB 1H89A 3PP5A 3N7NA 3MUDA 1PP9E 1JY2N 3L73G 5BVZA 5TISE 1JMBA 2MY5A 1JMMA 3CCVP 4I6MC 1DD3A 1N73C 1KB9H 3BCCG 1N7SA 2Z46A 1Q81Q 3TGUE 2ZAEB 3CCUP 4H44D 2XU6A 3M9BA 3CX5I 1DX7A 2K93A 1IFNA 2M3BA 4IFDK 3CD6P 2YIUB 1IMQA 2KOQA 3L72D 1HBWA 1LT9B 4DG9A 5BS2A 1J1EB 2B87B 4U0FA 1SQQE 1YJNP 1CSBA 2FYUD 3AE9C 1EMVA 3P05A 3KDPB 1AQ5A 4EDFA 3CWBJ 3CXHH 3B8EB 2PEQA 4QMAA 3VOPA 4UB6E 2LOLA 3G4SP 4GODA 2N6ZA 2WMMA 2AEJA 1T8ZA 2WPRA 4BPFA 2KYVA 1OR5A 3AECC 1FZBA 2KSJA 1VQPP 3T97A 1K05A 4GKGA 5APXA 5B5EH 1BGYD 1ZNVA 2NPSA 2JDIH 1T8KA 2LKIA 1FBMA 1LP1B 1ZRTD 1NTKD 2H8PD 4H2XC 4JQ0D 5C39A 1L0LE 2VRSA 2JU1A 2RH0A 2LIUA 3VN0A 1R8EA 2L4BA 1DEBA 1M7LA 3VP9A 3EFGA 3H1JE 2MR7A 3EJEA 3HD7D 4QKOA 1HF9A 1VQ4P 2QJYC 3HTKA 2L22A 2HG5D 3V4WA 2FVAA 3I55P 4TT3H 1LT9A 2KS1B 3L70G 2NRGA 2B87A 1M8OB 3AEGC 1SQVE 4LGDE 1SQPD 4GR2A 1PGPA 3G0VA 2OTKE 5KAIH 2PEKA 2YO3A 4HYTB 3G1GA 4PJ0H 2G8YA 2YKOA 2GZJA 5BS1A 4EIJA 1NTME 3Q20A 1T3UA 1GTWA 1YBKA 1VF5D 2POHA 2Q9IA 1KB9E 1SFCA 4IZ6A 3V4QA 1LT1A 3M9HA 2IBZG 3IF4A 1IFMA 3AE7C 3SSUA 1GU4A 1FZFA 1OXZA 2Z5IA 2ROQA 2GDYA 1EQ7A 2K9YA 1RF0A 3IAOA 4XFJA 2OTJP 3WU2H 3TDKA 5AW4B 1BCCE 4L74A 2GZIA 1BSHA 3CXHE 4MRTC 3IR9A 3E2DA 1CW5A 1SQXE 1P84H 1YTZI 2QG4A 1QL2A 2FQ1A 5KLIC 1KQSO 1PEUA 2YXQB 5EJDA 1M6EX 1SQBD 1PEOA 2KGDA 1U7JA 1HVVA 2B89A 2N1TA 3Q5SA 1E0HA 4PD4E 1KYOI 5KLIB 1L0IA 4IFMA 3CC2P 2X2BA 5KJ7C 1S3JA 5B5EE 2K37A 3RBZA 3KPEA 1FZGA 2O1KA 4JYCA 1RO0A 3GF3A 3MHVA 3KXDA 3CXCO 1N8RQ 1L4AD 4C7RA 3S4RA 4ZKPA 2WPQA 4C46A 1PP9J 3W68A 1CI6B 2KIKA 1OFCX 1NU1E 2JQ4A 4PD4I 1H0TA 3M0AA 1UJZA 2RMZA 4XFYA 1ZP0C 3TNUB 1IUQA 3TGUJ 1W2EA 2R5DA 1JY2P 4ZKUA 3A0HE 2IPPA 3Q1MA 2N98A 2FYNC 3AEEC 3R2PA 1KFNA 3M0DC 1OX3A 1ZR2A 1SQQJ 1PPJG 1VQKP 4PJ0E 2FVFA 3DPHA 4OGQC 1IFJA 1SVFA 1FDIA 3DS4A 3PJSK 1T2KC 1EDIA 3HUSC 2M5AB 2JAZA 3RL0C 2FBWC 1W2BO 1UNKA 2EIAA 1LWUA 4YTPC 3WU2E 3AE6C 5CBNA 3I56P 1A02J 3H6PA 4K3AA 2CNRA 3D70A 2E43A 3TF5A 3U1AA 2KLVA 1GL2C 3L70E 3RL0B 2KOGA 2WSEJ 1L0LJ 1P84E 2HPCB 1IK7A 4R4MA 4M3LA 1OVRA 3U1CA 1WT6A 2QJKC 1Q82Q 3HE4A 1PFIA 1RH5B 1S5LX 3SWFA 3TGUG 1KTMA 4R0MA 1Q7YQ 1IC2A 1BXIA 2QJKB 1AV1A 3GLMA 3G29A 2W6BA 1VHNA 2CK3H 2IBZE 3LRYA 5TJHA 1SQVJ 4RO0A 1Y47A 2IZ0A 1LTIC 3PLNA 1MKMA 3H32A 4U3FG 3UIAA 1VQ6P 2MR8A 1QVGO 2ZFCA 2KB7P 1OMIA 4AUWA 3WMM0 1VQ9P 2EFJA 1SQPK 2HODA 5I4TG 3B5NC 1NTMJ 4B86A 4F37A 2ZYGA 1NQ4A 3AEBC 1RE3A 2M5AA 3HD7B 3A5TA 4QNBA 2WQYC 2YMKA 2BCCG 1L0LK 1AA0A 3CWBD 1T3JA 3Q5RA 2A06E 4BXLA 2E75B 2MVVA 2J58A 2KGAA 2N5HA 2JWDA 2IBZI 2KUBA 1FZAA 2HFED 3LW5J 2KGEA 3LMOA 1LTGC 2M8NA 2OQQA 2FFDA 1MUUA 3H1LG 2IYOA 2QVAA 3CE7A 1VL2A 2BQ1E 1BCCJ 1LNQA 2IYPA 3VRLC 1S5LE 1KQFB 3H1JG 2ZJSE 3KHUA 4TLFA 1SQXJ 2YKQA 2JWAA 2C9NY 3TYYA 5KLVK 3HYBA 1HWTC 3GHGC 1AVOA 4M0IA 3NXSA 1S9KD 2C9LY 2E42A 3FX0A 1K73Q 1FJKA 2EHTA 1JM0A 1R5LA 1S1CX 1SQBK 1SQVG 5AVSB 5AVTB 3GHGB 2H43A 3AE4C 4BPHA 1JCDA 1NTMK 1M1JC 4GOEA 1WMKA 3RK2B 2KW2A 3N4XA 1JTHA 1PEQA 4Y99C 5KP7B 4I7ZC 2BUOA 4OH8B 5KJ7D 5F2OA 3L74G 1M1JB 4CA3A 5AW6B 3VMYA 3HD7A 3BRTB 1NTZG 2FYZA 1G1JA 2ITAA 4Y99B 4I7ZB 3CCEP 2H88C 1NU1J 4H13C 3RG2A 3PH0A 4U0DA 3RL0g 1G2CB 1X22A 5AW1B 1PEMA 1SQXK 2K88A 2JKVA 4H13B 4N3YB 1KN7A 3FXEA 4NPFX 3S9OA 1NVOA 2Z4EA 1VQ7P 1PGJA 5KTBA 2VLPA 2KR5A 4COCA 4W7ZA 1L4AB 4COPA 3H1KG 1FR2A 1NWQA 2WVRA 4H2WC 5HVCA 5H2FH 1NH4A 2D2CC 1R5SA 4OGQD 3VMXA 2XNDH 2Y9YA 1VKUA 1YJWP 5AW9B 1LTAC 1FS0E 3MP7B 2EG5A 1JY3O 1E6JP 1HGZA 2KG9A 3Q3DA 3WBHA 1IO4A 3IN6A 1T2KD 2D2CB 4AQRD 2W6JH 3MGNA 4EYYQ 3B4QA 1N73B 3QWOC 3L70J 3EJDA 2PAJA 2LXCB 