1X3OA

Crystal structure of the acyl carrier protein from thermus thermophilus hb8
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
80
structure length
80
Chain Sequence
MTEQEIFEKVKAVIADKLQVEPEKVTLEARFIEDLGADSLDTVELIMGLEDEFGLEISDEEAEKIRTVKDAVEYIKAKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords acyl carrier protein
publication title Crystal structure of the acyl carrier protein from thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 26
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2005-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1x3oA00
2L0QA 4H2WC 2KG9A 4PWVB 2KG6A 2N5IA 2KOOA 2PNGA 2KGDA 1X3OA 2GDYA 1ACPA 4PXHB 2VSQA 2AVAA 2KG8A 1HY8A 2EHTA 2X2BA 2FACA 2M5RA 2MY5A 2CG5B 2XZ0D 2CGQA 2MF4A 2L22A 2GDWA 2N6YA 2FVAA 2LTEA 2AFEA 2LMLA 2CQ8A 1DV5A 2LKIA 4DG9A 1OR5A 2KGCA 1F80D 1T8KA 1L0IA 2EHSA 5KP7B 2JU1A 2KOPA 2KR5A 2KORA 4IZ6A 2QNWA 4BPFA 4CA3A 2LPKA 4MRTC 2MVUA 1KLPA 5HV8A 2KOQA 2FVEA 3EJBA 2JGPA 2MVVA 4BPGA 2XZ1C 5CZDB 3NY7B 2K0XA 4HKGA 1HQBA 2N50A 3EJDA 3GZMA 2JU2A 2K94A 3EJEA 5KP6B 2ROQA 2AFDA 2LIWA 2KGEA 2FVFA 3LMOA 2L4BA 5HVCA 2K92A 2KW2A 4R0MA 2CNRA 2KGAA 2FAEA 4H2YC 2LL8A 4BPHA 2K2QA 2MD9A 2FQ2A 2L9FA 2MR8A 2FQ1A 2DNWA 2N6ZA 2K0YA 3GZLA 2FHSC 4H2XC 4NEOA 3CE7A 5KP8B 2LIUA 2MR7A 2KOSA 2KWLA 2AF8A 2GDXA 2N5HA 1VKUA 2FQ0A 2K93A 1DNYA 1NQ4A 2LOLA 2FADA 1L0HA 3RG2A 5EJDA 2JQ4A 1AF8A 2N98A
chains in the Genus database with same CATH superfamily
4H2WC 4XRQA 1M1KQ 4COCA 4XFXA 2VSQA 2KG8A 1HY8A 4GR2A 2EHTA 2L6EA 2JB0A 2CG5B 2CGQA 5EW5E 1M90Q 2JAZA 2AFEA 2LMLA 2OTJP 2LKIA 1YJNP 1OR5A 3CD6P 1F80D 3I55P 2EHSA 3DS4A 2JU1A 2KR5A 2KORA 3G26A 1QVGO 2LPKA 4PH0A 2KOQA 2GZIA 1K73Q 2K0DX 1ZNVA 3G28A 2PEJA 3DPHA 3NY7B 2VLOA 2K0XA 4HKGA 3GZMA 2GZGA 3I56P 2BHVA 2K94A 1EIAA 3EJEA 4XROA 2AFDA 3DS1A 2KGEA 1YJ9P 1Q86Q 3LMOA 1K9MQ 2L4BA 3E2DA 4R0MA 2ONTA 1EMVA 4U0EA 1VQ4P 3Q20A 5HGLA 2K2QA 3G1GA 2L9FA 2Z45A 2JYLA 1Z6MA 1Q82Q 2P9XA 2OTLP 1GPJA 2LIUA 2MR7A 2JYGA 1VQ8P 2GDXA 3HYBA 1DNYA 1NQ4A 3RG2A 2M8NA 3G6EP 4QNBA 1AF8A 3DS5A 2KG9A 2PEOA 4UHPB 1VQMP 1YHQP 5F2OA 