2GZIA

Crystal structure of the e9 dnase domain with a mutant immunity protein im9 (v34a)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
LKHSISDYTEAEFLQLVTTICNADTSSEEELAKLVTHFEEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E9 immunity protein
publication title Crystal Structure of the Complex of the Colicin E9 DNase Domain with a Mutant Immunity Protein, IM9 (V34A)
rcsb
source organism Escherichia coli k12
molecule tags Antibiotic/antibiotic inhibitor
total genus 28
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gziA00
1MZ8A 2GZEA 1CEIA 2JB0A 1IMPA 3GKLC 2VLPA 2GZIA 2VLNA 1GXHA 1GXGA 1EMVA 2GZJA 1BXIA 2JBGA 4UHPB 1IMQA 2ERHA 4QKOA 1UJZA 2K0DX 1AYIA 7CEIA 1ZNVA 3U43A 2WPTA 4F37A 2K5XA 2GZFA 2VLQA 1FR2A 3GJNA 5EW5E 2VLOA 2GYKA 2GZGA 1E0HA 1UNKA 2NO8A 2JAZA
chains in the Genus database with same CATH superfamily
2LIUA 2KW2A 2JU1A 2LTEA 2AFDA 2VLNA 2ROQA 2AFEA 1GXHA 2L0QA 2MVUA 2JGPA 1VQPP 2ERHA 1Z6MA 1RO0A 2K0XA 2GDWA 2K5XA 4PH0A 2VLQA 1KLPA 3GJNA 2GYKA 3I56P 3LMOA 2LPKA 2FVAA 3CCUP 4XFZA 4U0EA 1VQ5P 3B5IA 2KG8A 1IMQA 1L0HA 1KD1Q 2LKIA 5HV8A 2M8NA 2GDYA 2DGYA 4IPYA 1YJWP 2FQ0A 1VQ6P 5F2OA 1M6NA 1VQNP 1K30A 1MZ8A 2VSQA 4QNBA 3Q20A 5F2NA 3WBHA 2MR7A 2KOOA 1BXIA 4HKGA 2KGAA 1VQ7P 2FHSC 2KOSA 3G21A 2KGEA 1ZNVA 2XZ1C 3RG2A 2KR5A 2QA4P 2N5HA 3H4EA 1X3OA 5CZDB 1A8OA 2GZGA 3H47A 1VQ4P 2L22A 2K92A 3G71P 1T8KA 5HVCA 3LRYA 5BS2A 2PEIA 2ONTA 4U0BA 4QKOA 2QEXP 4BPGA 3CD6P 1HQBA 1W2BO 1YJNP 2X2BA 3DTJA 4WYMA 2JAZA 3DS1A 2M5RA 4H2XC 3EJEA 1K73Q 1M90Q 2GDXA 2JU2A 1EIAA 3CCEP 1YIJP 1VKUA 1E0HA 1UNKA 1YJ9P 3GKLC 4GR2A 4U0DA 2PEKA 1GXGA 5EJDA 1QVGO 3HYBA 2Z46A 2M8LA 2L4BA 2K0DX 3VRLC 4PWVB 2KOPA 3CCSP 4DG9A 1E6JP 2KG6A 2LL8A 1S72P 2BUOA 1HY8A 3RG6C 3EJBA 3EJDA 4CA3A 4COCA 2KGCA 4XRQA 1IUQA 2K2QA 1AUMA 2MR8A 3CXCO 3B4QA 3CC4P 2EFJA 3NTEA 2XV6A 2FADA 1VHNA 2OTLP 2KGDA 1RO2A 2CG5B 5F2KA 1VQLP 4NEOA 4UHPB 5I4TG 2L9FA 2PEMA 1EOQA 2M8PA 2XXMA 1F80D 4U0FA 5KP8B 3CC7P 2K0YA 1ACPA 1JJ2O 1EMVA 2XZ0D 2AF8A 1BAJA 3OW2O 3DS5A 4MRTC 3DS2A 3MGEA 3G1IA 5HGNA 2DNWA 2N6YA 3G6EP 2CNRA 4PH1A 3U43A 2FQ2A 3DS3A 5KP6B 3CE7A 2FAEA 1Q82Q 3CCJP 5HGOA 4XFYA 2WPTA 5BS1A 3CCVP 1KQSO 2NO8A 1Q7YQ 2GZIA 2K94A 1YITP 1NQ4A 2N50A 1AF8A 1AYIA 2PEJA 1VQ8P 3DS4A 3DS0A 3CCRP 2AVAA 3G0VA 2LIWA 2JO0A 1IMPA 2L6EA 3G1GA 2K93A 3CC2P 3G28A 1OR5A 1VQMP 1A43A 5HGLA 2CWOA 3HZQA 2JQ4A 3CMEP 1ZMBA 2KORA 3CMAP 2EHTA 1Q81Q 1FR2A 5EW5E 4XROA 4U0AA 1NJIQ 2JYLA 2KWLA 2CQ8A 2KODA 2OARA 3E2DA 1M74A 2KOQA 4BPHA 3DPHA 1VQKP 2JBGA 1VQ9P 1N8RQ 2E1MA 1K9MQ 5DCKA 1DV5A 4R0MA 