3RL0D 1FE6A 2PGDA 2QM7A 1QRJA 4HH2A 2GZEA 1NU1G 4U3FE 3CX5D 2LMLA 1J2JB 3V5BA 1FZCC 3JCUH 3H47A 1G2CA 1X0TA 1GL2D 2XNXA 2Y0CA 2AEMA 5GTIH 2DW3A 2YNYA 1XTGB 2JJLA 1PP9D 2OGUA 3AEFC 2AF8A 2KG6A 1JO5A 2FACA 3NTNA 2BCCE 5F2NA 3NFQA 2GA1A 1L4AA 4WY4C 2M3EA 3M06A 5HV8A 1MZ9A 2FHSC 2J59M 3TGUD 2AXTH 1OWAA 3PRJA 1USEA 2L91A 2OYIC 5AW7B 3O6QB 2R44A 1EZVG 5CCHC 3H1LE 3B5IA 2IZ1A 1BSNA 4WY4B 1L0NE 1DIPA 4H2YC 1LJ2A 1K9MQ 1SQQD 2AEFA 4I1LA 4RESB 3D71A 2QA4P 4U7JA 1FZEA 4YPCA 3V2RA 4JF7A 3EFFK 2E75D 2L5GB 1KILE 1N73A 4KJMA 3SWKA 4OWFA 2ONTA 3G21A 2RN0A 2KOSA 4BRYB 2QJYB 2IX7C 4N78E 2KP8A 1K30A 2H89C 4H0LC 1VQ5P 2N9YB 3CC4P 1LTBC 2CWOA 1MFTA 1QEXA 2KNCB 5H2FE 1VPCA 2WSFH 3L74E 1ZXGA 3H0DA 1L0LD 2Q5UA 5AW2B 4H0LB 2JYLA 1NTZE 4O9BA 2V7QH 2V4HA 1RNIA 1ZOYC 4AYCA 1DH3A 1PL5A 4PWVB 4IL6H 1GMJA 2M5RA 2FVEA 1A43A 3A3YB 1LP1A 3F5HA 3O6QA 2CQ8A 2R5BA 3RK2D 3BASA 4HKZH 2K9JB 1AJYA 4ASVA 1LTJC 2OYHC 3U59A 5AW8B 5KLVD 3JCUE 1SQVD 3H1HD 1YQ4C 2Y9ZA 4IPYA 5GTIE 2FQ2A 1U57A 2OYOA 2P10A 1KB9I 2A06G 3AE8C 1RF1C 4BWNA 4DJGA 2W6AA 3H1KE 2KS1A 1NTMD 2PP6A 4D6TG 2SPZA 4BRYA 3V2PA 1KB9D 1RF1B 2H7HA 3L35A 4H13D 5AVZB 4RKUJ 2AXTE 1OW6A 2P7JA 1EOQA 2QSIA 2KGCA 1QL1A 2KNCA 3CXHI 1AFOA 1KC8Q 1KYOD 2K5XA 2E76C 4WVZA 1N2DC 2XV6A 1BAJA 2PY8A 1ZN5A 3EJBA 2GDXA 1L0HA 1BCCD 2BEZF 3CCJP 5CHXA 2HR3A 3CXHD 2E76B 1EDLA 5EW5E 1SQXD 3RG6C 3HE5B 3CMEP 3W67A 1BE3E 3CI9A 2W8ZA 1M57D 1GU5A 5CBOA 4U0AA 1ZMBA 3D6ZA 2D2CD 1OZHA 3L36A 5CCGC 3AE5C 3L73D 4PD4D 2KODA 1KMIZ 1YITP 3L71G 3H1IG 2Q6QA 3B4SA 4UB8H 2WTYA 4XROA 5KAIE 2QIWA 3V2QA 3WUVA 3NY7B 2YXRB 1AVYA 4GIFA 5KAFH 2K92A 2E5TA 2AFDA 2K94A 4U3FJ 3BCCD 2FYNB 1Y9BA 1AYIA 3WUUA 1D7MA 2HYNA 1Z56A 1EZVE 1JEKA 1E5WA 1NAYA 4OGQB 1ZLLA 4IL6E 1X79B 5HGOA 1FDOA 1IFDA 1ZW0A 3BVHA 1EC5A 4W80A 1YJ9P 1NU1D 2XZRA 5APUA 2KLUA 2BCCJ 5DCKA 5KJ7A 3L72G 4U0CA 3HUSB 4GOFA 1MFZA 2JP3A 1H88A 2XT1A 1CI6A 2FYUG 3H1LJ 3B71A 4WBAA 5CJ0A 1L0NJ 2VSQA 1URQC 2O01N 4WY4D 3RK3E 3P8CE 1EZVI 1S2EA 3GF7A 3H1JJ 1GL2B 3TNUA 5CJ4A 1SQQK 1URQB 1Y8AA 3IFMA 2CPSA 4YXWH 1PZQA 2K0YA 3CL3D 2L0QA 2FXMA 3PTZA 2K2QA 1SS1A 4HJGH 1BGYG 2A45G 1P84I 2KZIA 3M0DA 1NTKG 2O01H 1M6NA 1HH0A 2K0XA 2K1AA 1ZMEC 4LLHA 3H4EA 4NEOA 1RE4C 1RO2A 5AVWB 2LPKA 2MVUA 2ZYAA 3L70D 3L74J 2Q7CA 1P84D 2FY8A 1M90Q 1NTZJ 3DTJA 1PV3A 3ITKA 4H0LD 4W7YA 1K04A 2B9BA 3MIWA 1Q86Q 3CX5H 4MN4C 1WRGA 3G9RA 3B5NB 4BPGA 1GK4A 2P58A 3L75E 3HUSA 3VP8A 3C9IA 4ZMDA 4UB8E 4GDOA 2N50A 4WB4A 4D6TE 2HPCA 1KLPA 2WPTA 1L0NG 1HQBA 5KAFE 1OW8A 5APVA 4EI2A 2IBZD 1M74A 1JY3N 1GL2A 1YHQP 3H25A 2JO0A 3C8VA 5KP6B 5DJUB 5EFWB 2LXBA 1GZLA 1SQVK 2A45H 3A0BH 3H1KJ 3USSA 2ERHA 1OIPA 1NO4A 1KILC 3FWNA 2PEJA 2W90A 3O8ZA 4YXDC 1HTLC 5HGNA 3MUDC 4NPEA 2LIWA 1TU3F 2KORA 1RY3A 2GUSA 2M8PA 1KD1Q 4ZNCA 1NTZK 4PV1C 1UIXA 4UB6H 3AEAC 1N7SC 4GR6A 1AF8A 2W27A 3HZQA 2E74C 3L71E 3H1IE 2JGPA 3OW2O 3PHLA 4ASWA 2P67A 4PV1B 2XZ0D 2LTEA 3E1IA 1N7SB 3VMAA 2JR8A 1EXJA 2E76D 3OA7A 2FAEA 2UWJE 1BE3J 4HB1A 4Z1MH 2Q1KA 5KP8B 5APYA 5AW0B 3S1KA 3SFDC 1Q2NA 2IFMA 1GDTA 1AUMA 2XZ1C 1GW3A 3AE1C 3L72E 2WSFJ 5CCGD 2OARA 3G26A 1JJ2O 3JSVC 2W83C 1LTTC 2FYUE 3EWKA 2NPSC 2V7QJ 3P7KA 2Z45A 1HGVA 3LIDA 1EIAA 3GHGA 1IFPA 1GXHA 2LKMA 1PPJD 2M0BA 3T97B 3MZWB 1F80D 1DD4A 1M1JA 2E5YA 1YI2P 1NU1K 1PGOA 2DNWA 2QJPC 2YIUC 1GPJA 3G6EP 2QM8A 4WYMA 1LT9C 5JPAA 3SFEC 2LR2A 3AE2C 1J1EC 2QRXA 1BGYE 1ZRTE 1IJDB 3A0BE 1JNMA 1NTKE 3HTKB 1BE3G 2QJPB 1KYOH 3LW5H 2NZ2A 1DV5A 1URQD 5AVQB 3R4YA 2WPVB 1FZCB 2JYGA 1IFIA 1NAFA 1EXIA 2KOPA 5AVVB 3GMAA 3LIEA 3E1RA 3EQ2A 