1X3OA 3CC7P 2M5RA 2MY5A 2ERHA 3CCMP 2L22A 2M8LA 2FVAA 3GKLC 2CQ8A 1YIJP 1DV5A 1RO0A 2XXMA 3P05A 3LRYA 3CCLP 1L0IA 1VQPP 2LF4A 2QNWA 4WYMA 4CA3A 1BXIA 2MVUA 3CCSP 2VLPA 5CZDB 3CCRP 3H4EA 2BUOA 4QKOA 1HQBA 2JU2A 4U0FA 4IPYA 1RO2A 1RNIA 2FVFA 2KODA 5HVCA 2QA4P 3G1IA 2KW2A 2FQ2A 1KQSO 2XV6A 2FQ1A 4XFZA 1BAJA 4F37A 4H2XC 4NEOA 3CE7A 2KWLA 5F2KA 1JJ2O 2AF8A 4M0IA 1MZ8A 1VKUA 4XFYA 1IMPA 2K93A 1N8RQ 2FADA 2PENA 1S72P 1M74A 2E1MA 2N98A 2L0QA 1EOQA 3OW2O 1KC8Q 2KOOA 3NTEA 1VQ6P 2GZFA 4U0CA 3M1MA 1ACPA 2GYKA 1A43A 2X2BA 2FACA 5I4TG 1Q7YQ 3U43A 3CCVP 2XZ0D 2MF4A 2K5XA 4COPA 3G21A 3H47A 5DCKA 1D1DA 3B4QA 2KGCA 1T8KA 2JBGA 1ZMBA 3HZQA 4BPFA 5BS1A 4MRTC 1AUMA 2NO8A 1NJIQ 2QEXP 1VHNA 1KLPA 5HV8A 5HGNA 1VQ7P 2FVEA 2GZEA 2CWOA 4PH1A 2MVVA 4GR6A 2XZ1C 4BPGA 2VLQA 5BS2A 1VQ5P 3EJDA 1E0HA 1K8AQ 2PY8A 2ROQA 3DS0A 2LIWA 2PEIA 1Q81Q 4U0AA 2OARA 1VQNP 2K92A 3CCJP 4U0DA 5HGMA 2FAEA 2LL8A 1VQLP 3CCUP 1GXHA 2MD9A 1GXGA 2PEMA 2DNWA 3CC4P 5KP8B 1VQOP 3CCQP 1IUQA 3G29A 4U0BA 2FQ0A 2XT1A 1YITP 3WBHA 2WPTA 2M8PA 3CCEP 5EJDA 5HGOA 3MGEA 3CXCO 4PWVB 3VRLC 2KG6A 2N5IA 1QRJA 3DS3A 3RG6C 1E6JP 2PNGA 2KGDA 2VLNA 2GDYA 2PEKA 4PXHB 2AVAA 3H0DA 3DTJA 1FR2A 2GDWA 2N6YA 1YI2P 2LTEA 1QVFO 2Z46A 4DG9A 5KP7B 2Z44A 2KOPA 1KD1Q 3G71P 4IZ6A 1VQKP 2EFJA 1K30A 3EJBA 2JGPA 7CEIA 3GJNA 2N50A 2JO0A 5KP6B 2EG5A 3B5IA 1VQ9P 2EIAA 3G0VA 1M6EX 3DS2A 3G4SP 2CNRA 2KGAA 1IMQA 1A8OA 4H2YC 5F2NA 5JPAA 4BPHA 3CMEP 1W2BO 2MR8A 2GZJA 2N6ZA 2K0YA 3GZLA 1M6NA 2FHSC 3CC2P 1UJZA 2KOSA 2N5HA 3CMAP 3CPWO 1YJWP 2LOLA 2PEQA 2DGYA 1AYIA 1UNKA 1L0HA 2JQ4A 1CEIA
chains in the Genus database with same CATH topology
2L0QA 4H2WC 2KG9A 4PWVB 2KG6A 2N5IA 2KOOA 2PNGA 2KGDA 1X3OA 2GDYA 1ACPA 4PXHB 2VSQA 2AVAA 2KG8A 1HY8A 2EHTA 2X2BA 2FACA 2M5RA 2MY5A 2CG5B 2XZ0D 2CGQA 2MF4A 2L22A 2GDWA 2N6YA 2FVAA 2LTEA 2AFEA 2LMLA 2CQ8A 1DV5A 2LKIA 4DG9A 1OR5A 2KGCA 1F80D 1T8KA 1L0IA 2EHSA 5KP7B 2JU1A 2KOPA 2KR5A 2KORA 4IZ6A 2QNWA 4BPFA 4CA3A 2LPKA 4MRTC 2MVUA 1KLPA 5HV8A 2KOQA 2FVEA 3EJBA 2JGPA 2MVVA 4BPGA 2XZ1C 5CZDB 3NY7B 2K0XA 4HKGA 1HQBA 2N50A 3EJDA 3GZMA 2JU2A 