1X3OA

Crystal structure of the acyl carrier protein from thermus thermophilus hb8
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
80
structure length
80
Chain Sequence
MTEQEIFEKVKAVIADKLQVEPEKVTLEARFIEDLGADSLDTVELIMGLEDEFGLEISDEEAEKIRTVKDAVEYIKAKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acyl carrier protein
publication title Crystal structure of the acyl carrier protein from thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Lipid transport
total genus 26
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2005-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1x3oA00
2AF8A 4PWVB 5HV8A 2CG5B 2JGPA 2LTEA 4BPGA 2KOPA 3NY7B 4NEOA 1L0HA 2L4BA 2N5IA 3GZLA 2LOLA 2GDXA 2K0YA 4H2YC 2KG8A 3LMOA 5KP6B 5KP8B 1DV5A 1X3OA 2GDWA 2DNWA 2FQ2A 2EHTA 4PXHB 4IZ6A 2KW2A 2XZ1C 3RG2A 2K2QA 3EJEA 2EHSA 1F80D 4CA3A 3GZMA 2FQ0A 2AFDA 1ACPA 1HQBA 1DNYA 2GDYA 2MVVA 2LMLA 2L9FA 2XZ0D 5CZDB 2FQ1A 2M5RA 2VSQA 2KOQA 2KWLA 2MY5A 3EJBA 5KP7B 2KG9A 2LKIA 2KGEA 5HVCA 2LPKA 1KLPA 3CE7A 2LIUA 2FVFA 2K94A 4BPHA 1HY8A 2PNGA 2CGQA 2FADA 5EJDA 1NQ4A 2FAEA 3EJDA 2FVAA 2AFEA 2N6YA 2ROQA 2KR5A 2MR7A 2KGCA 4DG9A 2CQ8A 2KGDA 2KORA 2N5HA 2CNRA 1T8KA 2KOOA 1L0IA 2L22A 4R0MA 2QNWA 2KOSA 1VKUA 1AF8A 2K92A 2N98A 2X2BA 2JU1A 2FVEA 2LIWA 2N50A 2KG6A 2L0QA 2N6ZA 2K93A 4H2WC 2FHSC 2JU2A 2KGAA 2MVUA 4HKGA 2LL8A 2AVAA 2FACA 4BPFA 1OR5A 2MF4A 4MRTC 2K0XA 4H2XC 2JQ4A 2MD9A 2MR8A
chains in the Genus database with same CATH superfamily
4PWVB 2PEIA 2KODA 1VQ9P 4NEOA 1L0HA 2N5IA 2K0YA 5KP6B 4XROA 1QRJA 1YHQP 3HZQA 4U0BA 2XV6A 2DNWA 2PEJA 1ZMBA 2JB0A 1RO0A 3Q20A 2EG5A 4CA3A 1UNKA 2FQ0A 3G1GA 4UHPB 3OW2O 2OTLP 1M6NA 2L9FA 2XZ0D 1K9MQ 2OARA 1IMQA 2DGYA 2PEKA 2MY5A 1NJIQ 1Q81Q 3DS2A 3G4SP 2LPKA 1KLPA 1EOQA 3WBHA 1VQ4P 2PNGA 1EMVA 1NQ4A 1UJZA 1ZNVA 2CWOA 1VQMP 2KR5A 2CQ8A 2KGDA 2CNRA 1T8KA 2KOOA 2L22A 3H0DA 1VKUA 5F2NA 1YJWP 4XFZA 2JU1A 5HGLA 2JYLA 2KG6A 3G21A 4IPYA 4U0EA 1GXHA 1JJ2O 4MRTC 2K0XA 3CC7P 2JQ4A 3DS5A 4GR2A 1A43A 5HV8A 4BPGA 3CD6P 2E1MA 2GDXA 1D1DA 4H2YC 1VQKP 3GKLC 3CCQP 4PH0A 1DV5A 2P9XA 1FR2A 4M0IA 1X3OA 2GDWA 4COPA 1GXGA 4PXHB 3H47A 3RG2A 2K2QA 2EHSA 1F80D 3CCJP 3GZMA 2XT1A 1ACPA 1Q7YQ 1HQBA 1DNYA 1VQOP 2LMLA 5CZDB 2FQ1A 1VQLP 2M5RA 2KOQA 2Z46A 3DS3A 3B5IA 3CE7A 2BUOA 4BPHA 5EJDA 2FADA 1YIJP 1KC8Q 3EJDA 2FVAA 2AFEA 2MR7A 2KORA 3E2DA 1L0IA 3CMAP 2N50A 1BXIA 2K93A 5I4TG 1M6EX 1E6JP 3CCVP 2JBGA 4PH1A 2M8LA 2MVUA 1YI2P 4U0CA 2Z44A 2AVAA 4BPFA 3CCRP 3CCSP 7CEIA 3CXCO 4H2XC 4WYMA 1YJ9P 1RNIA 1EIAA 2MD9A 1AF8A 2VLNA 2JGPA 2JO0A 3G1IA 2LTEA 1KD1Q 2GZJA 2KOPA 2L4BA 3GZLA 4U0DA 1IMPA 3M1MA 2LOLA 3DPHA 3NTEA 5F2KA 2VLQA 4U0AA 5KP8B 1K73Q 2GZGA 1VHNA 3G71P 3RG6C 3DS4A 1GPJA 2PEOA 1YJNP 1Z6MA 2K5XA 1K30A 2K0DX 2FQ2A 5DCKA 4IZ6A 1M74A 2XZ1C 3EJEA 3DTJA 1N8RQ 5JPAA 3G28A 1A8OA 2VSQA 1MZ8A 2KWLA 1BAJA 5EW5E 2KGEA 5HVCA 2LF4A 4XRQA 2FVFA 1HY8A 2M8PA 5F2OA 2FAEA 2N6YA 2ROQA 1IUQA 2KGCA 3LRYA 3MGEA 4R0MA 2KOSA 5HGMA 2N98A 2X2BA 1M90Q 2NO8A 3G0VA 1VQ5P 2M8NA 3CMEP 2L0QA 2ERHA 1K8AQ 3G26A 3P05A 2PEQA 3CC2P 3VRLC 3B4QA 2FHSC 2JU2A 1VQPP 1VQ6P 4XFXA 4F37A 4HKGA 2LL8A 1AUMA 2FACA 4QKOA 1OR5A 3G29A 1Q86Q 2JYGA 2GZIA 1KQSO 3DS1A 3CCUP 2OTJP 2MR8A 2AF8A 1RO2A 2CG5B 3CCLP 3CCMP 3NY7B 4U0FA 2PY8A 3GJNA 3G6EP 2KG8A 3LMOA 2BHVA 1VQ8P 2PENA 2GZFA 4QNBA 3CCEP 3H4EA 2EHTA 2KW2A 2QA4P 1YITP 2Z45A 2AFDA 5BS1A 2GYKA 2GDYA 2MVVA 1W2BO 1VQ7P 4COCA 3EJBA 2GZEA 5KP7B 2KG9A 2LKIA 3I56P 1E0HA 2EIAA 2LIUA 2K94A 2CGQA 2L6EA 1CEIA 4DG9A 5HGNA 4XFYA 1S72P 2N5HA 5HGOA 3U43A 1QVFO 2EFJA 4GR6A 2QNWA 3CC4P 2K92A 2VLOA 5BS2A 3I55P 2FVEA 2LIWA 2ONTA 2N6ZA 3DS0A 1Q82Q 4H2WC 3CPWO 2QEXP 1AYIA 1QVGO 2KGAA 2WPTA 3HYBA 2VLPA 2MF4A 2PEMA 2JAZA 2XXMA 1M1KQ 1VQNP
chains in the Genus database with same CATH topology