4XFXA 1JCCA 2MD9A 1VQMP 5AVUB 1SFCC 3HRNA 1GK6A 2K0DX 4N6JA 1QGKB 5AVXB 3V6IA 1FAVA 2A45I 1GD2E 1HJ0A 2R3SA 1SFCB 1ACPA 1KQGB 1RF0C 1SQPE 4PD4H 2KXPB 2C0WA 1OVUA 2MKVA 2QNWA 2OYIB 1S4XA 1H8AA 4U3FD 1DNYA 1N86A 1LGHB 3GJNA 1VQNP 3B5ND 3L75J 2KWLA 2WSCH 3ABVC 3KZIH 1X8YA 2JU2A 4D6TJ 2ZVNB 1X9VA 1KORA 4PH1A 2Y0EA 2N1TC 5HGLA 2FKWB 1RHZB 2CG5B 2BCCD 2JBGA 3DS3A 4OVNF 2M8RA 1MV8A 3RK3C 4IOIH 1VQ8P 2J5UA 2KSEA 3ZDMA 2QE7H 3M91A 3BATA 2N1TB 3NMDA 3A0HH 1DEEG 1XTCC 1JY2O 2R3CA 2RKLA 5KLVE 1FZCA 3H1HE 3H1LD 2QEXP 3RK3B 1JY3P 1L0ND 2LF4A 2WITA 3II6A 3CWBG 4DOJA 5K5GB 2I1JA 2GZGA 3CMAP 1SQBE 3H1JD 1LTSC 3E7KA 1VQOP 3DS2A 1KZUB 3CC7P 1OW7A 1KILD 1HJBA 4WY4A 2N9BA 2GM4A 2O3JA 1UIIA 1FJPA 4DT0A 1HUCA 5M1BA 2Q3IA 3H1IJ 3K5BA 3L71J 2OYIA 2AFEA 2IFNA 5CCHA 1KYOE 1H0TB 1JB0J 4N78D 3CPWO 1W5CE 2P2UA 4PV1D 4JYBA 1LTJB 1N7SD 2OYHB 3L75G 2HLOA 5BU5A 4L76A 5CMZA 1RQUA 2E74D 2VLQA 1USDA 3CCSP 4RJTA 1NOHA 4KT0J 3L74D 1A8OA 2ZT9C 1NTZD 1ZR4A 2B88A 4IL6X 1QLED 2O01J 3Q5PA 4PXHB 3RBXA 3G3ZA 4PH0A 5AVYB 4U0EA 5AW3B 2ZT9B 4Y28J 3L73E 1U7MA 3L72J 1A02F 2P1JA 3DS0A 5L8RJ 1LWUC 2MJZA 4L73A 4LC1A 2XXMA 1FC2C 2FYUJ 2PNGA 2OTLP 1L2PA 3BCCE 1AQTA 3P8MC 2XV5A 1LWUB 3CCLP 1YTZT 1NKZB 2YMYA 3KZIE 2NPSD 2ZXXA 3H1KD 2K9JA 4XA4A 4XRQA 4XFZA 2EHSA 2PEMA 2GZFA 2XDJA 2CPBA 3D6YA 3HE4B 1IMPA 3DS1A 3G71P 1BGYJ 1LTJA 3QH9A 3SWYA 3TK1A 2OYHA 3KYQA 1HY8A 1NTKJ 2Z5HA 1D1DA 1Q90D 3GZMA 3MGEA 2C0XA 2DGYA 1CZQA 3CLQA 3OJAB 4C7NB 1RF1A 2FQ0A 1PIXA 2K3RA 2JB0A 2BASA 3H32B 1S5LH 2FYUK 2G3AA 1RE3C 2WWWA 2GDWA 2N6YA 2JEEA 5HGMA 1VQLP 2M8LA 1BE3D 2AXCA 1E79H 4H44C 2HODB 1T6AA 5F2KA 4NPDA 1OVVA 4A7PA 1YIJP 2JO1A 1SQPJ 1SFCD 2AVAA 2XKMA 2FFDC 2FXPA 4H44B 5B66H 2WT7B 2KG8A 2P9XA 2WPSA 1J1DC 3AEDC 3HE5A 3M9QA 2ZVOB 3P32A 3MTUE 1ZV8A 1QVFO 2FXOA 1MZ8A 5CCHD 2ZYDA 1IK9A 2PEIA 1PP9G 1Z6MA 2FFDB 2R32A 4DZOA 1J1DB 1EZVD 2CGQA 2GUVA 1NTKK 1FDMA 3CWBE 4KHXA 1QX8A 5E79H 4XE5B 5APSA 1FOSE 5CCGA 3OAKA 1YQ3C 1NKNA 1EDJA 1G1IA 4JBZA 4K35A 5GTHH 3JC22 4C7NA 1SQQG 2N1TD 5KLVJ 3H1HJ 5KKZC 3CCMP 4DCKA 5APQA 3G28A 2O1JA 3RK3D 3VTPC 3P8CD 5CZDB 1IZNB 3HD7C 2YKPA 1SQBJ 1L0NK
chains in the Genus database with same CATH topology
4U0BA 3CCRP 1KC8Q 2PEQA 1IUQA 3CCSP 3G4SP 2Z45A 3G29A 1K30A 1EIAA 1VQNP 2XV6A 1BAJA 2Z44A 3LRYA 2PY8A 1A8OA 1VQ5P 2PEOA 5HGMA 1PEQA 3CC4P 3CCQP 1VQLP 2BUOA 2CWOA 2M8LA 1VQ6P 1QRJA 3CCJP 5F2OA 1QVGO 2PEJA 2PENA 5F2KA 2E1MA 3H0DA 2OTJP 1VQPP 3H47A 5HGNA 1VQKP 3RG6C 4PH1A 2EFJA 4PH0A 1VQ9P 5HGLA 3DPHA 2JYLA 5I4TG 4U0EA 1YIJP 3CMEP 1YI2P 3G1IA 3CCEP 2M8PA 1RNIA 3DS0A 1KD1Q 3DS5A 3DS3A 4U0AA 2P9XA 3E2DA 1ZMBA 1VQ8P 3G6EP 2XXMA 4U0DA 3DS4A 1K8AQ 1A43A 4WYMA 4QNBA 5JPAA 1QVFO 2OTLP 1KQSO 1PEUA 4GR6A 2KODA 2BHVA 1M6NA 1YITP 1PEMA 2PEIA 3HZQA 1M6EX 4XROA 5F2NA 1PEOA 2QEXP 3H4EA 3OW2O 3CCLP 1S72P 2LF4A 1RO2A 1VQ4P 1W2BO 2M8NA 2EIAA 3CCVP 1NJIQ 1VQ7P 3CC2P 4COCA 3NTEA 4XRQA 4XFZA 3I55P 3CMAP 3I56P 1M90Q 3B5IA 3M1MA 4IPYA 2BQ1E 3DTJA 4COPA 2JYGA 2PEMA 1M1KQ 2Z46A 1Q81Q 1VQOP 3VRLC 1Q86Q 1K9MQ 3DS2A 3CCUP 3CC7P 4XFXA 1RO0A 5HGOA 1VQMP 3CXCO 1N8RQ 4GR2A 3CD6P 3DS1A 3G71P 3HYBA 2QA4P 1YJ9P 3G0VA 4M0IA 5BS2A 1Q82Q 4U0FA 2PEKA 5DCKA 1D1DA 1YJNP 2L6EA 3CCMP 1AUMA 3G1GA 1YJWP 3G28A 2EG5A 5BS1A 1E6JP 4U0CA 3MGEA 3CPWO 2ONTA 3P05A 3WBHA 3Q20A 1EOQA 1Q7YQ 2DGYA 1K73Q 1M74A 3G21A 2XT1A 1YHQP 2OARA 3G26A 1JJ2O 2JO0A 4XFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL P;  3CCR P;  1S72 P;  1KC8 Q;  1YIJ P;  3CME P;  3CXC O;  1N8R Q;  3CD6 P;  1YI2 P;  3CCS P;  3G71 P;  2QA4 P;  3G4S P;  3CCE P;  1YJ9 P;  1VQ4 P;  1W2B O;  1KD1 Q;  1VQN P;  1Q82 Q;  3CCV P;  1NJI Q;  1VQ7 P;  3CC2 P;  1VQ5 P;  1YJN P;  1VQ8 P;  3CCM P;  3CMA P;  3I55 P;  3G6E P;  1YJW P;  3I56 P;  1M90 Q;  3CCQ P;  1VQL P;  1K8A Q;  3CC4 P;  1VQ6 P;  1QVF O;  1M1K Q;  3CPW O;  3CCJ P;  1KQS O;  2OTL P;  1Q81 Q;  1QVG O;  1K73 Q;  1VQO P;  1Q7Y Q;  1YIT P;  1Q86 Q;  1K9M Q;  3CCU P;  3CC7 P;  2OTJ P;  1YHQ P;  1JJ2 O;  1VQP P;  1VQK P;  1VQM P;  2QEX P;  3OW2 O;  1VQ9 P; 
