2MR7A

Apo structure of the peptidyl carrier protein domain 7 of the teicoplanin producing non-ribosomal peptide synthetase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
91
structure length
91
Chain Sequence
GAMAKAPESATEKVLCALYAEILGVERVGVDDAFHDLGGSSALAMRLIARIREELGVDLPIRQLFSSPTPAGVARALAAKSASWSHPQFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the terminal PCP domain of the non-ribosomal peptide synthetase in teicoplanin biosynthesis.
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Biosynthetic protein
molecule keywords Non-ribosomal peptide synthetase
total genus 25
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2mr7A00
2FHSC 2KR5A 2KORA 2KG8A 2VSQA 2CNRA 4PWVB 2EHSA 2MR7A 1OR5A 4IZ6A 2FQ1A 5KP6B 4R0MA 2MVUA 5HV8A 2AFDA 2ROQA 4BPGA 2GDYA 2KGCA 4H2YC 1L0HA 2KWLA 2N5IA 2KOSA 2K92A 2KOOA 1DV5A 2K94A 4HKGA 1ACPA 1DNYA 1HY8A 1VKUA 2LMLA 2X2BA 2GDXA 1F80D 1T8KA 1AF8A 2AFEA 2KOPA 1KLPA 3GZLA 3NY7B 1X3OA 2GDWA 2FADA 2MR8A 2K0XA 2L4BA 5KP7B 2JU1A 2PNGA 2AF8A 2LIUA 4MRTC 2LPKA 4H2XC 2MF4A 2N6YA 4PXHB 2CG5B 2K0YA 2LL8A 3RG2A 2LIWA 2L9FA 2AVAA 2KGEA 2FQ0A 5EJDA 3EJDA 5HVCA 2FVEA 2K2QA 2MVVA 2CQ8A 2KOQA 2EHTA 2JU2A 2LTEA 2XZ0D 2FACA 2LOLA 4BPHA 5KP8B 2FVFA 2L22A 2KG6A 2L0QA 3EJBA 3EJEA 4DG9A 3LMOA 2QNWA 5CZDB 3CE7A 2KG9A 3GZMA 2K93A 1NQ4A 2MD9A 1L0IA 2JGPA 2FQ2A 4CA3A 2MY5A 2N5HA 2LKIA 2CGQA 2JQ4A 2KGAA 1HQBA 2N50A 2KGDA 2XZ1C 2DNWA 2N98A 4NEOA 2N6ZA 4BPFA 2KW2A 4H2WC 2FAEA 2FVAA 2M5RA
chains in the Genus database with same CATH superfamily
3M1MA 5JPAA 1E0HA 2VLPA 2P9XA 2VSQA 3CCMP 1K73Q 1VQOP 2M8PA 2BUOA 1OR5A 2FQ1A 4R0MA 1K30A 2Z46A 3HYBA 2ROQA 3VRLC 2GZGA 1FR2A 1YHQP 1UNKA 3G1IA 3OW2O 2N5IA 2KOSA 2K92A 1E6JP 1ACPA 1IUQA 1GPJA 1HY8A 2X2BA 1F80D 1T8KA 4XRQA 4UHPB 1RNIA 3GJNA 3NY7B 2FADA 2L4BA 5KP7B 3G6EP 2PNGA 2AF8A 3GKLC 4MRTC 1ZMBA 1VQ9P 4H2XC 3I55P 1EIAA 1VHNA 2LL8A 3RG6C 2L9FA 2L6EA 1Q81Q 2FVEA 3B4QA 2QA4P 2FVFA 1JJ2O 3H0DA 2L22A 2L0QA 3EJEA 2CWOA 1VQ8P 1VQPP 3DTJA 3CXCO 1RO0A 2MD9A 1A43A 4XROA 4U0AA 1KD1Q 2MY5A 2PEKA 2N5HA 1AUMA 2PENA 3H47A 3DS3A 4QKOA 2PEOA 1A8OA 2EFJA 