2GZIA

Crystal structure of the e9 dnase domain with a mutant immunity protein im9 (v34a)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
LKHSISDYTEAEFLQLVTTICNADTSSEEELAKLVTHFEEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic/antibiotic inhibitor
molecule keywords Colicin-E9 immunity protein
publication title Crystal Structure of the Complex of the Colicin E9 DNase Domain with a Mutant Immunity Protein, IM9 (V34A)
rcsb
source organism Escherichia coli k12
total genus 28
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gziA00
2K5XA 3U43A 2GZJA 2JAZA 1GXHA 2JB0A 4F37A 1UJZA 4UHPB 1IMPA 3GJNA 3GKLC 2ERHA 1UNKA 1GXGA 1AYIA 1ZNVA 2VLOA 2GYKA 4QKOA 2GZEA 2K0DX 2GZFA 2VLQA 2VLNA 1EMVA 1E0HA 2WPTA 1IMQA 1BXIA 5EW5E 1MZ8A 2JBGA 2VLPA 2GZIA 2NO8A 7CEIA 1FR2A 1CEIA 2GZGA
chains in the Genus database with same CATH superfamily
2CGQA 5JPAA 2LIWA 3DS4A 3GJNA 2OTLP 2AF8A 1GXGA 2KG8A 3CCUP 2KGEA 2GYKA 1YIJP 3DS5A 2M8PA 2AVAA 3DS3A 3G21A 1K8AQ 1CEIA 4H2YC 2LF4A 3U43A 3CCMP 2L6EA 1KC8Q 3OW2O 4COCA 1AYIA 2XXMA 2JGPA 2N50A 2K0XA 1M6NA 2M8LA 3H47A 3Q20A 1BXIA 3CCLP 1QVFO 3I55P 1YHQP 2PENA 1HQBA 3B4QA 4XFZA 2LPKA 5DCKA 1VQLP 2QEXP 1RO0A 4BPFA 1VQ9P 2LTEA 1K73Q 2Z44A 4U0EA 4PH0A 1YITP 1L0HA 3G71P 2CNRA 1DV5A 1M6EX 2PEQA 2ROQA 2N5HA 5F2OA 2PNGA 5CZDB 2OTJP 3NTEA 2K94A 2KGDA 1VQMP 2L9FA 3H0DA 3CXCO 2KODA 3G6EP 2CQ8A 2JYLA 3CC4P 3LRYA 2DGYA 1UJZA 3HZQA 1IMPA 2ERHA 1UNKA 1YJNP 1F80D 3RG2A 4COPA 1W2BO 2JYGA 2PEMA 3CPWO 3CE7A 3CMEP 1ZMBA 1ACPA 7CEIA 2KOSA 2AFDA 2KOOA 3CCEP 3CCVP 2KOPA 3G0VA 2LOLA 2FAEA 2BUOA 2K0YA 3DS0A 2QNWA 1EMVA 2LKIA 3G29A 1L0IA 1VQ8P 1MZ8A 2LL8A 2JBGA 2M5RA 2GZEA 1RO2A 2GZJA 4XFXA 1BAJA 2OARA 3G26A 2CWOA 4F37A 5HV8A 2ONTA 4U0FA 2QA4P 1VQ4P 3E2DA 2FVAA 2GDWA 4H2XC 2KW2A 3CCRP 4NEOA 1EOQA 2XT1A 4GR6A 2P9XA 1Q86Q 2AFEA 4M0IA 1S72P 2L4BA 1VQKP 1JJ2O 1NJIQ 1K30A 2WPTA 3DPHA 4U0DA 1YJWP 2N98A 3G4SP 3P05A 3H4EA 2PEOA 1EIAA 1FR2A 2K5XA 2MVVA 1GXHA 2JB0A 2EHTA 4R0MA 2KR5A 3DTJA 2K92A 1T8KA 1KD1Q 2JU2A 3CCJP 2E1MA 2CG5B 2L0QA 2VSQA 3MGEA 5HGNA 5HVCA 2FQ1A 1QVGO 2KORA 3G28A 3HYBA 2GZGA 1VQPP 2LIUA 2PEKA 1OR5A 5HGMA 2FVEA 3CC7P 3VRLC 1VKUA 3WBHA 1D1DA 2KOQA 3DS2A 2Z45A 4IZ6A 1Q82Q 2K93A 2MD9A 2DNWA 2FQ2A 5BS1A 1IMQA 1VHNA 3CCSP 2MR8A 2JAZA 3G1GA 2FQ0A 3CD6P 2MR7A 5KP8B 1KLPA 2KG9A 2MY5A 5F2KA 4CA3A 1GPJA 2JU1A 2N6YA 2MF4A 2FACA 2KWLA 4U0AA 4WYMA 5EW5E 2XZ0D 4XFYA 2VLPA 1RNIA 3CMAP 1AF8A 1VQNP 4U0CA 2JQ4A 5BS2A 1KQSO 5HGLA 1YI2P 3EJDA 2BHVA 3I56P 2NO8A 3LMOA 1Q81Q 3G1IA 4GR2A 4BPHA 2JO0A 3NY7B 2FHSC 2Z46A 2EG5A 