#chains in the Genus database with same CATH topology
 3CCR P;  1S9K E;  1JTH B;  4HKG A;  5KKZ B;  3WUT A;  1X3O A;  2IDB A;  2E75 C;  4CPG A;  3VMZ A;  2Z44 A;  3F89 A;  2PEO A;  5DJT B;  1SQP G;  1NYH A;  2PFX A;  2KI7 B;  2WT7 A;  5TIS H;  2PEN A;  2E1M A;  1JOC A;  3KQG A;  1URQ A;  3G1I A;  1L0L G;  1SP4 A;  3TSI A;  5BU8 B;  1RQV A;  1K8A Q;  3A7O A;  3C1L A;  1VF5 C;  3I5C A;  3FXD A;  3L4F A;  2BHV A;  1KQL A;  1NHL A;  1VDF A;  1S72 P;  1FU1 A;  3AE3 C;  2WSS H;  1VF5 B;  2A06 D;  1NJI Q;  1KIL B;  5APW A;  3V2N A;  3NTE A;  3L75 D;  4WWI A;  2GYK A;  3M1M A;  3RK2 C;  1KV4 A;  2MF4 A;  2NO8 A;  1GXG A;  1M1K Q;  3L73 J;  1M56 D;  2ZT9 D;  5KLV G;  5B66 E;  3H1H G;  4D6T D;  2ZXE B;  4EOT A;  1PGQ A;  2BEQ D;  5AW5 B;  1KFM A;  1RE4 A;  5AVR B;  2Y0D A;  1NGM B;  3BCC J;  2I8D A;  3MD0 A;  3B5N A;  4GT1 A;  1SQB G;  2L6E A;  3BRV B;  2E74 B;  1NTM G;  4IFF A;  2WSC J;  2WZ7 A;  2Q3E A;  3A2A A;  3GW6 A;  1SLQ A;  5E79 E;  1FOS F;  3GG2 A;  2WSE H;  3FWL A;  1PPJ E;  2FAD A;  4U0B A;  1EDK A;  2YO2 A;  3FGA D;  2KK7 A;  3RGU A;  4JPZ B;  2KOO A;  3Q2Y A;  4I2L C;  3CCQ P;  1GW4 A;  5GTH E;  1YYC A;  4UHP B;  2N5I A;  3GZL A;  1L4A C;  1N7L A;  1JUN A;  2KZJ A;  1BCC G;  3VYI A;  2I1K A;  5APT A;  2L9F A;  3DS5 A;  3L37 A;  1SQX G;  3CX5 E;  3L71 D;  3H1I D;  2PRR A;  3U43 A;  2LL8 A;  2VLO A;  1CEI A;  1BDC A;  3GKL C;  2VLN A;  7CEI A;  4L75 A;  1KIL A;  4R4L A;  1BDD A;  2NPS B;  1H89 A;  3PP5 A;  3N7N A;  3MUD A;  1PP9 E;  1JY2 N;  3L73 G;  5BVZ A;  5TIS E;  1JMB A;  2MY5 A;  1JMM A;  3CCV P;  4I6M C;  1DD3 A;  1N73 C;  1KB9 H;  3BCC G;  1N7S A;  2Z46 A;  1Q81 Q;  3TGU E;  2ZAE B;  3CCU P;  4H44 D;  2XU6 A;  3M9B A;  3CX5 I;  1DX7 A;  2K93 A;  1IFN A;  2M3B A;  4IFD K;  3CD6 P;  2YIU B;  1IMQ A;  2KOQ A;  3L72 D;  1HBW A;  1LT9 B;  4DG9 A;  5BS2 A;  1J1E B;  2B87 B;  4U0F A;  1SQQ E;  1YJN P;  1CSB A;  2FYU D;  3AE9 C;  1EMV A;  3P05 A;  3KDP B;  1AQ5 A;  4EDF A;  3CWB J;  3CXH H;  3B8E B;  2PEQ A;  4QMA A;  3VOP A;  4UB6 E;  2LOL A;  3G4S P;  4GOD A;  2N6Z A;  2WMM A;  2AEJ A;  1T8Z A;  2WPR A;  4BPF A;  2KYV A;  1OR5 A;  3AEC C;  1FZB A;  2KSJ A;  1VQP P;  3T97 A;  1K05 A;  4GKG A;  5APX A;  5B5E H;  1BGY D;  1ZNV A;  2NPS A;  2JDI H;  1T8K A;  2LKI A;  1FBM A;  1LP1 B;  1ZRT D;  1NTK D;  2H8P D;  4H2X C;  4JQ0 D;  5C39 A;  1L0L E;  2VRS A;  2JU1 A;  2RH0 A;  2LIU A;  3VN0 A;  1R8E A;  2L4B A;  1DEB A;  1M7L A;  3VP9 A;  3EFG A;  3H1J E;  2MR7 A;  3EJE A;  3HD7 D;  4QKO A;  1HF9 A;  1VQ4 P;  2QJY C;  3HTK A;  2L22 A;  2HG5 D;  3V4W A;  2FVA A;  3I55 P;  4TT3 H;  1LT9 A;  2KS1 B;  3L70 G;  2NRG A;  2B87 A;  1M8O B;  3AEG C;  1SQV E;  4LGD E;  1SQP D;  4GR2 A;  1PGP A;  3G0V A;  2OTK E;  5KAI H;  2PEK A;  2YO3 A;  4HYT B;  3G1G A;  4PJ0 H;  2G8Y A;  2YKO A;  2GZJ A;  5BS1 A;  4EIJ A;  1NTM E;  3Q20 A;  1T3U A;  1GTW A;  1YBK A;  1VF5 D;  2POH A;  2Q9I A;  1KB9 E;  1SFC A;  4IZ6 A;  3V4Q A;  1LT1 A;  3M9H A;  2IBZ G;  3IF4 A;  1IFM A;  3AE7 C;  3SSU A;  1GU4 A;  1FZF A;  1OXZ A;  2Z5I A;  2ROQ A;  2GDY A;  1EQ7 A;  2K9Y A;  1RF0 A;  3IAO A;  4XFJ A;  2OTJ P;  3WU2 H;  3TDK A;  5AW4 B;  1BCC E;  4L74 A;  2GZI A;  1BSH A;  3CXH E;  4MRT C;  3IR9 A;  3E2D A;  1CW5 A;  1SQX E;  1P84 H;  1YTZ I;  2QG4 A;  1QL2 A;  2FQ1 A;  5KLI C;  1KQS O;  1PEU A;  2YXQ B;  5EJD A;  1M6E X;  1SQB D;  1PEO A;  2KGD A;  1U7J A;  1HVV A;  2B89 A;  2N1T A;  3Q5S A;  1E0H A;  4PD4 E;  1KYO I;  5KLI B;  1L0I A;  4IFM A;  3CC2 P;  2X2B A;  5KJ7 C;  1S3J A;  5B5E E;  2K37 A;  3RBZ A;  3KPE A;  1FZG A;  2O1K A;  4JYC A;  1RO0 A;  3GF3 A;  3MHV A;  3KXD A;  3CXC O;  1N8R Q;  1L4A D;  4C7R A;  3S4R A;  4ZKP A;  2WPQ A;  4C46 A;  1PP9 J;  3W68 A;  1CI6 B;  2KIK A;  1OFC X;  1NU1 E;  2JQ4 A;  4PD4 I;  1H0T A;  3M0A A;  1UJZ A;  2RMZ A;  4XFY A;  1ZP0 C;  3TNU B;  1IUQ A;  3TGU J;  1W2E A;  2R5D A;  1JY2 P;  4ZKU A;  3A0H E;  2IPP A;  3Q1M A;  2N98 A;  2FYN C;  3AEE C;  3R2P A;  1KFN A;  3M0D C;  1OX3 A;  1ZR2 A;  1SQQ J;  1PPJ G;  1VQK P;  4PJ0 E;  2FVF A;  3DPH A;  4OGQ C;  1IFJ A;  1SVF A;  1FDI A;  3DS4 A;  3PJS K;  1T2K C;  1EDI A;  3HUS C;  2M5A B;  2JAZ A;  3RL0 C;  2FBW C;  1W2B O;  1UNK A;  2EIA A;  1LWU A;  4YTP C;  3WU2 E;  3AE6 C;  5CBN A;  3I56 P;  1A02 J;  3H6P A;  4K3A A;  2CNR A;  3D70 A;  2E43 A;  3TF5 A;  3U1A A;  2KLV A;  1GL2 C;  3L70 E;  3RL0 B;  2KOG A;  2WSE J;  1L0L J;  1P84 E;  2HPC B;  1IK7 A;  4R4M A;  4M3L A;  1OVR A;  3U1C A;  1WT6 A;  2QJK C;  1Q82 Q;  3HE4 A;  1PFI A;  1RH5 B;  1S5L X;  3SWF A;  3TGU G;  1KTM A;  4R0M A;  1Q7Y Q;  1IC2 A;  1BXI A;  2QJK B;  1AV1 A;  3GLM A;  3G29 A;  2W6B A;  1VHN A;  2CK3 H;  2IBZ E;  3LRY A;  5TJH A;  1SQV J;  4RO0 A;  1Y47 A;  2IZ0 A;  1LTI C;  3PLN A;  1MKM A;  3H32 A;  4U3F G;  3UIA A;  1VQ6 P;  2MR8 A;  1QVG O;  2ZFC A;  2KB7 P;  1OMI A;  4AUW A;  3WMM 0;  1VQ9 P;  2EFJ A;  1SQP K;  2HOD A;  5I4T G;  3B5N C;  1NTM J;  4B86 A;  4F37 A;  2ZYG A;  1NQ4 A;  3AEB C;  1RE3 A;  2M5A A;  3HD7 B;  3A5T A;  4QNB A;  2WQY C;  2YMK A;  2BCC G;  1L0L K;  1AA0 A;  3CWB D;  1T3J A;  3Q5R A;  2A06 E;  4BXL A;  2E75 B;  2MVV A;  2J58 A;  2KGA A;  2N5H A;  2JWD A;  2IBZ I;  2KUB A;  1FZA A;  2HFE D;  3LW5 J;  2KGE A;  3LMO A;  1LTG C;  2M8N A;  2OQQ A;  2FFD A;  1MUU A;  3H1L G;  2IYO A;  2QVA A;  3CE7 A;  1VL2 A;  2BQ1 E;  1BCC J;  1LNQ A;  2IYP A;  3VRL C;  1S5L E;  1KQF B;  3H1J G;  2ZJS E;  3KHU A;  4TLF A;  1SQX J;  2YKQ A;  2JWA A;  2C9N Y;  3TYY A;  5KLV K;  3HYB A;  1HWT C;  3GHG C;  1AVO A;  4M0I A;  3NXS A;  1S9K D;  2C9L Y;  2E42 A;  3FX0 A;  1K73 Q;  1FJK A;  2EHT A;  1JM0 A;  1R5L A;  1S1C X;  1SQB K;  1SQV G;  5AVS B;  5AVT B;  3GHG B;  2H43 A;  3AE4 C;  4BPH A;  1JCD A;  1NTM K;  1M1J C;  4GOE A;  1WMK A;  3RK2 B;  2KW2 A;  3N4X A;  1JTH A;  1PEQ A;  4Y99 C;  5KP7 B;  4I7Z C;  2BUO A;  4OH8 B;  5KJ7 D;  5F2O A;  3L74 G;  1M1J B;  4CA3 A;  5AW6 B;  3VMY A;  3HD7 A;  3BRT B;  1NTZ G;  2FYZ A;  1G1J A;  2ITA A;  4Y99 B;  4I7Z B;  3CCE P;  2H88 C;  1NU1 J;  4H13 C;  3RG2 A;  3PH0 A;  4U0D A;  3RL0 g;  1G2C B;  1X22 A;  5AW1 B;  1PEM A;  1SQX K;  2K88 A;  2JKV A;  4H13 B;  4N3Y B;  1KN7 A;  3FXE A;  4NPF X;  3S9O A;  1NVO A;  2Z4E A;  1VQ7 P;  1PGJ A;  5KTB A;  2VLP A;  2KR5 A;  4COC A;  4W7Z A;  1L4A B;  4COP A;  3H1K G;  1FR2 A;  1NWQ A;  2WVR A;  4H2W C;  5HVC A;  5H2F H;  1NH4 A;  2D2C C;  1R5S A;  4OGQ D;  3VMX A;  2XND H;  2Y9Y A;  1VKU A;  1YJW P;  5AW9 B;  1LTA C;  1FS0 