2MR7A

Apo structure of the peptidyl carrier protein domain 7 of the teicoplanin producing non-ribosomal peptide synthetase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
91
structure length
91
Chain Sequence
GAMAKAPESATEKVLCALYAEILGVERVGVDDAFHDLGGSSALAMRLIARIREELGVDLPIRQLFSSPTPAGVARALAAKSASWSHPQFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Non-ribosomal peptide synthetase
publication title Structure of the terminal PCP domain of the non-ribosomal peptide synthetase in teicoplanin biosynthesis.
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
total genus 25
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2014-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2mr7A00
4IZ6A 2FVFA 2XZ0D 2L9FA 3NY7B 1OR5A 2MD9A 2FAEA 5KP8B 4MRTC 2AFEA 2FADA 2LOLA 2CGQA 2AFDA 1DV5A 2JGPA 2LMLA 2LTEA 1NQ4A 1T8KA 2KW2A 2LL8A 2K92A 2N5HA 2N6YA 2GDWA 2K94A 2LIUA 2AF8A 3EJEA 2KOPA 2MR8A 2AVAA 5EJDA 2N50A 4HKGA 3GZMA 2FQ1A 2JQ4A 5CZDB 2EHSA 2GDXA 2M5RA 2PNGA 2DNWA 2L0QA 2KG8A 1L0HA 3LMOA 4H2YC 1AF8A 5HV8A 2VSQA 2MVVA 2CG5B 1X3OA 4PWVB 2K93A 2N6ZA 3CE7A 2L4BA 2MVUA 2QNWA 4H2XC 2KR5A 2EHTA 3EJBA 2KOQA 1L0IA 2FVEA 2GDYA 2K0XA 2KGAA 2MY5A 1HY8A 2N98A 4BPHA 2CNRA 2KGEA 4PXHB 2KOOA 2FQ2A 4BPGA 2JU1A 2ROQA 3RG2A 2KORA 5KP6B 2FACA 2LKIA 2K0YA 2FHSC 1KLPA 2KG9A 2KWLA 2MR7A 2N5IA 1HQBA 1VKUA 2K2QA 4NEOA 4BPFA 4CA3A 1ACPA 3GZLA 2JU2A 3EJDA 2KOSA 2X2BA 5HVCA 2L22A 2MF4A 2CQ8A 2LIWA 1DNYA 4H2WC 2KGCA 2FQ0A 2LPKA 2FVAA 2KGDA 2KG6A 1F80D 4R0MA 2XZ1C 5KP7B 4DG9A
chains in the Genus database with same CATH superfamily
2GYKA 2KODA 2FVFA 2XV6A 1Q7YQ 2MD9A 5KP8B 2LMLA 3H47A 2KW2A 3H4EA 2AVAA 2N50A 2P9XA 1E6JP 3G26A 1UNKA 2LF4A 1RO2A 2GDXA 2PNGA 1NJIQ 1KD1Q 3VRLC 2VSQA 2ERHA 5HGOA 2MVVA 2CG5B 4WYMA 2K93A 2L4BA 1JJ2O 2MVUA 2QNWA 4U0DA 3CCUP 3G71P 1M90Q 2K0DX 1RNIA 2KOQA 3EJBA 2KGAA 1K9MQ 1VQ4P 3CC7P 5HGMA 2ONTA 3CCEP 2FACA 4PH0A 1VQPP 1K30A 1KLPA 2NO8A 3CPWO 1YHQP 2JBGA 3OW2O 2K2QA 1VQMP 1IMQA 1CEIA 2GZFA 4U0AA 4COPA 2Z46A 1VQNP 4H2WC 2KGCA 4U0CA 1F80D 3P05A 1D1DA 4R0MA 2EIAA 2PENA 1OR5A 3I56P 3DS0A 1M6NA 4U0EA 1VQ7P 