2K94A 3EJEA 5KP6B 2ROQA 2AFDA 2LIWA 2KGEA 2FVFA 3LMOA 2L4BA 5HVCA 2K92A 2KW2A 4R0MA 2CNRA 2KGAA 2FAEA 4H2YC 2LL8A 4BPHA 2K2QA 2MD9A 2FQ2A 2L9FA 2MR8A 2FQ1A 2DNWA 2N6ZA 2K0YA 3GZLA 2FHSC 4H2XC 4NEOA 3CE7A 5KP8B 2LIUA 2MR7A 2KOSA 2KWLA 2AF8A 2GDXA 2N5HA 1VKUA 2FQ0A 2K93A 1DNYA 1NQ4A 2LOLA 2FADA 1L0HA 3RG2A 5EJDA 2JQ4A 1AF8A 2N98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0Q A;  4H2W C;  2KG9 A;  4PWV B;  2KG6 A;  2N5I A;  2KOO A;  2PNG A;  2KGD A;  1X3O A;  2GDY A;  1ACP A;  4PXH B;  2VSQ A;  2AVA A;  2KG8 A;  1HY8 A;  2EHT A;  2X2B A;  2FAC A;  2M5R A;  2MY5 A;  2CG5 B;  2XZ0 D;  2CGQ A;  2MF4 A;  2L22 A;  2GDW A;  2N6Y A;  2FVA A;  2LTE A;  2AFE A;  2LML A;  2CQ8 A;  1DV5 A;  2LKI A;  4DG9 A;  1OR5 A;  2KGC A;  1F80 D;  1T8K A;  1L0I A;  2EHS A;  5KP7 B;  2JU1 A;  2KOP A;  2KR5 A;  2KOR A;  4IZ6 A;  2QNW A;  4BPF A;  4CA3 A;  2LPK A;  4MRT C;  2MVU A;  1KLP A;  5HV8 A;  2KOQ A;  2FVE A;  3EJB A;  2JGP A;  2MVV A;  4BPG A;  2XZ1 C;  5CZD B;  3NY7 B;  2K0X A;  4HKG A;  1HQB A;  2N50 A;  3EJD A;  3GZM A;  2JU2 A;  2K94 A;  3EJE A;  5KP6 B;  2ROQ A;  2AFD A;  2LIW A;  2KGE A;  2FVF A;  3LMO A;  2L4B A;  5HVC A;  2K92 A;  2KW2 A;  4R0M A;  2CNR A;  2KGA A;  2FAE A;  4H2Y C;  2LL8 A;  4BPH A;  2K2Q A;  2MD9 A;  2FQ2 A;  2L9F A;  2MR8 A;  2FQ1 A;  2DNW A;  2N6Z A;  2K0Y A;  3GZL A;  2FHS C;  4H2X C;  4NEO A;  3CE7 A;  5KP8 B;  2LIU A;  2MR7 A;  2KOS A;  2KWL A;  2AF8 A;  2GDX A;  2N5H A;  1VKU A;  2FQ0 A;  2K93 A;  1DNY A;  1NQ4 A;  2LOL A;  2FAD A;  1L0H A;  3RG2 A;  5EJD A;  2JQ4 A;  1AF8 A;  2N98 A; 
#chains in the Genus database with same CATH topology
 4H2W C;  4XRQ A;  1M1K Q;  4COC A;  4XFX A;  2VSQ A;  2KG8 A;  1HY8 A;  4GR2 A;  2EHT A;  2L6E A;  2JB0 A;  2CG5 B;  2CGQ A;  5EW5 E;  1M90 Q;  2JAZ A;  2AFE A;  2LML A;  2OTJ P;  2LKI A;  1YJN P;  1OR5 A;  3CD6 P;  1F80 D;  3I55 P;  2EHS A;  3DS4 A;  2JU1 A;  2KR5 A;  2KOR A;  3G26 A;  1QVG O;  2LPK A;  4PH0 A;  2KOQ A;  2GZI A;  1K73 Q;  2K0D X;  1ZNV A;  3G28 A;  2PEJ A;  3DPH A;  3NY7 B;  2VLO A;  2K0X A;  4HKG A;  