E;  3MP7 B;  2EG5 A;  1JY3 O;  1E6J P;  1HGZ A;  2KG9 A;  3Q3D A;  3WBH A;  1IO4 A;  3IN6 A;  1T2K D;  2D2C B;  4AQR D;  2W6J H;  3MGN A;  4EYY Q;  3B4Q A;  1N73 B;  3QWO C;  3L70 J;  3EJD A;  2PAJ A;  2LXC B;  3RL0 D;  1FE6 A;  2PGD A;  2QM7 A;  1QRJ A;  4HH2 A;  2GZE A;  1NU1 G;  4U3F E;  3CX5 D;  2LML A;  1J2J B;  3V5B A;  1FZC C;  3JCU H;  3H47 A;  1G2C A;  1X0T A;  1GL2 D;  2XNX A;  2Y0C A;  2AEM A;  5GTI H;  2DW3 A;  2YNY A;  1XTG B;  2JJL A;  1PP9 D;  2OGU A;  3AEF C;  2AF8 A;  2KG6 A;  1JO5 A;  2FAC A;  3NTN A;  2BCC E;  5F2N A;  3NFQ A;  2GA1 A;  1L4A A;  4WY4 C;  2M3E A;  3M06 A;  5HV8 A;  1MZ9 A;  2FHS C;  2J59 M;  3TGU D;  2AXT H;  1OWA A;  3PRJ A;  1USE A;  2L91 A;  2OYI C;  5AW7 B;  3O6Q B;  2R44 A;  1EZV G;  5CCH C;  3H1L E;  3B5I A;  2IZ1 A;  1BSN A;  4WY4 B;  1L0N E;  1DIP A;  4H2Y C;  1LJ2 A;  1K9M Q;  1SQQ D;  2AEF A;  4I1L A;  4RES B;  3D71 A;  2QA4 P;  4U7J A;  1FZE A;  4YPC A;  3V2R A;  4JF7 A;  3EFF K;  2E75 D;  2L5G B;  1KIL E;  1N73 A;  4KJM A;  3SWK A;  4OWF A;  2ONT A;  3G21 A;  2RN0 A;  2KOS A;  4BRY B;  2QJY B;  2IX7 C;  4N78 E;  2KP8 A;  1K30 A;  2H89 C;  4H0L C;  1VQ5 P;  2N9Y B;  3CC4 P;  1LTB C;  2CWO A;  1MFT A;  1QEX A;  2KNC B;  5H2F E;  1VPC A;  2WSF H;  3L74 E;  1ZXG A;  3H0D A;  1L0L D;  2Q5U A;  5AW2 B;  4H0L B;  2JYL A;  1NTZ E;  4O9B A;  2V7Q H;  2V4H A;  1RNI A;  1ZOY C;  4AYC A;  1DH3 A;  1PL5 A;  4PWV B;  4IL6 H;  1GMJ A;  2M5R A;  2FVE A;  1A43 A;  3A3Y B;  1LP1 A;  3F5H A;  3O6Q A;  2CQ8 A;  2R5B A;  3RK2 D;  3BAS A;  4HKZ H;  2K9J B;  1AJY A;  4ASV A;  1LTJ C;  2OYH C;  3U59 A;  5AW8 B;  5KLV D;  3JCU E;  1SQV D;  3H1H D;  1YQ4 C;  2Y9Z A;  4IPY A;  5GTI E;  2FQ2 A;  1U57 A;  2OYO A;  2P10 A;  1KB9 I;  2A06 G;  3AE8 C;  1RF1 C;  4BWN A;  4DJG A;  2W6A A;  3H1K E;  2KS1 A;  1NTM D;  2PP6 A;  4D6T G;  2SPZ A;  4BRY A;  3V2P A;  1KB9 D;  1RF1 B;  2H7H A;  3L35 A;  4H13 D;  5AVZ B;  4RKU J;  2AXT E;  1OW6 A;  2P7J A;  1EOQ A;  2QSI A;  2KGC A;  1QL1 A;  2KNC A;  3CXH I;  1AFO A;  1KC8 Q;  1KYO D;  2K5X A;  2E76 C;  4WVZ A;  1N2D C;  2XV6 A;  1BAJ A;  2PY8 A;  1ZN5 A;  3EJB A;  2GDX A;  1L0H A;  1BCC D;  2BEZ F;  3CCJ P;  5CHX A;  2HR3 A;  3CXH D;  2E76 B;  1EDL A;  5EW5 E;  1SQX D;  3RG6 C;  3HE5 B;  3CME P;  3W67 A;  1BE3 E;  3CI9 A;  2W8Z A;  1M57 D;  1GU5 A;  5CBO A;  4U0A A;  1ZMB A;  3D6Z A;  2D2C D;  1OZH A;  3L36 A;  5CCG C;  3AE5 C;  3L73 D;  4PD4 D;  2KOD A;  1KMI Z;  1YIT P;  3L71 G;  3H1I G;  2Q6Q A;  3B4S A;  4UB8 H;  2WTY A;  4XRO A;  5KAI E;  2QIW A;  3V2Q A;  3WUV A;  3NY7 B;  2YXR B;  1AVY A;  4GIF A;  5KAF H;  2K92 A;  2E5T A;  2AFD A;  2K94 A;  4U3F J;  3BCC D;  2FYN B;  1Y9B A;  1AYI A;  3WUU A;  1D7M A;  2HYN A;  1Z56 A;  1EZV E;  1JEK A;  1E5W A;  1NAY A;  4OGQ B;  1ZLL A;  4IL6 E;  1X79 B;  5HGO A;  1FDO A;  1IFD A;  1ZW0 A;  3BVH A;  1EC5 A;  4W80 A;  1YJ9 P;  1NU1 D;  2XZR A;  5APU A;  2KLU A;  2BCC J;  5DCK A;  5KJ7 A;  3L72 G;  4U0C A;  3HUS B;  4GOF A;  1MFZ A;  2JP3 A;  1H88 A;  2XT1 A;  1CI6 A;  2FYU G;  3H1L J;  3B71 A;  4WBA A;  5CJ0 A;  1L0N J;  2VSQ A;  1URQ C;  2O01 N;  4WY4 D;  3RK3 E;  3P8C E;  1EZV I;  1S2E A;  3GF7 A;  3H1J J;  1GL2 B;  3TNU A;  5CJ4 A;  1SQQ K;  1URQ B;  1Y8A A;  3IFM A;  2CPS A;  4YXW H;  1PZQ A;  2K0Y A;  3CL3 D;  2L0Q A;  2FXM A;  3PTZ A;  2K2Q A;  1SS1 A;  4HJG H;  1BGY G;  2A45 G;  1P84 I;  2KZI A;  3M0D A;  1NTK G;  2O01 H;  1M6N A;  1HH0 A;  2K0X A;  2K1A A;  1ZME C;  4LLH A;  3H4E A;  