2GZIA

Crystal structure of the e9 dnase domain with a mutant immunity protein im9 (v34a)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
LKHSISDYTEAEFLQLVTTICNADTSSEEELAKLVTHFEEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Complex of the Colicin E9 DNase Domain with a Mutant Immunity Protein, IM9 (V34A)
rcsb
source organism Escherichia coli k12
molecule tags Antibiotic/antibiotic inhibitor
molecule keywords Colicin-E9 immunity protein
total genus 28
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gziA00
1ZNVA 2GZFA 7CEIA 1UJZA 4QKOA 1GXGA 2VLQA 1AYIA 1BXIA 1MZ8A 2GYKA 2WPTA 2K0DX 2GZGA 2K5XA 2ERHA 2GZJA 3GJNA 3GKLC 2VLNA 1UNKA 3U43A 5EW5E 1IMPA 1FR2A 1EMVA 2JB0A 2VLPA 2JAZA 2VLOA 1IMQA 4F37A 2JBGA 4UHPB 2GZIA 1E0HA 2GZEA 1GXHA 1CEIA 2NO8A
chains in the Genus database with same CATH superfamily
2M8NA 2KODA 3B4QA 4PXHB 1BXIA 3CCLP 2JU1A 3CC2P 2OARA 2L6EA 2PEQA 4COCA 2N50A 1E6JP 2L0QA 1IMPA 1FR2A 1EMVA 3RG6C 1Q81Q 2GZEA 1ZNVA 4H2WC 2JO0A 3G28A 1YI2P 5EJDA 1QRJA 1MZ8A 1GPJA 1EIAA 2LL8A 5JPAA 1K9MQ 2VSQA 2ONTA 4U0DA 1K73Q 1HY8A 3CCVP 5KP7B 5BS2A 2ROQA 1M6EX 1CEIA 1YHQP 4GR6A 3OW2O 2LIWA 1AUMA 2GZFA 1UJZA 2FVFA 1RO0A 2VLQA 1BAJA 3WBHA 4R0MA 3GKLC 2FQ2A 3EJEA 2JYLA 3CD6P 2FADA 4XROA 2JU2A 5KP8B 2JYGA 2N98A 2QNWA 2QA4P 2PNGA 5F2NA 2KGAA 5F2KA 2KOPA 1KLPA 2CWOA 5I4TG 2PEJA 3CE7A 5HGLA 4BPFA 2FACA 4UHPB 4WYMA 2MVVA 1YJ9P 2PEKA 1VQ9P 2L9FA 4GR2A 2GDWA 1GXGA 3GJNA 2K0XA 2LKIA 2KORA 2MY5A 4XFYA 4NEOA 2FVAA 2XV6A 4CA3A 3M1MA 3B5IA 2MVUA 1KC8Q 4IZ6A 1Q7YQ 5BS1A 3MGEA 3H4EA 2CNRA 2GZGA 3CCMP 2KW2A 2M8PA 3NY7B 2LIUA 3G4SP 2VLNA 1Q82Q 2GDYA 1T8KA 2GZIA 1E0HA 4IPYA 2LMLA 2PY8A 3CCSP 3E2DA 2K5XA 1VQ7P 4U0EA 1L0HA 1UNKA 2CG5B 1W2BO 5HGMA 3G29A 2EHSA 1Z6MA 2FAEA 1K8AQ 2EIAA 3G1IA 1VQNP 2K93A 2LTEA 2X2BA 2XZ1C 3LMOA 5HGOA 2M5RA 2XT1A 1VQKP 2MR8A 2JQ4A 3GZLA 2QEXP 3DS4A 2LOLA 2JB0A 2K2QA 2AFEA 2KGEA 3CMAP 2P9XA 2XZ0D 1EOQA 1VQ8P 1VHNA 2EG5A 2FHSC 1YIJP 4PWVB 4XFZA 1YJNP 4XFXA 2KR5A 2CQ8A 2KOOA 2L4BA 4H2YC 1A8OA 5HV8A 5CZDB 1M6NA 1VQMP 1L0IA 3CCUP 3DTJA 3HYBA 3G0VA 2GDXA 1M74A 3DS3A 2XXMA 3EJBA 3CCJP 1D1DA 3CXCO 2GZJA 2CGQA 2KG8A 4BPHA 2JAZA 1VQPP 1M90Q 2DNWA 3DPHA 2NO8A 1RNIA 2N6ZA 2FQ1A 2WPTA 1VQ6P 2KGDA 1ACPA 2JGPA 3LRYA 2Z44A 2BHVA 3P05A 3H47A 2KOQA 3DS2A 2N5IA 4PH1A 1NQ4A 1VKUA 1JJ2O 7CEIA 1NJIQ 3DS5A 3G6EP 3G26A 3H0DA 1OR5A 1QVFO 2MD9A 5KP6B 2LF4A 3CC4P 1ZMBA 5HVCA 1VQOP 4XRQA 4COPA 2OTLP 4MRTC 5EW5E 4F37A 2VLOA 2EHTA 1A43A 3EJDA 2PEMA 1YITP 2AVAA 4DG9A 4M0IA 3VRLC 3CCRP 4U0FA 2K94A 2FVEA 4U0AA 3CCEP 3Q20A 