3GZM A;  2GZG A;  3I56 P;  2BHV A;  2K94 A;  1EIA A;  3EJE A;  4XRO A;  2AFD A;  3DS1 A;  2KGE A;  1YJ9 P;  1Q86 Q;  3LMO A;  1K9M Q;  2L4B A;  3E2D A;  4R0M A;  2ONT A;  1EMV A;  4U0E A;  1VQ4 P;  3Q20 A;  5HGL A;  2K2Q A;  3G1G A;  2L9F A;  2Z45 A;  2JYL A;  1Z6M A;  1Q82 Q;  2P9X A;  2OTL P;  1GPJ A;  2LIU A;  2MR7 A;  2JYG A;  1VQ8 P;  2GDX A;  3HYB A;  1DNY A;  1NQ4 A;  3RG2 A;  2M8N A;  3G6E P;  4QNB A;  1AF8 A;  3DS5 A;  2KG9 A;  2PEO A;  4UHP B;  1VQM P;  1YHQ P;  5F2O A;  1X3O A;  3CC7 P;  2M5R A;  2MY5 A;  2ERH A;  3CCM P;  2L22 A;  2M8L A;  2FVA A;  3GKL C;  2CQ8 A;  1YIJ P;  1DV5 A;  1RO0 A;  2XXM A;  3P05 A;  3LRY A;  3CCL P;  1L0I A;  1VQP P;  2LF4 A;  2QNW A;  4WYM A;  4CA3 A;  1BXI A;  2MVU A;  3CCS P;  2VLP A;  5CZD B;  3CCR P;  3H4E A;  2BUO A;  4QKO A;  1HQB A;  2JU2 A;  4U0F A;  4IPY A;  1RO2 A;  1RNI A;  2FVF A;  2KOD A;  5HVC A;  2QA4 P;  3G1I A;  2KW2 A;  2FQ2 A;  1KQS O;  2XV6 A;  2FQ1 A;  4XFZ A;  1BAJ A;  4F37 A;  4H2X C;  4NEO A;  3CE7 A;  2KWL A;  5F2K A;  1JJ2 O;  2AF8 A;  4M0I A;  1MZ8 A;  1VKU A;  4XFY A;  1IMP A;  2K93 A;  1N8R Q;  2FAD A;  2PEN A;  1S72 P;  1M74 A;  2E1M A;  2N98 A;  2L0Q A;  1EOQ A;  3OW2 O;  1KC8 Q;  2KOO A;  3NTE A;  1VQ6 P;  2GZF A;  4U0C A;  3M1M A;  1ACP A;  2GYK A;  1A43 A;  2X2B A;  2FAC A;  5I4T G;  1Q7Y Q;  3U43 A;  3CCV P;  2XZ0 D;  2MF4 A;  2K5X A;  4COP A;  3G21 A;  3H47 A;  5DCK A;  1D1D A;  3B4Q A;  2KGC A;  1T8K A;  2JBG A;  1ZMB A;  3HZQ A;  4BPF A;  5BS1 A;  4MRT C;  1AUM A;  2NO8 A;  1NJI Q;  2QEX P;  1VHN A;  1KLP A;  5HV8 A;  5HGN A;  1VQ7 P;  2FVE A;  2GZE A;  2CWO A;  4PH1 A;  2MVV A;  4GR6 A;  2XZ1 C;  4BPG A;  2VLQ A;  5BS2 A;  1VQ5 P;  3EJD A;  1E0H A;  1K8A Q;  2PY8 A;  2ROQ A;  3DS0 A;  2LIW A;  2PEI A;  1Q81 Q;  4U0A A;  2OAR A;  1VQN P;  2K92 A;  3CCJ P;  4U0D A;  5HGM A;  2FAE A;  2LL8 A;  1VQL P;  3CCU P;  1GXH A;  2MD9 A;  1GXG A;  2PEM A;  2DNW A;  3CC4 P;  5KP8 B;  1VQO P;  3CCQ P;  1IUQ A;  3G29 A;  4U0B A;  2FQ0 A;  2XT1 A;  1YIT P;  3WBH A;  2WPT A;  2M8P A;  3CCE P;  5EJD A;  5HGO A;  