4NEO A;  1RE4 C;  1RO2 A;  5AVW B;  2LPK A;  2MVU A;  2ZYA A;  3L70 D;  3L74 J;  2Q7C A;  1P84 D;  2FY8 A;  1M90 Q;  1NTZ J;  3DTJ A;  1PV3 A;  3ITK A;  4H0L D;  4W7Y A;  1K04 A;  2B9B A;  3MIW A;  1Q86 Q;  3CX5 H;  4MN4 C;  1WRG A;  3G9R A;  3B5N B;  4BPG A;  1GK4 A;  2P58 A;  3L75 E;  3HUS A;  3VP8 A;  3C9I A;  4ZMD A;  4UB8 E;  4GDO A;  2N50 A;  4WB4 A;  4D6T E;  2HPC A;  1KLP A;  2WPT A;  1L0N G;  1HQB A;  5KAF E;  1OW8 A;  5APV A;  4EI2 A;  2IBZ D;  1M74 A;  1JY3 N;  1GL2 A;  1YHQ P;  3H25 A;  2JO0 A;  3C8V A;  5KP6 B;  5DJU B;  5EFW B;  2LXB A;  1GZL A;  1SQV K;  2A45 H;  3A0B H;  3H1K J;  3USS A;  2ERH A;  1OIP A;  1NO4 A;  1KIL C;  3FWN A;  2PEJ A;  2W90 A;  3O8Z A;  4YXD C;  1HTL C;  5HGN A;  3MUD C;  4NPE A;  2LIW A;  1TU3 F;  2KOR A;  1RY3 A;  2GUS A;  2M8P A;  1KD1 Q;  4ZNC A;  1NTZ K;  4PV1 C;  1UIX A;  4UB6 H;  3AEA C;  1N7S C;  4GR6 A;  1AF8 A;  2W27 A;  3HZQ A;  2E74 C;  3L71 E;  3H1I E;  2JGP A;  3OW2 O;  3PHL A;  4ASW A;  2P67 A;  4PV1 B;  2XZ0 D;  2LTE A;  3E1I A;  1N7S B;  3VMA A;  2JR8 A;  1EXJ A;  2E76 D;  3OA7 A;  2FAE A;  2UWJ E;  1BE3 J;  4HB1 A;  4Z1M H;  2Q1K A;  5KP8 B;  5APY A;  5AW0 B;  3S1K A;  3SFD C;  1Q2N A;  2IFM A;  1GDT A;  1AUM A;  2XZ1 C;  1GW3 A;  3AE1 C;  3L72 E;  2WSF J;  5CCG D;  2OAR A;  3G26 A;  1JJ2 O;  3JSV C;  2W83 C;  1LTT C;  2FYU E;  3EWK A;  2NPS C;  2V7Q J;  3P7K A;  2Z45 A;  1HGV A;  3LID A;  1EIA A;  3GHG A;  1IFP A;  1GXH A;  2LKM A;  1PPJ D;  2M0B A;  3T97 B;  3MZW B;  1F80 D;  1DD4 A;  1M1J A;  2E5Y A;  1YI2 P;  1NU1 K;  1PGO A;  2DNW A;  2QJP C;  2YIU C;  1GPJ A;  3G6E P;  2QM8 A;  4WYM A;  1LT9 C;  5JPA A;  3SFE C;  2LR2 A;  3AE2 C;  1J1E C;  2QRX A;  1BGY E;  1ZRT E;  1IJD B;  3A0B E;  1JNM A;  1NTK E;  3HTK B;  1BE3 G;  2QJP B;  1KYO H;  3LW5 H;  2NZ2 A;  1DV5 A;  1URQ D;  5AVQ B;  3R4Y A;  2WPV B;  1FZC B;  2JYG A;  1IFI A;  1NAF A;  1EXI A;  2KOP A;  5AVV B;  3GMA A;  3LIE A;  3E1R A;  3EQ2 A;  4XFX A;  1JCC A;  2MD9 A;  1VQM P;  5AVU B;  1SFC C;  3HRN A;  1GK6 A;  2K0D X;  4N6J A;  1QGK B;  5AVX B;  3V6I A;  1FAV A;  2A45 I;  1GD2 E;  1HJ0 A;  2R3S A;  1SFC B;  1ACP A;  1KQG B;  1RF0 C;  1SQP E;  4PD4 H;  2KXP B;  2C0W A;  1OVU A;  2MKV A;  2QNW A;  2OYI B;  1S4X A;  1H8A A;  4U3F D;  1DNY A;  1N86 A;  1LGH B;  3GJN A;  1VQN P;  3B5N D;  3L75 J;  2KWL A;  2WSC H;  3ABV C;  3KZI H;  1X8Y A;  2JU2 A;  4D6T J;  2ZVN B;  1X9V A;  1KOR A;  4PH1 A;  2Y0E A;  2N1T C;  5HGL A;  2FKW B;  1RHZ B;  2CG5 B;  2BCC D;  2JBG A;  3DS3 A;  4OVN F;  2M8R A;  1MV8 A;  3RK3 C;  4IOI H;  1VQ8 P;  2J5U A;  2KSE A;  3ZDM A;  2QE7 H;  3M91 A;  3BAT A;  2N1T B;  3NMD A;  3A0H H;  1DEE G;  1XTC C;  1JY2 O;  2R3C A;  2RKL A;  5KLV E;  1FZC A;  3H1H E;  3H1L D;  2QEX P;  3RK3 B;  1JY3 P;  1L0N D;  2LF4 A;  2WIT A;  3II6 A;  3CWB G;  4DOJ A;  5K5G B;  2I1J A;  2GZG A;  3CMA P;  1SQB E;  3H1J D;  1LTS C;  3E7K A;  1VQO P;  3DS2 A;  1KZU B;  3CC7 P;  1OW7 A;  1KIL D;  1HJB A;  4WY4 A;  2N9B A;  2GM4 A;  2O3J A;  1UII A;  1FJP A;  4DT0 A;  1HUC A;  5M1B A;  2Q3I A;  3H1I J;  3K5B A;  3L71 J;  2OYI A;  2AFE A;  2IFN A;  5CCH A;  1KYO E;  1H0T B;  1JB0 J;  4N78 D;  3CPW O;  1W5C E;  2P2U A;  4PV1 D;  4JYB A;  1LTJ B;  1N7S D;  2OYH B;  3L75 G;  2HLO A;  5BU5 A;  4L76 A;  5CMZ A;  1RQU A;  2E74 D;  2VLQ A;  1USD A;  3CCS P;  4RJT A;  1NOH A;  4KT0 J;  3L74 D;  1A8O A;  2ZT9 C;  1NTZ D;  1ZR4 A;  2B88 A;  4IL6 X;  1QLE D;  2O01 J;  3Q5P A;  4PXH B;  3RBX A;  3G3Z A;  