2GZIA

Crystal structure of the e9 dnase domain with a mutant immunity protein im9 (v34a)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
83
structure length
83
Chain Sequence
LKHSISDYTEAEFLQLVTTICNADTSSEEELAKLVTHFEEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E9 immunity protein
publication title Crystal Structure of the Complex of the Colicin E9 DNase Domain with a Mutant Immunity Protein, IM9 (V34A)
rcsb
source organism Escherichia coli k12
molecule tags Antibiotic/antibiotic inhibitor
total genus 28
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gziA00
1UJZA 2JB0A 2ERHA 2GZJA 2GZGA 1E0HA 2GZIA 4UHPB 1GXHA 1FR2A 3GJNA 5EW5E 1IMPA 1ZNVA 3GKLC 2NO8A 2K5XA 1CEIA 1GXGA 1IMQA 1UNKA 2JAZA 2VLOA 2VLNA 2GYKA 1AYIA 2VLQA 2GZFA 4F37A 2WPTA 1MZ8A 7CEIA 2JBGA 3U43A 2VLPA 1EMVA 4QKOA 2GZEA 2K0DX 1BXIA
chains in the Genus database with same CATH superfamily
3E2DA 2KWLA 2Z44A 1YITP 3G0VA 4U0EA 5EW5E 1DNYA 2Z45A 1IMQA 4QNBA 1QVGO 5JPAA 1Z6MA 4U0FA 3VRLC 4BPHA 2L0QA 2XZ1C 4XRQA 2ERHA 2GDWA 1GPJA 1VQ5P 2MY5A 2QEXP 2BUOA 2K5XA 3M1MA 1VQ6P 2L9FA 2K94A 2VLOA 4NEOA 1K30A 2JU2A 4XROA 1M74A 2EIAA 5F2NA 2LPKA 2JU1A 1RNIA 1UJZA 2PEOA 2MVUA 2FQ1A 1M6NA 5I4TG 1M6EX 2CNRA 3DS0A 5HGNA 1YIJP 2QA4P 3DS4A 1A8OA 3DS2A 1KLPA 2AFEA 2M8NA 4H2WC 2OTJP 1YJ9P 1N8RQ 3HZQA 5HGMA 1BXIA 3NY7B 2GZJA 2PY8A 3I56P 3CC7P 3HYBA 4UHPB 1IMPA 3NTEA 4XFXA 2EFJA 5HV8A 4XFZA 2VLNA 2LF4A 4COPA 1VQOP 1YHQP 5EJDA 2FQ2A 3U43A 2K93A 2VLPA 1EMVA 2PEJA 2CGQA 2LL8A 3RG2A 2LMLA 1E0HA 2LKIA 1L0HA 2FVFA 2KOPA 1UNKA 1M1KQ 4GR6A 3DS1A 4IZ6A 1RO2A 2KG8A 3CCEP 4BPGA 1EIAA 3G26A 2K2QA 4PH0A 1VQNP 1QRJA 2M8PA 2FQ0A 2CWOA 2KGAA 1K9MQ 2LOLA 4CA3A 1GXGA 1JJ2O 3OW2O 3B5IA 2EHTA 2FVEA 3G28A 1KD1Q 1S72P 2JO0A 1T8KA 1AF8A 2KR5A 2XZ0D 1K73Q 5F2KA 2N6ZA 1BAJA 2FHSC 1CEIA 3CCMP 3CCQP 1VQ8P 5BS1A 1Q86Q 3EJDA 3CXCO 1K8AQ 3G29A 2AVAA 2AFDA 4GR2A 1D1DA 2JYGA 4BPFA 4MRTC 1M90Q 2WPTA 3H4EA 3CC4P 2CQ8A 2GDYA 4U0DA 1RO0A 2K0XA 1HQBA 2PENA 2M5RA 2OARA 2PEQA 1Q7YQ 2MD9A 3G71P 3Q20A 3RG6C 4U0CA 2P9XA 2XV6A 3GZMA 2FADA 5KP6B 2PEMA 5CZDB 1E6JP 2GZGA 4WYMA 3EJBA 3CD6P 1FR2A 1VQLP 3CCJP 2N5HA 3P05A 2Z46A 4U0BA 2E1MA 2L4BA 1VQPP 2K0YA 3MGEA 2MR8A 2KODA 4QKOA 2K92A 1NJIQ 2MF4A 1VQ7P 4IPYA 3EJEA 2JQ4A 1VQMP 2DNWA 3GKLC 1VQKP 1ZMBA 3GZLA 2JAZA 4COCA 2JYLA 5HGOA 3CMEP 2VLQA 2FACA 4F37A 1NQ4A 3CE7A 2KORA 3CCRP 2L6EA 2LIUA 1YI2P 4PH1A 1L0IA 3CMAP 2FAEA 2EG5A 2XT1A 4H2XC 1A43A 3G4SP 5KP7B 2KGDA 5DCKA 3B4QA 2KGCA 3DPHA 2KW2A 4HKGA 2LTEA 3CCSP 2PEIA 2L22A 2GYKA 2EHSA 2N5IA 5BS2A 4DG9A 4PXHB 2MR7A 2M8LA 