2FADA 3G6EP 2LTEA 2M8NA 2K92A 2Z44A 2K5XA 1Q86Q 1VQLP 2LIUA 2AF8A 5BS1A 2EFJA 3U43A 3LRYA 4XRQA 1VQ9P 2PEMA 1Z6MA 5HGNA 2L0QA 2WPTA 3Q20A 2KG8A 1BAJA 3CXCO 3H0DA 1VQ6P 1AF8A 5HV8A 4F37A 4M0IA 4GR6A 3G1IA 5JPAA 4U0FA 1AYIA 2FVEA 2GDYA 2K0XA 1A8OA 2MY5A 3NTEA 2EG5A 2KGEA 1UJZA 2KOOA 2FQ2A 1ZMBA 2ROQA 3RG2A 5KP6B 1E0HA 3DS5A 4PH1A 1QRJA 2K0YA 1GXGA 3I55P 1AUMA 2KG9A 3HZQA 2KWLA 2MR7A 4NEOA 3M1MA 4CA3A 1YIJP 5BS2A 3EJDA 2M8LA 3CCMP 2GZEA 2KGDA 1YITP 1K73Q 2XZ1C 2QA4P 4IZ6A 2QEXP 2VLQA 2XZ0D 1ZNVA 2JYGA 2L9FA 1YI2P 3NY7B 2PEJA 3CC4P 4MRTC 2LOLA 3G0VA 1VQ5P 1DV5A 1T8KA 2LL8A 2PEOA 2N6YA 2K94A 3GJNA 2L6EA 1K8AQ 3EJEA 2KOPA 1YJ9P 3B5IA 4HKGA 3GZMA 2FQ1A 3DPHA 5CZDB 2EHSA 4UHPB 4QNBA 5I4TG 1L0HA 2Z45A 3LMOA 4H2YC 2JO0A 1VQ8P 1KQSO 5DCKA 1X3OA 4PWVB 4U0BA 3CCSP 3CE7A 3DTJA 1YJNP 4H2XC 1EIAA 1W2BO 3DS4A 1HY8A 1QVFO 2OTLP 2CNRA 4PXHB 4QKOA 2CWOA 1M6EX 1KC8Q 2VLPA 2LKIA 1Q81Q 2BHVA 1BXIA 1M1KQ 3CD6P 5HGLA 2PEKA 2JU2A 2JYLA 2KOSA 5HVCA 3CMAP 5EW5E 2L22A 2CQ8A 1GPJA 2LPKA 4XFZA 4XFYA 2FVAA 2KG6A 3G29A 2E1MA 4DG9A 3GKLC 2PY8A 2FAEA 1QVGO 2AFEA 3CMEP 1IUQA 2CGQA 3E2DA 2AFDA 3CCJP 1Q82Q 2OTJP 2JGPA 4IPYA 3G28A 3RG6C 1NQ4A 4XROA 1EMVA 2N5HA 3G21A 1M74A 2GDWA 2MR8A 2VLNA 5EJDA 3DS3A 3MGEA 2JQ4A 2JAZA 3G1GA 2GZGA 1EOQA 7CEIA 2M5RA 2DNWA 2VLOA 2GZJA 2DGYA 1YJWP 3G4SP 1VQOP 2XXMA 2PEIA 1GXHA 3CCVP 2N6ZA 3DS2A 3B4QA 1S72P 2KR5A 2EHTA 2PEQA 1L0IA 2N98A 4BPHA 3HYBA 5F2OA 2JB0A 5F2KA 3CC2P 4BPGA 3CCQP 1FR2A 2JU1A 2KORA 5F2NA 2FHSC 3CCRP 4XFXA 2XT1A 1A43A 2M8PA 1N8RQ 3CCLP 2OARA 3DS1A 2N5IA 1HQBA 1VKUA 4BPFA 1ACPA 2GZIA 3WBHA 3GZLA 2X2BA 4COCA 2MF4A 2LIWA 1DNYA 4GR2A 2FQ0A 1VQKP 1VHNA 1MZ8A 1IMPA 2BUOA 1RO0A 5KP7B
chains in the Genus database with same CATH topology
4IZ6A 2FVFA 2XZ0D 2L9FA 3NY7B 1OR5A 2MD9A 2FAEA 5KP8B 4MRTC 2AFEA 2FADA 2LOLA 2CGQA 2AFDA 1DV5A 2JGPA 2LMLA 2LTEA 1NQ4A 1T8KA 2KW2A 2LL8A 2K92A 2N5HA 2N6YA 2GDWA 2K94A 2LIUA 2AF8A 3EJEA 2KOPA 2MR8A 2AVAA 5EJDA 2N50A 4HKGA 3GZMA 2FQ1A 2JQ4A 5CZDB 2EHSA 2GDXA 2M5RA 2PNGA 2DNWA 2L0QA 2KG8A 1L0HA 3LMOA 4H2YC 1AF8A 5HV8A 2VSQA 2MVVA 2CG5B 1X3OA 4PWVB 2K93A 2N6ZA 3CE7A 