3MGEA 4NEOA 2JYLA 4XFZA 5HGNA 1KC8Q 3CMEP 4H2WC 2JO0A 2M5RA 2FHSC 3G71P 2KORA 2KG8A 2MR7A 4IZ6A 2ONTA 2GZJA 3WBHA 3CCLP 2KGCA 4COCA 4H2YC 1QVFO 1YIJP 1VQMP 2KWLA 2NO8A 4U0BA 1DNYA 1VKUA 2LMLA 2GDXA 1Z6MA 2VLNA 1GXHA 2KOPA 3GZLA 1M90Q 2GDWA 2MR8A 2ERHA 2PEMA 2OTJP 2JU1A 1D1DA 2GZFA 5HGLA 1RO2A 2MF4A 4WYMA 2LIWA 2JAZA 5HVCA 2GZIA 2K2QA 2KOQA 5F2OA 3I56P 2PY8A 4M0IA 1W2BO 2LTEA 2LOLA 4BPHA 3H4EA 5KP8B 3G21A 2KG6A 5F2NA 1BXIA 1M6NA 2KG9A 2WPTA 1VQLP 3U43A 1L0IA 2JBGA 4CA3A 3B5IA 4COPA 3CC4P 2KGAA 2BHVA 1GXGA 1YJ9P 1NJIQ 1VQNP 3NTEA 2EIAA 4BPFA 1CEIA 2FAEA 2FVAA 3CCUP 2KR5A 2M8NA 2DGYA 2CNRA 3LRYA 2EHSA 2PEQA 5KP6B 2AFDA 4BPGA 2KODA 2JYGA 4XFXA 1BAJA 3CCVP 4U0CA 2K94A 3Q20A 3DS2A 1IMQA 1M74A 3G26A 1IMPA 5HGMA 1AF8A 2AFEA 1VQ6P 5BS1A 1X3OA 2LIUA 1EOQA 2LPKA 2N6YA 3G28A 3CCSP 2E1MA 4QNBA 3RG2A 4U0EA 2EG5A 2AVAA 1Q7YQ 2CQ8A 1QVGO 4GR2A 2Z45A 2PEIA 2XZ0D 2FACA 3CCRP 4DG9A 3P05A 2Z44A 2K5XA 1YJNP 1AYIA 3G0VA 1Q82Q 1EMVA 2K93A 1YI2P 4GR6A 4XFYA 2XXMA 3CC2P 2FQ2A 4F37A 1Q86Q 2LKIA 2CGQA 1QRJA 2JQ4A 3DS5A 1HQBA 2KGDA 2DNWA 2PEJA 2N6ZA 2GYKA 2VLOA 3CD6P 1K9MQ 4PWVB 1N8RQ 3E2DA 2MVUA 5HV8A 1VQ7P 2XV6A 1K8AQ 3CPWO 5I4TG 5BS2A 2GDYA 2JB0A 1L0HA 2KOOA 3CC7P 1DV5A 4HKGA 3DS0A 3G1GA 3HZQA 1M1KQ 1KLPA 2K0XA 2LF4A 3CCEP 4PH0A 4U0DA 3DPHA 1VQ5P 4PXHB 2CG5B 2OARA 1YITP 2K0YA 1S72P 2KGEA 2FQ0A 3G29A 5EJDA 2XT1A 3EJDA 2MVVA 1MZ8A 5DCKA 5EW5E 2EHTA 2GZEA 2JU2A 4PH1A 2M8LA 7CEIA 3CCQP 2K0DX 3EJBA 3LMOA 2QNWA 5CZDB 3CCJP 3DS4A 3CE7A 1VQKP 3GZMA 5HGOA 1NQ4A 2JGPA 3CMAP 3G4SP 1ZNVA 2N50A 2XZ1C 4U0FA 1UJZA 2N98A 5F2KA 1KQSO 2QEXP 1YJWP 2OTLP 1M6EX 4IPYA 2KW2A 2VLQA 3DS1A 1VQ4P
chains in the Genus database with same CATH topology
2FHSC 2KR5A 2KORA 2KG8A 2VSQA 2CNRA 4PWVB 2EHSA 2MR7A 1OR5A 4IZ6A 2FQ1A 5KP6B 4R0MA 2MVUA 5HV8A 2AFDA 2ROQA 4BPGA 2GDYA 2KGCA 4H2YC 1L0HA 2KWLA 2N5IA 2KOSA 2K92A 2KOOA 1DV5A 2K94A 4HKGA 1ACPA 1DNYA 1HY8A 1VKUA 2LMLA 2X2BA 2GDXA 1F80D 1T8KA 1AF8A 2AFEA 2KOPA 1KLPA 3GZLA 3NY7B 1X3OA 2GDWA 2FADA 2MR8A 2K0XA 2L4BA 5KP7B 2JU1A 2PNGA 2AF8A 2LIUA 4MRTC 2LPKA 4H2XC 2MF4A 2N6YA 4PXHB 2CG5B 2K0YA 2LL8A 