1X3OA 3CC2P 3H47A 2GZIA 1VKUA 1YJWP 3G6EP 1DV5A 1VHNA 2LIWA 2QNWA 2N50A 2KOSA 1AYIA 2X2BA 3CCLP 2ROQA 2JBGA 2AF8A 3GJNA 3LMOA 1HY8A 4U0AA 4XFYA 2N98A 5F2OA 1Q82Q 1GXHA 3H0DA 1KC8Q 1KQSO 3G21A 1AUMA 3DTJA 4PWVB 2BHVA 2GZFA 2KOOA 1MZ8A 5KP8B 1Q81Q 7CEIA 4R0MA 2GZEA 3CCUP 3G1IA 2JGPA 1ZNVA 1YJNP 2ONTA 2NO8A 3DS5A 1OR5A 2KG6A 2DGYA 3LRYA 4M0IA 1VQ4P 1F80D 3WBHA 2PEKA 1QVFO 2JB0A 2KGEA 5HGLA 2KG9A 2XXMA 2FVAA 2CG5B 1W2BO 3DS3A 3CCVP 2PNGA 1VQ9P 3I55P 3CPWO 2VSQA 2GDXA 3G1GA 1EOQA 2N6YA 2MVVA 5HVCA 1IUQA 2KOQA 4H2YC 1ACPA 2OTLP 2K0DX
chains in the Genus database with same CATH topology
1UJZA 2JB0A 2ERHA 2GZJA 2GZGA 1E0HA 2GZIA 4UHPB 1GXHA 1FR2A 3GJNA 5EW5E 1IMPA 1ZNVA 3GKLC 2NO8A 2K5XA 1CEIA 1GXGA 1IMQA 1UNKA 2JAZA 2VLOA 2VLNA 2GYKA 1AYIA 2VLQA 2GZFA 4F37A 2WPTA 1MZ8A 7CEIA 2JBGA 3U43A 2VLPA 1EMVA 4QKOA 2GZEA 2K0DX 1BXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UJZ A;  2JB0 A;  2ERH A;  2GZJ A;  2GZG A;  1E0H A;  2GZI A;  4UHP B;  1GXH A;  1FR2 A;  3GJN A;  5EW5 E;  1IMP A;  1ZNV A;  3GKL C;  2NO8 A;  2K5X A;  1CEI A;  1GXG A;  1IMQ A;  1UNK A;  2JAZ A;  2VLO A;  2VLN A;  2GYK A;  1AYI A;  2VLQ A;  2GZF A;  4F37 A;  2WPT A;  1MZ8 A;  7CEI A;  2JBG A;  3U43 A;  2VLP A;  1EMV A;  4QKO A;  2GZE A;  2K0D X;  1BXI A; 
#chains in the Genus database with same CATH topology
 3E2D A;  2KWL A;  2Z44 A;  1YIT P;  3G0V A;  4U0E A;  5EW5 E;  1DNY A;  2Z45 A;  1IMQ A;  4QNB A;  1QVG O;  5JPA A;  1Z6M A;  4U0F A;  3VRL C;  4BPH A;  2L0Q A;  2XZ1 C;  4XRQ A;  2ERH A;  2GDW A;  1GPJ A;  1VQ5 P;  2MY5 A;  2QEX P;  2BUO A;  2K5X A;  3M1M A;  1VQ6 P;  2L9F A;  2K94 A;  2VLO A;  4NEO A;  1K30 A;  2JU2 A;  4XRO A;  1M74 A;  2EIA A;  5F2N A;  2LPK A;  2JU1 A;  1RNI A;  1UJZ A;  2PEO A;  2MVU A;  2FQ1 A;  1M6N A;  5I4T G;  1M6E X;  2CNR A;  3DS0 A;  5HGN A;  1YIJ P;  2QA4 P;  3DS4 A;  1A8O A;  3DS2 A;  1KLP A;  2AFE A;  2M8N A;  4H2W C;  2OTJ P;  1YJ9 P;  1N8R Q;  3HZQ A;  5HGM A;  1BXI A;  3NY7 B;  2GZJ A;  2PY8 A;  3I56 P;  3CC7 P;  3HYB A;  4UHP B;  1IMP A;  3NTE A;  4XFX A;  2EFJ A;  5HV8 A;  4XFZ A;  2VLN A;  2LF4 A;  4COP A;  1VQO P;  1YHQ P;  5EJD A;  2FQ2 A;  3U43 A;  2K93 A;  2VLP A;  1EMV A;  2PEJ A;  2CGQ A;  2LL8 A;  3RG2 A;  2LML A;  1E0H A;  2LKI A;  1L0H A;  2FVF A;  2KOP A;  1UNK A;  1M1K Q;  4GR6 A;  3DS1 A;  4IZ6 A;  1RO2 A;  2KG8 A;  3CCE P;  4BPG A;  1EIA A;  3G26 A;  2K2Q A;  4PH0 A;  1VQN P;  1QRJ A;  2M8P A;  2FQ0 A;  2CWO A;  2KGA A;  1K9M Q;  2LOL A;  4CA3 A;  1GXG A;  1JJ2 O;  3OW2 O;  3B5I A;  2EHT A;  2FVE A;  3G28 