5F2NA 1NQ4A 3GKLC 2KGAA 4H2WC 2EIAA 4QKOA 2K0DX 1DNYA 4MRTC 2L22A 2VLQA 4XRQA 2MVUA 2GDYA 4PXHB 1E0HA 3CC2P 4PWVB 1E6JP 2X2BA 3B5IA 5I4TG 2FADA 3EJBA 4QNBA 2GZIA 1K9MQ 1M74A 4DG9A 2FVFA 2K2QA 1X3OA 5EJDA 5KP7B 5HGOA 1YJ9P 1Q7YQ 2VLOA 4XROA 2PY8A 2EHSA 2EFJA 3EJEA 2GDXA 1HY8A 4BPGA 3CCQP 1VQOP 3DS1A 2N5IA 1AUMA 1ZNVA 1VQ7P 2GZFA 1IUQA 4IPYA 1Z6MA 1A8OA 4U0BA 3RG6C 2KG6A 1M1KQ 1VQ5P 4HKGA 1N8RQ 4PH1A 2M8NA 4UHPB 2XV6A 2PEIA 2KGCA 3GZLA 2XZ1C 3M1MA 1A43A 1M90Q 2VLNA 1VQ6P 2N6ZA 5KP6B 2PEJA 3GZMA 2LMLA 1QRJA
chains in the Genus database with same CATH topology
2K5XA 3U43A 2GZJA 2JAZA 1GXHA 2JB0A 4F37A 1UJZA 4UHPB 1IMPA 3GJNA 3GKLC 2ERHA 1UNKA 1GXGA 1AYIA 1ZNVA 2VLOA 2GYKA 4QKOA 2GZEA 2K0DX 2GZFA 2VLQA 2VLNA 1EMVA 1E0HA 2WPTA 1IMQA 1BXIA 5EW5E 1MZ8A 2JBGA 2VLPA 2GZIA 2NO8A 7CEIA 1FR2A 1CEIA 2GZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5X A;  3U43 A;  2GZJ A;  2JAZ A;  1GXH A;  2JB0 A;  4F37 A;  1UJZ A;  4UHP B;  1IMP A;  3GJN A;  3GKL C;  2ERH A;  1UNK A;  1GXG A;  1AYI A;  1ZNV A;  2VLO A;  2GYK A;  4QKO A;  2GZE A;  2K0D X;  2GZF A;  2VLQ A;  2VLN A;  1EMV A;  1E0H A;  2WPT A;  1IMQ A;  1BXI A;  5EW5 E;  1MZ8 A;  2JBG A;  2VLP A;  2GZI A;  2NO8 A;  7CEI A;  1FR2 A;  1CEI A;  2GZG A; 
#chains in the Genus database with same CATH topology
 2CGQ A;  5JPA A;  2LIW A;  3DS4 A;  3GJN A;  2OTL P;  2AF8 A;  1GXG A;  2KG8 A;  3CCU P;  2KGE A;  2GYK A;  1YIJ P;  3DS5 A;  2M8P A;  2AVA A;  3DS3 A;  3G21 A;  1K8A Q;  1CEI A;  4H2Y C;  2LF4 A;  3U43 A;  3CCM P;  2L6E A;  1KC8 Q;  3OW2 O;  4COC A;  1AYI A;  2XXM A;  2JGP A;  2N50 A;  2K0X A;  1M6N A;  2M8L A;  3H47 A;  3Q20 A;  1BXI A;  3CCL P;  1QVF O;  3I55 P;  1YHQ P;  2PEN A;  1HQB A;  3B4Q A;  4XFZ A;  2LPK A;  5DCK A;  1VQL P;  2QEX P;  1RO0 A;  4BPF A;  1VQ9 P;  2LTE A;  1K73 Q;  2Z44 A;  4U0E A;  4PH0 A;  1YIT P;  1L0H A;  3G71 P;  2CNR A;  1DV5 A;  1M6E X;  2PEQ A;  2ROQ A;  2N5H A;  5F2O A;  2PNG A;  5CZD B;  2OTJ P;  3NTE A;  2K94 A;  2KGD A;  1VQM P;  2L9F A;  3H0D A;  3CXC O;  2KOD A;  3G6E P;  2CQ8 A;  2JYL A;  3CC4 P;  3LRY A;  2DGY A;  1UJZ A;  3HZQ A;  1IMP A;  2ERH A;  1UNK A;  1YJN P;  1F80 D;  3RG2 A;  4COP A;  1W2B O;  2JYG A;  2PEM A;  3CPW O;  3CE7 A;  3CME P;  1ZMB A;  1ACP A;  7CEI A;  2KOS A;  2AFD A;  2KOO A;  3CCE P;  3CCV P;  2KOP A;  3G0V A;  2LOL A;  2FAE A;  2BUO A;  2K0Y A;  3DS0 A;  2QNW A;  1EMV A;  2LKI A;  3G29 A;  1L0I A;  1VQ8 P;  1MZ8 A;  2LL8 A;  2JBG A;  2M5R A;  2GZE A;  1RO2 A;  2GZJ A;  4XFX A;  1BAJ A;  2OAR A;  3G26 A;  2CWO A;  4F37 A;  5HV8 A;  2ONT A;  4U0F A;  2QA4 P;  1VQ4 P;  3E2D A;  2FVA A;  2GDW A;  4H2X C;  2KW2 A;  3CCR P;  4NEO A;  1EOQ A;  2XT1 A;  4GR6 A;  2P9X A;  1Q86 Q;  2AFE A;  4M0I A;  1S72 P;  2L4B A;  1VQK P;  1JJ2 O;  1NJI Q;  1K30 A;  2WPT A;  3DPH A;  4U0D A;  1YJW P;  2N98 A;  3G4S P;  3P05 A;  3H4E A;  2PEO A;  1EIA A;  1FR2 A;  2K5X A;  2MVV A;  1GXH A;  2JB0 A;  2EHT A;  4R0M A;  2KR5 A;  3DTJ A;  2K92 A;  1T8K A;  1KD1 Q;  2JU2 A;  3CCJ P;  2E1M A;  2CG5 B;  2L0Q A;  2VSQ A;  3MGE A;  5HGN A;  5HVC A;  2FQ1 A;  1QVG O;  2KOR A;  3G28 A;  3HYB A;  2GZG A;  1VQP P;  2LIU A;  2PEK A;  1OR5 A;  5HGM A;  2FVE A;  3CC7 P;  3VRL C;  1VKU A;  3WBH A;  1D1D A;  2KOQ A;  3DS2 A;  2Z45 A;  4IZ6 A;  1Q82 Q;  2K93 A;  2MD9 A;  2DNW A;  2FQ2 A;  5BS1 A;  1IMQ A;  1VHN A;  3CCS P;  2MR8 A;  2JAZ A;  3G1G A;  2FQ0 A;  3CD6 P;  2MR7 A;  5KP8 B;  1KLP A;  2KG9 A;  2MY5 A;  5F2K A;  4CA3 A;  1GPJ A;  2JU1 A;  2N6Y A;  2MF4 A;  2FAC A;  2KWL A;  4U0A A;  4WYM A;  5EW5 E;  2XZ0 D;  4XFY A;  2VLP A;  1RNI A;  3CMA P;  1AF8 A;  1VQN P;  4U0C A;  2JQ4 A;  5BS2 A;  1KQS O;  5HGL A;  1YI2 P;  3EJD A;  2BHV A;  3I56 P;  2NO8 A;  3LMO A;  1Q81 Q;  3G1I A;  4GR2 A;  4BPH A;  2JO0 A;  3NY7 B;  2FHS C;  2Z46 A;  2EG5 A;  5F2N A;  1NQ4 A;  3GKL C;  2KGA A;  4H2W C;  2EIA A;  4QKO A;  2K0D X;  1DNY A;  4MRT C;  2L22 A;  2VLQ A;  4XRQ A;  2MVU A;  2GDY A;  4PXH B;  1E0H A;  3CC2 P;  4PWV B;  1E6J P;  2X2B A;  3B5I A;  5I4T G;  2FAD A;  3EJB A;  4QNB A;  2GZI A;  1K9M Q;  1M74 A;  4DG9 A;  2FVF A;  2K2Q A;  1X3O A;  5EJD A;  5KP7 B;  5HGO A;  1YJ9 P;  1Q7Y Q;  2VLO A;  4XRO A;  2PY8 A;  2EHS A;  2EFJ A;  3EJE A;  2GDX A;  1HY8 A;  4BPG A;  3CCQ P;  1VQO P;  3DS1 A;  2N5I A;  1AUM A;  1ZNV A;  1VQ7 P;  2GZF A;  1IUQ A;  4IPY A;  1Z6M A;  1A8O A;  4U0B A;  3RG6 C;  2KG6 A;  1M1K Q;  1VQ5 P;  4HKG A;  1N8R Q;  4PH1 A;  2M8N A;  4UHP B;  2XV6 A;  2PEI A;  2KGC A;  3GZL A;  2XZ1 C;  3M1M A;  1A43 A;  1M90 Q;  2VLN A;  1VQ6 P;  2N6Z A;  5KP6 B;  2PEJ A;  3GZM A;  2LML A;  1QRJ A; 
#chains in the Genus database with same CATH homology
 2K5X A;  3U43 A;  2GZJ A;  2JAZ A;  1GXH A;  2JB0 A;  4F37 A;  1UJZ A;  4UHP B;  1IMP A;  3GJN A;  3GKL C;  2ERH A;  1UNK A;  1GXG A;  1AYI A;  1ZNV A;  2VLO A;  2GYK A;  4QKO A;  2GZE A;  2K0D X;  2GZF A;  2VLQ A;  2VLN A;  1EMV A;  1E0H A;  2WPT A;  1IMQ A;  1BXI A;  5EW5 E;  1MZ8 A;  2JBG A;  2VLP A;  2GZI A;  2NO8 A;  7CEI A;  1FR2 A;  1CEI A;  2GZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...