2L4BA 2MVUA 2QNWA 4H2XC 2KR5A 2EHTA 3EJBA 2KOQA 1L0IA 2FVEA 2GDYA 2K0XA 2KGAA 2MY5A 1HY8A 2N98A 4BPHA 2CNRA 2KGEA 4PXHB 2KOOA 2FQ2A 4BPGA 2JU1A 2ROQA 3RG2A 2KORA 5KP6B 2FACA 2LKIA 2K0YA 2FHSC 1KLPA 2KG9A 2KWLA 2MR7A 2N5IA 1HQBA 1VKUA 2K2QA 4NEOA 4BPFA 4CA3A 1ACPA 3GZLA 2JU2A 3EJDA 2KOSA 2X2BA 5HVCA 2L22A 2MF4A 2CQ8A 2LIWA 1DNYA 4H2WC 2KGCA 2FQ0A 2LPKA 2FVAA 2KGDA 2KG6A 1F80D 4R0MA 2XZ1C 5KP7B 4DG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IZ6 A;  2FVF A;  2XZ0 D;  2L9F A;  3NY7 B;  1OR5 A;  2MD9 A;  2FAE A;  5KP8 B;  4MRT C;  2AFE A;  2FAD A;  2LOL A;  2CGQ A;  2AFD A;  1DV5 A;  2JGP A;  2LML A;  2LTE A;  1NQ4 A;  1T8K A;  2KW2 A;  2LL8 A;  2K92 A;  2N5H A;  2N6Y A;  2GDW A;  2K94 A;  2LIU A;  2AF8 A;  3EJE A;  2KOP A;  2MR8 A;  2AVA A;  5EJD A;  2N50 A;  4HKG A;  3GZM A;  2FQ1 A;  2JQ4 A;  5CZD B;  2EHS A;  2GDX A;  2M5R A;  2PNG A;  2DNW A;  2L0Q A;  2KG8 A;  1L0H A;  3LMO A;  4H2Y C;  1AF8 A;  5HV8 A;  2VSQ A;  2MVV A;  2CG5 B;  1X3O A;  4PWV B;  2K93 A;  2N6Z A;  3CE7 A;  2L4B A;  2MVU A;  2QNW A;  4H2X C;  2KR5 A;  2EHT A;  3EJB A;  2KOQ A;  1L0I A;  2FVE A;  2GDY A;  2K0X A;  2KGA A;  2MY5 A;  1HY8 A;  2N98 A;  4BPH A;  2CNR A;  2KGE A;  4PXH B;  2KOO A;  2FQ2 A;  4BPG A;  2JU1 A;  2ROQ A;  3RG2 A;  2KOR A;  5KP6 B;  2FAC A;  2LKI A;  2K0Y A;  2FHS C;  1KLP A;  2KG9 A;  2KWL A;  2MR7 A;  2N5I A;  1HQB A;  1VKU A;  2K2Q A;  4NEO A;  4BPF A;  4CA3 A;  1ACP A;  3GZL A;  2JU2 A;  3EJD A;  2KOS A;  2X2B A;  5HVC A;  2L22 A;  2MF4 A;  2CQ8 A;  2LIW A;  1DNY A;  4H2W C;  2KGC A;  2FQ0 A;  2LPK A;  2FVA A;  2KGD A;  2KG6 A;  1F80 D;  4R0M A;  2XZ1 C;  5KP7 B;  4DG9 A; 
#chains in the Genus database with same CATH topology
 2GYK A;  2KOD A;  2FVF A;  2XV6 A;  1Q7Y Q;  2MD9 A;  5KP8 B;  2LML A;  3H47 A;  2KW2 A;  3H4E A;  2AVA A;  2N50 A;  2P9X A;  1E6J P;  3G26 A;  1UNK A;  2LF4 A;  1RO2 A;  2GDX A;  2PNG A;  1NJI Q;  1KD1 Q;  3VRL C;  2VSQ A;  2ERH A;  5HGO A;  2MVV A;  2CG5 B;  4WYM A;  2K93 A;  2L4B A;  1JJ2 O;  2MVU A;  2QNW A;  4U0D A;  3CCU P;  3G71 P;  1M90 Q;  2K0D X;  1RNI A;  2KOQ A;  3EJB A;  2KGA A;  1K9M Q;  1VQ4 P;  3CC7 P;  5HGM A;  2ONT A;  3CCE P;  2FAC A;  4PH0 A;  1VQP P;  1K30 A;  1KLP A;  2NO8 A;  3CPW O;  1YHQ P;  2JBG A;  3OW2 O;  2K2Q A;  1VQM P;  1IMQ A;  1CEI A;  2GZF A;  4U0A A;  4COP A;  2Z46 A;  1VQN P;  4H2W C;  2KGC A;  4U0C A;  1F80 D;  3P05 A;  1D1D A;  4R0M A;  2EIA A;  2PEN A;  1OR5 A;  3I56 P;  3DS0 A;  1M6N A;  4U0E A;  1VQ7 P;  2FAD A;  3G6E P;  2LTE A;  2M8N A;  2K92 A;  2Z44 A;  2K5X A;  1Q86 Q;  1VQL P;  2LIU A;  2AF8 A;  5BS1 A;  2EFJ A;  3U43 A;  3LRY A;  4XRQ A;  1VQ9 P;  2PEM A;  1Z6M A;  5HGN A;  2L0Q A;  2WPT A;  3Q20 A;  2KG8 A;  1BAJ A;  3CXC O;  3H0D A;  1VQ6 P;  1AF8 A;  5HV8 A;  4F37 A;  4M0I A;  4GR6 A;  3G1I A;  5JPA A;  4U0F A;  1AYI A;  2FVE A;  2GDY A;  2K0X A;  1A8O A;  2MY5 A;  3NTE A;  2EG5 A;  2KGE A;  1UJZ A;  2KOO A;  2FQ2 A;  1ZMB A;  2ROQ A;  3RG2 A;  5KP6 B;  1E0H A;  3DS5 A;  4PH1 A;  1QRJ A;  2K0Y A;  1GXG A;  3I55 P;  1AUM A;  2KG9 A;  3HZQ A;  2KWL A;  2MR7 A;  4NEO A;  3M1M A;  4CA3 A;  1YIJ P;  5BS2 A;  3EJD A;  2M8L A;  3CCM P;  2GZE A;  2KGD A;  1YIT P;  1K73 Q;  2XZ1 C;  2QA4 P;  4IZ6 A;  2QEX P;  2VLQ A;  2XZ0 D;  1ZNV A;  2JYG A;  2L9F A;  1YI2 P;  3NY7 B;  2PEJ A;  3CC4 P;  4MRT C;  2LOL A;  3G0V A;  1VQ5 P;  1DV5 A;  1T8K A;  2LL8 A;  2PEO A;  2N6Y A;  2K94 A;  3GJN A;  2L6E A;  1K8A Q;  3EJE A;  2KOP A;  1YJ9 P;  3B5I A;  4HKG A;  3GZM A;  2FQ1 A;  3DPH A;  5CZD B;  2EHS A;  4UHP B;  4QNB A;  5I4T G;  1L0H A;  2Z45 A;  3LMO A;  4H2Y C;  2JO0 A;  1VQ8 P;  1KQS O;  5DCK A;  1X3O A;  4PWV B;  4U0B A;  3CCS P;  3CE7 A;  3DTJ A;  1YJN P;  4H2X C;  1EIA A;  1W2B O;  3DS4 A;  1HY8 A;  1QVF O;  2OTL P;  2CNR A;  4PXH B;  4QKO A;  2CWO A;  1M6E X;  1KC8 Q;  2VLP A;  2LKI A;  1Q81 Q;  2BHV A;  1BXI A;  1M1K Q;  3CD6 P;  5HGL A;  2PEK A;  2JU2 A;  2JYL A;  2KOS A;  5HVC A;  3CMA P;  5EW5 E;  2L22 A;  2CQ8 A;  1GPJ A;  2LPK A;  4XFZ A;  4XFY A;  2FVA A;  2KG6 A;  3G29 A;  2E1M A;  4DG9 A;  3GKL C;  2PY8 A;  2FAE A;  1QVG O;  2AFE A;  3CME P;  1IUQ A;  2CGQ A;  3E2D A;  2AFD A;  3CCJ P;  1Q82 Q;  2OTJ P;  2JGP A;  