A;  1KD1 Q;  1S72 P;  2JO0 A;  1T8K A;  1AF8 A;  2KR5 A;  2XZ0 D;  1K73 Q;  5F2K A;  2N6Z A;  1BAJ A;  2FHS C;  1CEI A;  3CCM P;  3CCQ P;  1VQ8 P;  5BS1 A;  1Q86 Q;  3EJD A;  3CXC O;  1K8A Q;  3G29 A;  2AVA A;  2AFD A;  4GR2 A;  1D1D A;  2JYG A;  4BPF A;  4MRT C;  1M90 Q;  2WPT A;  3H4E A;  3CC4 P;  2CQ8 A;  2GDY A;  4U0D A;  1RO0 A;  2K0X A;  1HQB A;  2PEN A;  2M5R A;  2OAR A;  2PEQ A;  1Q7Y Q;  2MD9 A;  3G71 P;  3Q20 A;  3RG6 C;  4U0C A;  2P9X A;  2XV6 A;  3GZM A;  2FAD A;  5KP6 B;  2PEM A;  5CZD B;  1E6J P;  2GZG A;  4WYM A;  3EJB A;  3CD6 P;  1FR2 A;  1VQL P;  3CCJ P;  2N5H A;  3P05 A;  2Z46 A;  4U0B A;  2E1M A;  2L4B A;  1VQP P;  2K0Y A;  3MGE A;  2MR8 A;  2KOD A;  4QKO A;  2K92 A;  1NJI Q;  2MF4 A;  1VQ7 P;  4IPY A;  3EJE A;  2JQ4 A;  1VQM P;  2DNW A;  3GKL C;  1VQK P;  1ZMB A;  3GZL A;  2JAZ A;  4COC A;  2JYL A;  5HGO A;  3CME P;  2VLQ A;  2FAC A;  4F37 A;  1NQ4 A;  3CE7 A;  2KOR A;  3CCR P;  2L6E A;  2LIU A;  1YI2 P;  4PH1 A;  1L0I A;  3CMA P;  2FAE A;  2EG5 A;  2XT1 A;  4H2X C;  1A43 A;  3G4S P;  5KP7 B;  2KGD A;  5DCK A;  3B4Q A;  2KGC A;  3DPH A;  2KW2 A;  4HKG A;  2LTE A;  3CCS P;  2PEI A;  2L22 A;  2GYK A;  2EHS A;  2N5I A;  5BS2 A;  4DG9 A;  4PXH B;  2MR7 A;  2M8L A;  1X3O A;  3CC2 P;  3H47 A;  2GZI A;  1VKU A;  1YJW P;  3G6E P;  1DV5 A;  1VHN A;  2LIW A;  2QNW A;  2N50 A;  2KOS A;  1AYI A;  2X2B A;  3CCL P;  2ROQ A;  2JBG A;  2AF8 A;  3GJN A;  3LMO A;  1HY8 A;  4U0A A;  4XFY A;  2N98 A;  5F2O A;  1Q82 Q;  1GXH A;  3H0D A;  1KC8 Q;  1KQS O;  3G21 A;  1AUM A;  3DTJ A;  4PWV B;  2BHV A;  2GZF A;  2KOO A;  1MZ8 A;  5KP8 B;  1Q81 Q;  7CEI A;  4R0M A;  2GZE A;  3CCU P;  3G1I A;  2JGP A;  1ZNV A;  1YJN P;  2ONT A;  2NO8 A;  3DS5 A;  1OR5 A;  2KG6 A;  2DGY A;  3LRY A;  4M0I A;  1VQ4 P;  1F80 D;  3WBH A;  2PEK A;  1QVF O;  2JB0 A;  2KGE A;  5HGL A;  2KG9 A;  2XXM A;  2FVA A;  2CG5 B;  1W2B O;  3DS3 A;  3CCV P;  2PNG A;  1VQ9 P;  3I55 P;  3CPW O;  2VSQ A;  2GDX A;  3G1G A;  1EOQ A;  2N6Y A;  2MVV A;  5HVC A;  1IUQ A;  2KOQ A;  4H2Y C;  1ACP A;  2OTL P;  2K0D X; 
#chains in the Genus database with same CATH homology
 1UJZ A;  2JB0 A;  2ERH A;  2GZJ A;  2GZG A;  1E0H A;  2GZI A;  4UHP B;  1GXH A;  1FR2 A;  3GJN A;  5EW5 E;  1IMP A;  1ZNV A;  3GKL C;  2NO8 A;  2K5X A;  1CEI A;  1GXG A;  1IMQ A;  1UNK A;  2JAZ A;  2VLO A;  2VLN A;  2GYK A;  1AYI A;  2VLQ A;  2GZF A;  4F37 A;  2WPT A;  1MZ8 A;  7CEI A;  2JBG A;  3U43 A;  2VLP A;  1EMV A;  4QKO A;  2GZE A;  2K0D X;  1BXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...