3RG2A 2LIWA 2L9FA 2AVAA 2KGEA 2FQ0A 5EJDA 3EJDA 5HVCA 2FVEA 2K2QA 2MVVA 2CQ8A 2KOQA 2EHTA 2JU2A 2LTEA 2XZ0D 2FACA 2LOLA 4BPHA 5KP8B 2FVFA 2L22A 2KG6A 2L0QA 3EJBA 3EJEA 4DG9A 3LMOA 2QNWA 5CZDB 3CE7A 2KG9A 3GZMA 2K93A 1NQ4A 2MD9A 1L0IA 2JGPA 2FQ2A 4CA3A 2MY5A 2N5HA 2LKIA 2CGQA 2JQ4A 2KGAA 1HQBA 2N50A 2KGDA 2XZ1C 2DNWA 2N98A 4NEOA 2N6ZA 4BPFA 2KW2A 4H2WC 2FAEA 2FVAA 2M5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FHS C;  2KR5 A;  2KOR A;  2KG8 A;  2VSQ A;  2CNR A;  4PWV B;  2EHS A;  2MR7 A;  1OR5 A;  4IZ6 A;  2FQ1 A;  5KP6 B;  4R0M A;  2MVU A;  5HV8 A;  2AFD A;  2ROQ A;  4BPG A;  2GDY A;  2KGC A;  4H2Y C;  1L0H A;  2KWL A;  2N5I A;  2KOS A;  2K92 A;  2KOO A;  1DV5 A;  2K94 A;  4HKG A;  1ACP A;  1DNY A;  1HY8 A;  1VKU A;  2LML A;  2X2B A;  2GDX A;  1F80 D;  1T8K A;  1AF8 A;  2AFE A;  2KOP A;  1KLP A;  3GZL A;  3NY7 B;  1X3O A;  2GDW A;  2FAD A;  2MR8 A;  2K0X A;  2L4B A;  5KP7 B;  2JU1 A;  2PNG A;  2AF8 A;  2LIU A;  4MRT C;  2LPK A;  4H2X C;  2MF4 A;  2N6Y A;  4PXH B;  2CG5 B;  2K0Y A;  2LL8 A;  3RG2 A;  2LIW A;  2L9F A;  2AVA A;  2KGE A;  2FQ0 A;  5EJD A;  3EJD A;  5HVC A;  2FVE A;  2K2Q A;  2MVV A;  2CQ8 A;  2KOQ A;  2EHT A;  2JU2 A;  2LTE A;  2XZ0 D;  2FAC A;  2LOL A;  4BPH A;  5KP8 B;  2FVF A;  2L22 A;  2KG6 A;  2L0Q A;  3EJB A;  3EJE A;  4DG9 A;  3LMO A;  2QNW A;  5CZD B;  3CE7 A;  2KG9 A;  3GZM A;  2K93 A;  1NQ4 A;  2MD9 A;  1L0I A;  2JGP A;  2FQ2 A;  4CA3 A;  2MY5 A;  2N5H A;  2LKI A;  2CGQ A;  2JQ4 A;  2KGA A;  1HQB A;  2N50 A;  2KGD A;  2XZ1 C;  2DNW A;  2N98 A;  4NEO A;  2N6Z A;  4BPF A;  2KW2 A;  4H2W C;  2FAE A;  2FVA A;  2M5R A; 
#chains in the Genus database with same CATH topology
 3M1M A;  5JPA A;  1E0H A;  2VLP A;  2P9X A;  2VSQ A;  3CCM P;  1K73 Q;  1VQO P;  2M8P A;  2BUO A;  1OR5 A;  2FQ1 A;  4R0M A;  1K30 A;  2Z46 A;  3HYB A;  2ROQ A;  3VRL C;  2GZG A;  1FR2 A;  1YHQ P;  1UNK A;  3G1I A;  3OW2 O;  2N5I A;  2KOS A;  2K92 A;  1E6J P;  1ACP A;  1IUQ A;  1GPJ A;  1HY8 A;  2X2B A;  1F80 D;  1T8K A;  4XRQ A;  4UHP B;  1RNI A;  3GJN A;  3NY7 B;  2FAD A;  2L4B A;  5KP7 