4PH0 A;  5AVY B;  4U0E A;  5AW3 B;  2ZT9 B;  4Y28 J;  3L73 E;  1U7M A;  3L72 J;  1A02 F;  2P1J A;  3DS0 A;  5L8R J;  1LWU C;  2MJZ A;  4L73 A;  4LC1 A;  2XXM A;  1FC2 C;  2FYU J;  2PNG A;  2OTL P;  1L2P A;  3BCC E;  1AQT A;  3P8M C;  2XV5 A;  1LWU B;  3CCL P;  1YTZ T;  1NKZ B;  2YMY A;  3KZI E;  2NPS D;  2ZXX A;  3H1K D;  2K9J A;  4XA4 A;  4XRQ A;  4XFZ A;  2EHS A;  2PEM A;  2GZF A;  2XDJ A;  2CPB A;  3D6Y A;  3HE4 B;  1IMP A;  3DS1 A;  3G71 P;  1BGY J;  1LTJ A;  3QH9 A;  3SWY A;  3TK1 A;  2OYH A;  3KYQ A;  1HY8 A;  1NTK J;  2Z5H A;  1D1D A;  1Q90 D;  3GZM A;  3MGE A;  2C0X A;  2DGY A;  1CZQ A;  3CLQ A;  3OJA B;  4C7N B;  1RF1 A;  2FQ0 A;  1PIX A;  2K3R A;  2JB0 A;  2BAS A;  3H32 B;  1S5L H;  2FYU K;  2G3A A;  1RE3 C;  2WWW A;  2GDW A;  2N6Y A;  2JEE A;  5HGM A;  1VQL P;  2M8L A;  1BE3 D;  2AXC A;  1E79 H;  4H44 C;  2HOD B;  1T6A A;  5F2K A;  4NPD A;  1OVV A;  4A7P A;  1YIJ P;  2JO1 A;  1SQP J;  1SFC D;  2AVA A;  2XKM A;  2FFD C;  2FXP A;  4H44 B;  5B66 H;  2WT7 B;  2KG8 A;  2P9X A;  2WPS A;  1J1D C;  3AED C;  3HE5 A;  3M9Q A;  2ZVO B;  3P32 A;  3MTU E;  1ZV8 A;  1QVF O;  2FXO A;  1MZ8 A;  5CCH D;  2ZYD A;  1IK9 A;  2PEI A;  1PP9 G;  1Z6M A;  2FFD B;  2R32 A;  4DZO A;  1J1D B;  1EZV D;  2CGQ A;  2GUV A;  1NTK K;  1FDM A;  3CWB E;  4KHX A;  1QX8 A;  5E79 H;  4XE5 B;  5APS A;  1FOS E;  5CCG A;  3OAK A;  1YQ3 C;  1NKN A;  1EDJ A;  1G1I A;  4JBZ A;  4K35 A;  5GTH H;  3JC2 2;  4C7N A;  1SQQ G;  2N1T D;  5KLV J;  3H1H J;  5KKZ C;  3CCM P;  4DCK A;  5APQ A;  3G28 A;  2O1J A;  3RK3 D;  3VTP C;  3P8C D;  5CZD B;  1IZN B;  3HD7 C;  2YKP A;  1SQB J;  1L0N K; 
#chains in the Genus database with same CATH homology
 4U0B A;  3CCR P;  1KC8 Q;  2PEQ A;  1IUQ A;  3CCS P;  3G4S P;  2Z45 A;  3G29 A;  1K30 A;  1EIA A;  1VQN P;  2XV6 A;  1BAJ A;  2Z44 A;  3LRY A;  2PY8 A;  1A8O A;  1VQ5 P;  2PEO A;  5HGM A;  1PEQ A;  3CC4 P;  3CCQ P;  1VQL P;  2BUO A;  2CWO A;  2M8L A;  1VQ6 P;  1QRJ A;  3CCJ P;  5F2O A;  1QVG O;  2PEJ A;  2PEN A;  5F2K A;  2E1M A;  3H0D A;  2OTJ P;  1VQP P;  3H47 A;  5HGN A;  1VQK P;  3RG6 C;  4PH1 A;  2EFJ A;  4PH0 A;  1VQ9 P;  5HGL A;  3DPH A;  2JYL A;  5I4T G;  4U0E A;  1YIJ P;  3CME P;  1YI2 P;  3G1I A;  3CCE P;  2M8P A;  1RNI A;  3DS0 A;  1KD1 Q;  3DS5 A;  3DS3 A;  4U0A A;  2P9X A;  3E2D A;  1ZMB A;  1VQ8 P;  3G6E P;  2XXM A;  4U0D A;  3DS4 A;  1K8A Q;  1A43 A;  4WYM A;  4QNB A;  5JPA A;  1QVF O;  2OTL P;  1KQS O;  1PEU A;  4GR6 A;  2KOD A;  2BHV A;  1M6N A;  1YIT P;  1PEM A;  2PEI A;  3HZQ A;  1M6E X;  4XRO A;  5F2N A;  1PEO A;  2QEX P;  3H4E A;  3OW2 O;  3CCL P;  1S72 P;  2LF4 A;  1RO2 A;  1VQ4 P;  1W2B O;  2M8N A;  2EIA A;  3CCV P;  1NJI Q;  1VQ7 P;  3CC2 P;  4COC A;  3NTE A;  4XRQ A;  4XFZ A;  3I55 P;  3CMA P;  3I56 P;  1M90 Q;  3B5I A;  3M1M A;  4IPY A;  2BQ1 E;  3DTJ A;  4COP A;  2JYG A;  2PEM A;  1M1K Q;  2Z46 A;  1Q81 Q;  1VQO P;  3VRL C;  1Q86 Q;  1K9M Q;  3DS2 A;  3CCU P;  3CC7 P;  4XFX A;  1RO0 A;  5HGO A;  1VQM P;  3CXC O;  1N8R Q;  4GR2 A;  3CD6 P;  3DS1 A;  3G71 P;  3HYB A;  2QA4 P;  1YJ9 P;  3G0V A;  4M0I A;  5BS2 A;  1Q82 Q;  4U0F A;  2PEK A;  5DCK A;  1D1D A;  1YJN P;  2L6E A;  3CCM P;  1AUM A;  3G1G A;  1YJW P;  3G28 A;  2EG5 A;  5BS1 A;  1E6J P;  4U0C A;  3MGE A;  3CPW O;  2ONT A;  3P05 A;  3WBH A;  3Q20 A;  1EOQ A;  1Q7Y Q;  2DGY A;  1K73 Q;  1M74 A;  3G21 A;  2XT1 A;  1YHQ P;  2OAR A;  3G26 A;  1JJ2 O;  2JO0 A;  4XFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...