2AF8A 4PWVB 5HV8A 2CG5B 2JGPA 2LTEA 4BPGA 2KOPA 3NY7B 4NEOA 1L0HA 2L4BA 2N5IA 3GZLA 2LOLA 2GDXA 2K0YA 4H2YC 2KG8A 3LMOA 5KP6B 5KP8B 1DV5A 1X3OA 2GDWA 2DNWA 2FQ2A 2EHTA 4PXHB 4IZ6A 2KW2A 2XZ1C 3RG2A 2K2QA 3EJEA 2EHSA 1F80D 4CA3A 3GZMA 2FQ0A 2AFDA 1ACPA 1HQBA 1DNYA 2GDYA 2MVVA 2LMLA 2L9FA 2XZ0D 5CZDB 2FQ1A 2M5RA 2VSQA 2KOQA 2KWLA 2MY5A 3EJBA 5KP7B 2KG9A 2LKIA 2KGEA 5HVCA 2LPKA 1KLPA 3CE7A 2LIUA 2FVFA 2K94A 4BPHA 1HY8A 2PNGA 2CGQA 2FADA 5EJDA 1NQ4A 2FAEA 3EJDA 2FVAA 2AFEA 2N6YA 2ROQA 2KR5A 2MR7A 2KGCA 4DG9A 2CQ8A 2KGDA 2KORA 2N5HA 2CNRA 1T8KA 2KOOA 1L0IA 2L22A 4R0MA 2QNWA 2KOSA 1VKUA 1AF8A 2K92A 2N98A 2X2BA 2JU1A 2FVEA 2LIWA 2N50A 2KG6A 2L0QA 2N6ZA 2K93A 4H2WC 2FHSC 2JU2A 2KGAA 2MVUA 4HKGA 2LL8A 2AVAA 2FACA 4BPFA 1OR5A 2MF4A 4MRTC 2K0XA 4H2XC 2JQ4A 2MD9A 2MR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AF8 A;  4PWV B;  5HV8 A;  2CG5 B;  2JGP A;  2LTE A;  4BPG A;  2KOP A;  3NY7 B;  4NEO A;  1L0H A;  2L4B A;  2N5I A;  3GZL A;  2LOL A;  2GDX A;  2K0Y A;  4H2Y C;  2KG8 A;  3LMO A;  5KP6 B;  5KP8 B;  1DV5 A;  1X3O A;  2GDW A;  2DNW A;  2FQ2 A;  2EHT A;  4PXH B;  4IZ6 A;  2KW2 A;  2XZ1 C;  3RG2 A;  2K2Q A;  3EJE A;  2EHS A;  1F80 D;  4CA3 A;  3GZM A;  2FQ0 A;  2AFD A;  1ACP A;  1HQB A;  1DNY A;  2GDY A;  2MVV A;  2LML A;  2L9F A;  2XZ0 D;  5CZD B;  2FQ1 A;  2M5R A;  2VSQ A;  2KOQ A;  2KWL A;  2MY5 A;  3EJB A;  5KP7 B;  2KG9 A;  2LKI A;  2KGE A;  5HVC A;  2LPK A;  1KLP A;  3CE7 A;  2LIU A;  2FVF A;  2K94 A;  4BPH A;  1HY8 A;  2PNG A;  2CGQ A;  2FAD A;  5EJD A;  1NQ4 A;  2FAE A;  3EJD A;  2FVA A;  2AFE A;  2N6Y A;  2ROQ A;  2KR5 A;  2MR7 A;  2KGC A;  4DG9 A;  2CQ8 A;  2KGD A;  2KOR A;  2N5H A;  2CNR A;  1T8K A;  2KOO A;  1L0I A;  2L22 A;  4R0M A;  2QNW A;  2KOS A;  1VKU A;  1AF8 A;  2K92 A;  2N98 A;  2X2B A;  2JU1 A;  2FVE A;  2LIW A;  2N50 A;  2KG6 A;  2L0Q A;  2N6Z A;  2K93 A;  4H2W C;  2FHS C;  2JU2 A;  2KGA A;  2MVU A;  4HKG A;  2LL8 A;  2AVA A;  2FAC A;  4BPF A;  1OR5 A;  2MF4 A;  4MRT C;  2K0X A;  4H2X C;  2JQ4 A;  2MD9 A;  2MR8 A; 