4IPY A;  3G28 A;  3RG6 C;  1NQ4 A;  4XRO A;  1EMV A;  2N5H A;  3G21 A;  1M74 A;  2GDW A;  2MR8 A;  2VLN A;  5EJD A;  3DS3 A;  3MGE A;  2JQ4 A;  2JAZ A;  3G1G A;  2GZG A;  1EOQ A;  7CEI A;  2M5R A;  2DNW A;  2VLO A;  2GZJ A;  2DGY A;  1YJW P;  3G4S P;  1VQO P;  2XXM A;  2PEI A;  1GXH A;  3CCV P;  2N6Z A;  3DS2 A;  3B4Q A;  1S72 P;  2KR5 A;  2EHT A;  2PEQ A;  1L0I A;  2N98 A;  4BPH A;  3HYB A;  5F2O A;  2JB0 A;  5F2K A;  3CC2 P;  4BPG A;  3CCQ P;  1FR2 A;  2JU1 A;  2KOR A;  5F2N A;  2FHS C;  3CCR P;  4XFX A;  2XT1 A;  1A43 A;  2M8P A;  1N8R Q;  3CCL P;  2OAR A;  3DS1 A;  2N5I A;  1HQB A;  1VKU A;  4BPF A;  1ACP A;  2GZI A;  3WBH A;  3GZL A;  2X2B A;  4COC A;  2MF4 A;  2LIW A;  1DNY A;  4GR2 A;  2FQ0 A;  1VQK P;  1VHN A;  1MZ8 A;  1IMP A;  2BUO A;  1RO0 A;  5KP7 B; 
#chains in the Genus database with same CATH homology
 4IZ6 A;  2FVF A;  2XZ0 D;  2L9F A;  3NY7 B;  1OR5 A;  2MD9 A;  2FAE A;  5KP8 B;  4MRT C;  2AFE A;  2FAD A;  2LOL A;  2CGQ A;  2AFD A;  1DV5 A;  2JGP A;  2LML A;  2LTE A;  1NQ4 A;  1T8K A;  2KW2 A;  2LL8 A;  2K92 A;  2N5H A;  2N6Y A;  2GDW A;  2K94 A;  2LIU A;  2AF8 A;  3EJE A;  2KOP A;  2MR8 A;  2AVA A;  5EJD A;  2N50 A;  4HKG A;  3GZM A;  2FQ1 A;  2JQ4 A;  5CZD B;  2EHS A;  2GDX A;  2M5R A;  2PNG A;  2DNW A;  2L0Q A;  2KG8 A;  1L0H A;  3LMO A;  4H2Y C;  1AF8 A;  5HV8 A;  2VSQ A;  2MVV A;  2CG5 B;  1X3O A;  4PWV B;  2K93 A;  2N6Z A;  3CE7 A;  2L4B A;  2MVU A;  2QNW A;  4H2X C;  2KR5 A;  2EHT A;  3EJB A;  2KOQ A;  1L0I A;  2FVE A;  2GDY A;  2K0X A;  2KGA A;  2MY5 A;  1HY8 A;  2N98 A;  4BPH A;  2CNR A;  2KGE A;  4PXH B;  2KOO A;  2FQ2 A;  4BPG A;  2JU1 A;  2ROQ A;  3RG2 A;  2KOR A;  5KP6 B;  2FAC A;  2LKI A;  2K0Y A;  2FHS C;  1KLP A;  2KG9 A;  2KWL A;  2MR7 A;  2N5I A;  1HQB A;  1VKU A;  2K2Q A;  4NEO A;  4BPF A;  4CA3 A;  1ACP A;  3GZL A;  2JU2 A;  3EJD A;  2KOS A;  2X2B A;  5HVC A;  2L22 A;  2MF4 A;  2CQ8 A;  2LIW A;  1DNY A;  4H2W C;  2KGC A;  2FQ0 A;  2LPK A;  2FVA A;  2KGD A;  2KG6 A;  1F80 D;  4R0M A;  2XZ1 C;  5KP7 B;  4DG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...