B;  3G6E P;  2PNG A;  2AF8 A;  3GKL C;  4MRT C;  1ZMB A;  1VQ9 P;  4H2X C;  3I55 P;  1EIA A;  1VHN A;  2LL8 A;  3RG6 C;  2L9F A;  2L6E A;  1Q81 Q;  2FVE A;  3B4Q A;  2QA4 P;  2FVF A;  1JJ2 O;  3H0D A;  2L22 A;  2L0Q A;  3EJE A;  2CWO A;  1VQ8 P;  1VQP P;  3DTJ A;  3CXC O;  1RO0 A;  2MD9 A;  1A43 A;  4XRO A;  4U0A A;  1KD1 Q;  2MY5 A;  2PEK A;  2N5H A;  1AUM A;  2PEN A;  3H47 A;  3DS3 A;  4QKO A;  2PEO A;  1A8O A;  2EFJ A;  3MGE A;  4NEO A;  2JYL A;  4XFZ A;  5HGN A;  1KC8 Q;  3CME P;  4H2W C;  2JO0 A;  2M5R A;  2FHS C;  3G71 P;  2KOR A;  2KG8 A;  2MR7 A;  4IZ6 A;  2ONT A;  2GZJ A;  3WBH A;  3CCL P;  2KGC A;  4COC A;  4H2Y C;  1QVF O;  1YIJ P;  1VQM P;  2KWL A;  2NO8 A;  4U0B A;  1DNY A;  1VKU A;  2LML A;  2GDX A;  1Z6M A;  2VLN A;  1GXH A;  2KOP A;  3GZL A;  1M90 Q;  2GDW A;  2MR8 A;  2ERH A;  2PEM A;  2OTJ P;  2JU1 A;  1D1D A;  2GZF A;  5HGL A;  1RO2 A;  2MF4 A;  4WYM A;  2LIW A;  2JAZ A;  5HVC A;  2GZI A;  2K2Q A;  2KOQ A;  5F2O A;  3I56 P;  2PY8 A;  4M0I A;  1W2B O;  2LTE A;  2LOL A;  4BPH A;  3H4E A;  5KP8 B;  3G21 A;  2KG6 A;  5F2N A;  1BXI A;  1M6N A;  2KG9 A;  2WPT A;  1VQL P;  3U43 A;  1L0I A;  2JBG A;  4CA3 A;  3B5I A;  4COP A;  3CC4 P;  2KGA A;  2BHV A;  1GXG A;  1YJ9 P;  1NJI Q;  1VQN P;  3NTE A;  2EIA A;  4BPF A;  1CEI A;  2FAE A;  2FVA A;  3CCU P;  2KR5 A;  2M8N A;  2DGY A;  2CNR A;  3LRY A;  2EHS A;  2PEQ A;  5KP6 B;  2AFD A;  4BPG A;  2KOD A;  2JYG A;  4XFX A;  1BAJ A;  3CCV P;  4U0C A;  2K94 A;  3Q20 A;  3DS2 A;  1IMQ A;  1M74 A;  3G26 A;  1IMP A;  5HGM A;  1AF8 A;  2AFE A;  1VQ6 P;  5BS1 A;  1X3O A;  2LIU A;  1EOQ A;  2LPK A;  2N6Y A;  3G28 A;  3CCS P;  2E1M A;  4QNB A;  3RG2 A;  4U0E A;  2EG5 A;  2AVA A;  1Q7Y Q;  2CQ8 A;  1QVG O;  4GR2 A;  2Z45 A;  2PEI A;  2XZ0 D;  2FAC A;  3CCR P;  4DG9 A;  3P05 A;  2Z44 A;  2K5X A;  1YJN P;  1AYI A;  3G0V A;  1Q82 Q;  1EMV A;  2K93 A;  1YI2 P;  4GR6 A;  4XFY A;  2XXM A;  3CC2 P;  2FQ2 A;  4F37 A;  1Q86 Q;  2LKI A;  2CGQ A;  1QRJ A;  2JQ4 A;  3DS5 A;  1HQB A;  2KGD A;  2DNW A;  2PEJ A;  2N6Z A;  2GYK A;  2VLO A;  3CD6 P;  1K9M Q;  