3MGE A;  3CXC O;  4PWV B;  3VRL C;  2KG6 A;  2N5I A;  1QRJ A;  3DS3 A;  3RG6 C;  1E6J P;  2PNG A;  2KGD A;  2VLN A;  2GDY A;  2PEK A;  4PXH B;  2AVA A;  3H0D A;  3DTJ A;  1FR2 A;  2GDW A;  2N6Y A;  1YI2 P;  2LTE A;  1QVF O;  2Z46 A;  4DG9 A;  5KP7 B;  2Z44 A;  2KOP A;  1KD1 Q;  3G71 P;  4IZ6 A;  1VQK P;  2EFJ A;  1K30 A;  3EJB A;  2JGP A;  7CEI A;  3GJN A;  2N50 A;  2JO0 A;  5KP6 B;  2EG5 A;  3B5I A;  1VQ9 P;  2EIA A;  3G0V A;  1M6E X;  3DS2 A;  3G4S P;  2CNR A;  2KGA A;  1IMQ A;  1A8O A;  4H2Y C;  5F2N A;  5JPA A;  4BPH A;  3CME P;  1W2B O;  2MR8 A;  2GZJ A;  2N6Z A;  2K0Y A;  3GZL A;  1M6N A;  2FHS C;  3CC2 P;  1UJZ A;  2KOS A;  2N5H A;  3CMA P;  3CPW O;  1YJW P;  2LOL A;  2PEQ A;  2DGY A;  1AYI A;  1UNK A;  1L0H A;  2JQ4 A;  1CEI A; 
#chains in the Genus database with same CATH homology
 2L0Q A;  4H2W C;  2KG9 A;  4PWV B;  2KG6 A;  2N5I A;  2KOO A;  2PNG A;  2KGD A;  1X3O A;  2GDY A;  1ACP A;  4PXH B;  2VSQ A;  2AVA A;  2KG8 A;  1HY8 A;  2EHT A;  2X2B A;  2FAC A;  2M5R A;  2MY5 A;  2CG5 B;  2XZ0 D;  2CGQ A;  2MF4 A;  2L22 A;  2GDW A;  2N6Y A;  2FVA A;  2LTE A;  2AFE A;  2LML A;  2CQ8 A;  1DV5 A;  2LKI A;  4DG9 A;  1OR5 A;  2KGC A;  1F80 D;  1T8K A;  1L0I A;  2EHS A;  5KP7 B;  2JU1 A;  2KOP A;  2KR5 A;  2KOR A;  4IZ6 A;  2QNW A;  4BPF A;  4CA3 A;  2LPK A;  4MRT C;  2MVU A;  1KLP A;  5HV8 A;  2KOQ A;  2FVE A;  3EJB A;  2JGP A;  2MVV A;  4BPG A;  2XZ1 C;  5CZD B;  3NY7 B;  2K0X A;  4HKG A;  1HQB A;  2N50 A;  3EJD A;  3GZM A;  2JU2 A;  2K94 A;  3EJE A;  5KP6 B;  2ROQ A;  2AFD A;  2LIW A;  2KGE A;  2FVF A;  3LMO A;  2L4B A;  5HVC A;  2K92 A;  2KW2 A;  4R0M A;  2CNR A;  2KGA A;  2FAE A;  4H2Y C;  2LL8 A;  4BPH A;  2K2Q A;  2MD9 A;  2FQ2 A;  2L9F A;  2MR8 A;  2FQ1 A;  2DNW A;  2N6Z A;  2K0Y A;  3GZL A;  2FHS C;  4H2X C;  4NEO A;  3CE7 A;  5KP8 B;  2LIU A;  2MR7 A;  2KOS A;  2KWL A;  2AF8 A;  2GDX A;  2N5H A;  1VKU A;  2FQ0 A;  2K93 A;  1DNY A;  1NQ4 A;  2LOL A;  2FAD A;  1L0H A;  3RG2 A;  5EJD A;  2JQ4 A;  1AF8 A;  2N98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...