2BHVA 1DNYA 4M0IA 4COPA 2N5IA 3GZLA 2FVFA 1VQOP 2Z45A 4IZ6A 2Z44A 4U0CA 3P05A 2PEQA 2MF4A 2JB0A 1YHQP 2CGQA 2EHSA 2N98A 1M6EX 2LMLA 2LOLA 1D1DA 1M1KQ 2PY8A 1RNIA 4GR6A 1GPJA 4F37A 2GZFA 2KG9A 2PEOA 3G4SP 2JYGA 2VLOA 2XT1A 2FVEA 3CPWO 2GZEA 1YI2P 2MY5A 2QNWA 4H2WC 1L0IA 1UJZA 4BPFA 7CEIA 5JPAA 3CCQP 3CCMP 3M1MA 4XFXA 1QRJA 2FQ1A 2MD9A 4PXHB 2PNGA 4H2YC 3G26A 1CEIA 2EIAA 2P9XA 3H0DA 2VLPA 1Q86Q 2GZJA 2MVVA 3G29A 3GZMA 1KC8Q 3CCLP 5HGMA 2N6ZA 2OTJP 1K8AQ 2EG5A 3NY7B 3I55P 2PENA 2LF4A 2FACA 1QVFO 5KP7B
chains in the Genus database with same CATH topology
1MZ8A 2GZEA 1CEIA 2JB0A 1IMPA 3GKLC 2VLPA 2GZIA 2VLNA 1GXHA 1GXGA 1EMVA 2GZJA 1BXIA 2JBGA 4UHPB 1IMQA 2ERHA 4QKOA 1UJZA 2K0DX 1AYIA 7CEIA 1ZNVA 3U43A 2WPTA 4F37A 2K5XA 2GZFA 2VLQA 1FR2A 3GJNA 5EW5E 2VLOA 2GYKA 2GZGA 1E0HA 1UNKA 2NO8A 2JAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MZ8 A;  2GZE A;  1CEI A;  2JB0 A;  1IMP A;  3GKL C;  2VLP A;  2GZI A;  2VLN A;  1GXH A;  1GXG A;  1EMV A;  2GZJ A;  1BXI A;  2JBG A;  4UHP B;  1IMQ A;  2ERH A;  4QKO A;  1UJZ A;  2K0D X;  1AYI A;  7CEI A;  1ZNV A;  3U43 A;  2WPT A;  4F37 A;  2K5X A;  2GZF A;  2VLQ A;  1FR2 A;  3GJN A;  5EW5 E;  2VLO A;  2GYK A;  2GZG A;  1E0H A;  1UNK A;  2NO8 A;  2JAZ A; 
#chains in the Genus database with same CATH topology
 2LIU A;  2KW2 A;  2JU1 A;  2LTE A;  2AFD A;  2VLN A;  2ROQ A;  2AFE A;  1GXH A;  2L0Q A;  2MVU A;  2JGP A;  1VQP P;  2ERH A;  1Z6M A;  1RO0 A;  2K0X A;  2GDW A;  2K5X A;  4PH0 A;  2VLQ A;  1KLP A;  3GJN A;  2GYK A;  3I56 P;  3LMO A;  2LPK A;  2FVA A;  3CCU P;  4XFZ A;  4U0E A;  1VQ5 P;  3B5I A;  2KG8 A;  1IMQ A;  1L0H A;  1KD1 Q;  2LKI A;  5HV8 A;  2M8N A;  2GDY A;  2DGY A;  4IPY A;  1YJW P;  2FQ0 A;  1VQ6 P;  5F2O A;  1M6N A;  1VQN P;  1K30 A;  1MZ8 A;  2VSQ A;  4QNB A;  3Q20 A;  5F2N A;  3WBH A;  2MR7 A;  2KOO A;  1BXI A;  4HKG A;  2KGA A;  1VQ7 P;  2FHS C;  2KOS A;  3G21 A;  2KGE A;  1ZNV A;  2XZ1 C;  3RG2 A;  2KR5 A;  2QA4 P;  2N5H A;  3H4E A;  1X3O A;  5CZD B;  1A8O A;  2GZG A;  3H47 A;  1VQ4 P;  2L22 A;  2K92 A;  3G71 P;  1T8K A;  5HVC A;  3LRY A;  5BS2 A;  2PEI A;  2ONT A;  4U0B A;  4QKO A;  2QEX P;  4BPG A;  3CD6 P;  1HQB A;  1W2B O;  1YJN P;  2X2B A;  3DTJ A;  4WYM A;  2JAZ A;  3DS1 A;  2M5R A;  4H2X C;  3EJE A;  1K73 Q;  1M90 Q;  2GDX A;  2JU2 A;  1EIA A;  3CCE P;  1YIJ P;  1VKU A;  1E0H A;  1UNK A;  1YJ9 P;  3GKL C;  4GR2 A;  4U0D A;  2PEK A;  1GXG A;  5EJD A;  1QVG O;  3HYB A;  2Z46 A;  2M8L A;  2L4B A;  2K0D X;  3VRL C;  4PWV B;  2KOP A;  3CCS P;  4DG9 A;  