2M8LA 1N8RQ 3CPWO 1M1KQ 3I55P 2EFJA 2N6YA 3NTEA 1KD1Q 2JBGA 1HQBA 5F2OA 3G71P 2KWLA 2LPKA 2MF4A 3CC7P 3DS0A 2OTJP 2DGYA 4QKOA 3G21A 2AFDA 4BPGA 1VQLP 1F80D 4U0CA 5HGNA 1VQ4P 4U0BA 2N5HA 2AF8A 3RG2A 1QVGO 3G1GA 4PH0A 4H2XC 1AYIA 2KOSA 1K30A 2K0DX 2PEOA 2PENA 2KG6A 2FQ0A 3CMEP 2Z46A 2K0YA 2L22A 2MR7A 2VLPA 3I56P 3GZMA 1KQSO 4QNBA 2KGCA 1GXHA 1S72P 1DV5A 2Z45A 1DNYA 2PEIA 4HKGA 2KG9A 1X3OA 2GYKA 2ERHA 1Q86Q 1AF8A 2K92A 1RO2A 5DCKA 1VQ5P 3U43A 3DS1A 1YJWP 1IMQA 3HZQA 1IUQA 2BUOA 2E1MA 3CCQP
chains in the Genus database with same CATH topology
1ZNVA 2GZFA 7CEIA 1UJZA 4QKOA 1GXGA 2VLQA 1AYIA 1BXIA 1MZ8A 2GYKA 2WPTA 2K0DX 2GZGA 2K5XA 2ERHA 2GZJA 3GJNA 3GKLC 2VLNA 1UNKA 3U43A 5EW5E 1IMPA 1FR2A 1EMVA 2JB0A 2VLPA 2JAZA 2VLOA 1IMQA 4F37A 2JBGA 4UHPB 2GZIA 1E0HA 2GZEA 1GXHA 1CEIA 2NO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZNV A;  2GZF A;  7CEI A;  1UJZ A;  4QKO A;  1GXG A;  2VLQ A;  1AYI A;  1BXI A;  1MZ8 A;  2GYK A;  2WPT A;  2K0D X;  2GZG A;  2K5X A;  2ERH A;  2GZJ A;  3GJN A;  3GKL C;  2VLN A;  1UNK A;  3U43 A;  5EW5 E;  1IMP A;  1FR2 A;  1EMV A;  2JB0 A;  2VLP A;  2JAZ A;  2VLO A;  1IMQ A;  4F37 A;  2JBG A;  4UHP B;  2GZI A;  1E0H A;  2GZE A;  1GXH A;  1CEI A;  2NO8 A; 
#chains in the Genus database with same CATH topology
 2M8N A;  2KOD A;  3B4Q A;  4PXH B;  1BXI A;  3CCL P;  2JU1 A;  3CC2 P;  2OAR A;  2L6E A;  2PEQ A;  4COC A;  2N50 A;  1E6J P;  2L0Q A;  1IMP A;  1FR2 A;  1EMV A;  3RG6 C;  1Q81 Q;  2GZE A;  1ZNV A;  4H2W C;  2JO0 A;  3G28 A;  1YI2 P;  5EJD A;  1QRJ A;  1MZ8 A;  1GPJ A;  1EIA A;  2LL8 A;  5JPA A;  1K9M Q;  2VSQ A;  2ONT A;  4U0D A;  1K73 Q;  1HY8 A;  3CCV P;  5KP7 B;  5BS2 A;  2ROQ A;  1M6E X;  1CEI A;  1YHQ P;  4GR6 A;  3OW2 O;  2LIW A;  1AUM A;  2GZF A;  1UJZ A;  2FVF A;  1RO0 A;  2VLQ A;  1BAJ A;  3WBH A;  4R0M A;  3GKL C;  2FQ2 A;  3EJE A;  2JYL A;  3CD6 P;  2FAD A;  4XRO A;  2JU2 A;  5KP8 B;  2JYG A;  2N98 A;  2QNW A;  2QA4 P;  2PNG A;  5F2N A;  2KGA A;  5F2K A;  2KOP A;  1KLP A;  2CWO A;  5I4T G;  2PEJ A;  3CE7 A;  5HGL A;  4BPF A;  2FAC A;  4UHP B;  4WYM A;  2MVV A;  1YJ9 P;  2PEK A;  1VQ9 P;  2L9F A;  4GR2 A;  2GDW A;  1GXG A;  3GJN A;  2K0X A;  2LKI A;  2KOR A;  2MY5 A;  4XFY A;  4NEO A;  2FVA A;  2XV6 A;  4CA3 A;  3M1M A;  3B5I A;  2MVU A;  1KC8 Q;  4IZ6 A;  1Q7Y Q;  5BS1 A;  3MGE A;  3H4E A;  2CNR A;  2GZG A;  3CCM P;  2KW2 A;  2M8P A;  3NY7 B;  2LIU A;  3G4S P;  2VLN A;  1Q82 Q;  2GDY A;  1T8K A;  2GZI A;  1E0H A;  4IPY A;  2LML A;  2PY8 A;  3CCS P;  3E2D A;  2K5X A;  