4PWV B;  1N8R Q;  3E2D A;  2MVU A;  5HV8 A;  1VQ7 P;  2XV6 A;  1K8A Q;  3CPW O;  5I4T G;  5BS2 A;  2GDY A;  2JB0 A;  1L0H A;  2KOO A;  3CC7 P;  1DV5 A;  4HKG A;  3DS0 A;  3G1G A;  3HZQ A;  1M1K Q;  1KLP A;  2K0X A;  2LF4 A;  3CCE P;  4PH0 A;  4U0D A;  3DPH A;  1VQ5 P;  4PXH B;  2CG5 B;  2OAR A;  1YIT P;  2K0Y A;  1S72 P;  2KGE A;  2FQ0 A;  3G29 A;  5EJD A;  2XT1 A;  3EJD A;  2MVV A;  1MZ8 A;  5DCK A;  5EW5 E;  2EHT A;  2GZE A;  2JU2 A;  4PH1 A;  2M8L A;  7CEI A;  3CCQ P;  2K0D X;  3EJB A;  3LMO A;  2QNW A;  5CZD B;  3CCJ P;  3DS4 A;  3CE7 A;  1VQK P;  3GZM A;  5HGO A;  1NQ4 A;  2JGP A;  3CMA P;  3G4S P;  1ZNV A;  2N50 A;  2XZ1 C;  4U0F A;  1UJZ A;  2N98 A;  5F2K A;  1KQS O;  2QEX P;  1YJW P;  2OTL P;  1M6E X;  4IPY A;  2KW2 A;  2VLQ A;  3DS1 A;  1VQ4 P; 
#chains in the Genus database with same CATH homology
 2FHS C;  2KR5 A;  2KOR A;  2KG8 A;  2VSQ A;  2CNR A;  4PWV B;  2EHS A;  2MR7 A;  1OR5 A;  4IZ6 A;  2FQ1 A;  5KP6 B;  4R0M A;  2MVU A;  5HV8 A;  2AFD A;  2ROQ A;  4BPG A;  2GDY A;  2KGC A;  4H2Y C;  1L0H A;  2KWL A;  2N5I A;  2KOS A;  2K92 A;  2KOO A;  1DV5 A;  2K94 A;  4HKG A;  1ACP A;  1DNY A;  1HY8 A;  1VKU A;  2LML A;  2X2B A;  2GDX A;  1F80 D;  1T8K A;  1AF8 A;  2AFE A;  2KOP A;  1KLP A;  3GZL A;  3NY7 B;  1X3O A;  2GDW A;  2FAD A;  2MR8 A;  2K0X A;  2L4B A;  5KP7 B;  2JU1 A;  2PNG A;  2AF8 A;  2LIU A;  4MRT C;  2LPK A;  4H2X C;  2MF4 A;  2N6Y A;  4PXH B;  2CG5 B;  2K0Y A;  2LL8 A;  3RG2 A;  2LIW A;  2L9F A;  2AVA A;  2KGE A;  2FQ0 A;  5EJD A;  3EJD A;  5HVC A;  2FVE A;  2K2Q A;  2MVV A;  2CQ8 A;  2KOQ A;  2EHT A;  2JU2 A;  2LTE A;  2XZ0 D;  2FAC A;  2LOL A;  4BPH A;  5KP8 B;  2FVF A;  2L22 A;  2KG6 A;  2L0Q A;  3EJB A;  3EJE A;  4DG9 A;  3LMO A;  2QNW A;  5CZD B;  3CE7 A;  2KG9 A;  3GZM A;  2K93 A;  1NQ4 A;  2MD9 A;  1L0I A;  2JGP A;  2FQ2 A;  4CA3 A;  2MY5 A;  2N5H A;  2LKI A;  2CGQ A;  2JQ4 A;  2KGA A;  1HQB A;  2N50 A;  2KGD A;  2XZ1 C;  2DNW A;  2N98 A;  4NEO A;  2N6Z A;  4BPF A;  2KW2 A;  4H2W C;  2FAE A;  2FVA A;  2M5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...