1E6J P;  2KG6 A;  2LL8 A;  1S72 P;  2BUO A;  1HY8 A;  3RG6 C;  3EJB A;  3EJD A;  4CA3 A;  4COC A;  2KGC A;  4XRQ A;  1IUQ A;  2K2Q A;  1AUM A;  2MR8 A;  3CXC O;  3B4Q A;  3CC4 P;  2EFJ A;  3NTE A;  2XV6 A;  2FAD A;  1VHN A;  2OTL P;  2KGD A;  1RO2 A;  2CG5 B;  5F2K A;  1VQL P;  4NEO A;  4UHP B;  5I4T G;  2L9F A;  2PEM A;  1EOQ A;  2M8P A;  2XXM A;  1F80 D;  4U0F A;  5KP8 B;  3CC7 P;  2K0Y A;  1ACP A;  1JJ2 O;  1EMV A;  2XZ0 D;  2AF8 A;  1BAJ A;  3OW2 O;  3DS5 A;  4MRT C;  3DS2 A;  3MGE A;  3G1I A;  5HGN A;  2DNW A;  2N6Y A;  3G6E P;  2CNR A;  4PH1 A;  3U43 A;  2FQ2 A;  3DS3 A;  5KP6 B;  3CE7 A;  2FAE A;  1Q82 Q;  3CCJ P;  5HGO A;  4XFY A;  2WPT A;  5BS1 A;  3CCV P;  1KQS O;  2NO8 A;  1Q7Y Q;  2GZI A;  2K94 A;  1YIT P;  1NQ4 A;  2N50 A;  1AF8 A;  1AYI A;  2PEJ A;  1VQ8 P;  3DS4 A;  3DS0 A;  3CCR P;  2AVA A;  3G0V A;  2LIW A;  2JO0 A;  1IMP A;  2L6E A;  3G1G A;  2K93 A;  3CC2 P;  3G28 A;  1OR5 A;  1VQM P;  1A43 A;  5HGL A;  2CWO A;  3HZQ A;  2JQ4 A;  3CME P;  1ZMB A;  2KOR A;  3CMA P;  2EHT A;  1Q81 Q;  1FR2 A;  5EW5 E;  4XRO A;  4U0A A;  1NJI Q;  2JYL A;  2KWL A;  2CQ8 A;  2KOD A;  2OAR A;  3E2D A;  1M74 A;  2KOQ A;  4BPH A;  3DPH A;  1VQK P;  2JBG A;  1VQ9 P;  1N8R Q;  2E1M A;  1K9M Q;  5DCK A;  1DV5 A;  4R0M A;  2BHV A;  1DNY A;  4M0I A;  4COP A;  2N5I A;  3GZL A;  2FVF A;  1VQO P;  2Z45 A;  4IZ6 A;  2Z44 A;  4U0C A;  3P05 A;  2PEQ A;  2MF4 A;  2JB0 A;  1YHQ P;  2CGQ A;  2EHS A;  2N98 A;  1M6E X;  2LML A;  2LOL A;  1D1D A;  1M1K Q;  2PY8 A;  1RNI A;  4GR6 A;  1GPJ A;  4F37 A;  2GZF A;  2KG9 A;  2PEO A;  3G4S P;  2JYG A;  2VLO A;  2XT1 A;  2FVE A;  3CPW O;  2GZE A;  1YI2 P;  2MY5 A;  2QNW A;  4H2W C;  1L0I A;  1UJZ A;  4BPF A;  7CEI A;  5JPA A;  3CCQ P;  3CCM P;  3M1M A;  4XFX A;  1QRJ A;  2FQ1 A;  2MD9 A;  4PXH B;  2PNG A;  4H2Y C;  3G26 A;  1CEI A;  2EIA A;  2P9X A;  3H0D A;  2VLP A;  1Q86 Q;  2GZJ A;  2MVV A;  3G29 A;  3GZM A;  1KC8 Q;  3CCL P;  5HGM A;  2N6Z A;  2OTJ P;  1K8A Q;  2EG5 A;  3NY7 B;  3I55 P;  2PEN A;  2LF4 A;  2FAC A;  1QVF O;  5KP7 B; 
#chains in the Genus database with same CATH homology
 1MZ8 A;  2GZE A;  1CEI A;  2JB0 A;  1IMP A;  3GKL C;  2VLP A;  2GZI A;  2VLN A;  1GXH A;  1GXG A;  1EMV A;  2GZJ A;  1BXI A;  2JBG A;  4UHP B;  1IMQ A;  2ERH A;  4QKO A;  1UJZ A;  2K0D X;  1AYI A;  7CEI A;  1ZNV A;  3U43 A;  2WPT A;  4F37 A;  2K5X A;  2GZF A;  2VLQ A;  1FR2 A;  3GJN A;  5EW5 E;  2VLO A;  2GYK A;  2GZG A;  1E0H A;  1UNK A;  2NO8 A;  2JAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...