1VQ7 P;  4U0E A;  1L0H A;  1UNK A;  2CG5 B;  1W2B O;  5HGM A;  3G29 A;  2EHS A;  1Z6M A;  2FAE A;  1K8A Q;  2EIA A;  3G1I A;  1VQN P;  2K93 A;  2LTE A;  2X2B A;  2XZ1 C;  3LMO A;  5HGO A;  2M5R A;  2XT1 A;  1VQK P;  2MR8 A;  2JQ4 A;  3GZL A;  2QEX P;  3DS4 A;  2LOL A;  2JB0 A;  2K2Q A;  2AFE A;  2KGE A;  3CMA P;  2P9X A;  2XZ0 D;  1EOQ A;  1VQ8 P;  1VHN A;  2EG5 A;  2FHS C;  1YIJ P;  4PWV B;  4XFZ A;  1YJN P;  4XFX A;  2KR5 A;  2CQ8 A;  2KOO A;  2L4B A;  4H2Y C;  1A8O A;  5HV8 A;  5CZD B;  1M6N A;  1VQM P;  1L0I A;  3CCU P;  3DTJ A;  3HYB A;  3G0V A;  2GDX A;  1M74 A;  3DS3 A;  2XXM A;  3EJB A;  3CCJ P;  1D1D A;  3CXC O;  2GZJ A;  2CGQ A;  2KG8 A;  4BPH A;  2JAZ A;  1VQP P;  1M90 Q;  2DNW A;  3DPH A;  2NO8 A;  1RNI A;  2N6Z A;  2FQ1 A;  2WPT A;  1VQ6 P;  2KGD A;  1ACP A;  2JGP A;  3LRY A;  2Z44 A;  2BHV A;  3P05 A;  3H47 A;  2KOQ A;  3DS2 A;  2N5I A;  4PH1 A;  1NQ4 A;  1VKU A;  1JJ2 O;  7CEI A;  1NJI Q;  3DS5 A;  3G6E P;  3G26 A;  3H0D A;  1OR5 A;  1QVF O;  2MD9 A;  5KP6 B;  2LF4 A;  3CC4 P;  1ZMB A;  5HVC A;  1VQO P;  4XRQ A;  4COP A;  2OTL P;  4MRT C;  5EW5 E;  4F37 A;  2VLO A;  2EHT A;  1A43 A;  3EJD A;  2PEM A;  1YIT P;  2AVA A;  4DG9 A;  4M0I A;  3VRL C;  3CCR P;  4U0F A;  2K94 A;  2FVE A;  4U0A A;  3CCE P;  3Q20 A;  2M8L A;  1N8R Q;  3CPW O;  1M1K Q;  3I55 P;  2EFJ A;  2N6Y A;  3NTE A;  1KD1 Q;  2JBG A;  1HQB A;  5F2O A;  3G71 P;  2KWL A;  2LPK A;  2MF4 A;  3CC7 P;  3DS0 A;  2OTJ P;  2DGY A;  4QKO A;  3G21 A;  2AFD A;  4BPG A;  1VQL P;  1F80 D;  4U0C A;  5HGN A;  1VQ4 P;  4U0B A;  2N5H A;  2AF8 A;  3RG2 A;  1QVG O;  3G1G A;  4PH0 A;  4H2X C;  1AYI A;  2KOS A;  1K30 A;  2K0D X;  2PEO A;  2PEN A;  2KG6 A;  2FQ0 A;  3CME P;  2Z46 A;  2K0Y A;  2L22 A;  2MR7 A;  2VLP A;  3I56 P;  3GZM A;  1KQS O;  4QNB A;  2KGC A;  1GXH A;  1S72 P;  1DV5 A;  2Z45 A;  1DNY A;  2PEI A;  4HKG A;  2KG9 A;  1X3O A;  2GYK A;  2ERH A;  1Q86 Q;  1AF8 A;  2K92 A;  1RO2 A;  5DCK A;  1VQ5 P;  3U43 A;  3DS1 A;  1YJW P;  1IMQ A;  3HZQ A;  1IUQ A;  2BUO A;  2E1M A;  3CCQ P; 
#chains in the Genus database with same CATH homology
 1ZNV A;  2GZF A;  7CEI A;  1UJZ A;  4QKO A;  1GXG A;  2VLQ A;  1AYI A;  1BXI A;  1MZ8 A;  2GYK A;  2WPT A;  2K0D X;  2GZG A;  2K5X A;  2ERH A;  2GZJ A;  3GJN A;  3GKL C;  2VLN A;  1UNK A;  3U43 A;  5EW5 E;  1IMP A;  1FR2 A;  1EMV A;  2JB0 A;  2VLP A;  2JAZ A;  2VLO A;  1IMQ A;  4F37 A;  2JBG A;  4UHP B;  2GZI A;  1E0H A;  2GZE A;  1GXH A;  1CEI A;  2NO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...