#chains in the Genus database with same CATH topology
 4PWV B;  2PEI A;  2KOD A;  1VQ9 P;  4NEO A;  1L0H A;  2N5I A;  2K0Y A;  5KP6 B;  4XRO A;  1QRJ A;  1YHQ P;  3HZQ A;  4U0B A;  2XV6 A;  2DNW A;  2PEJ A;  1ZMB A;  2JB0 A;  1RO0 A;  3Q20 A;  2EG5 A;  4CA3 A;  1UNK A;  2FQ0 A;  3G1G A;  4UHP B;  3OW2 O;  2OTL P;  1M6N A;  2L9F A;  2XZ0 D;  1K9M Q;  2OAR A;  1IMQ A;  2DGY A;  2PEK A;  2MY5 A;  1NJI Q;  1Q81 Q;  3DS2 A;  3G4S P;  2LPK A;  1KLP A;  1EOQ A;  3WBH A;  1VQ4 P;  2PNG A;  1EMV A;  1NQ4 A;  1UJZ A;  1ZNV A;  2CWO A;  1VQM P;  2KR5 A;  2CQ8 A;  2KGD A;  2CNR A;  1T8K A;  2KOO A;  2L22 A;  3H0D A;  1VKU A;  5F2N A;  1YJW P;  4XFZ A;  2JU1 A;  5HGL A;  2JYL A;  2KG6 A;  3G21 A;  4IPY A;  4U0E A;  1GXH A;  1JJ2 O;  4MRT C;  2K0X A;  3CC7 P;  2JQ4 A;  3DS5 A;  4GR2 A;  1A43 A;  5HV8 A;  4BPG A;  3CD6 P;  2E1M A;  2GDX A;  1D1D A;  4H2Y C;  1VQK P;  3GKL C;  3CCQ P;  4PH0 A;  1DV5 A;  2P9X A;  1FR2 A;  4M0I A;  1X3O A;  2GDW A;  4COP A;  1GXG A;  4PXH B;  3H47 A;  3RG2 A;  2K2Q A;  2EHS A;  1F80 D;  3CCJ P;  3GZM A;  2XT1 A;  1ACP A;  1Q7Y Q;  1HQB A;  1DNY A;  1VQO P;  2LML A;  5CZD B;  2FQ1 A;  1VQL P;  2M5R A;  2KOQ A;  2Z46 A;  3DS3 A;  3B5I A;  3CE7 A;  2BUO A;  4BPH A;  5EJD A;  2FAD A;  1YIJ P;  1KC8 Q;  3EJD A;  2FVA A;  2AFE A;  2MR7 A;  2KOR A;  3E2D A;  1L0I A;  3CMA P;  2N50 A;  1BXI A;  2K93 A;  5I4T G;  1M6E X;  1E6J P;  3CCV P;  2JBG A;  4PH1 A;  2M8L A;  2MVU A;  1YI2 P;  4U0C A;  2Z44 A;  2AVA A;  4BPF A;  3CCR P;  3CCS P;  7CEI A;  3CXC O;  4H2X C;  4WYM A;  1YJ9 P;  1RNI A;  1EIA A;  2MD9 A;  1AF8 A;  2VLN A;  2JGP A;  2JO0 A;  3G1I A;  2LTE A;  1KD1 Q;  2GZJ A;  2KOP A;  2L4B A;  3GZL A;  4U0D A;  1IMP A;  3M1M A;  2LOL A;  3DPH A;  3NTE A;  5F2K A;  2VLQ A;  4U0A A;  5KP8 B;  1K73 Q;  2GZG A;  1VHN A;  3G71 P;  3RG6 C;  3DS4 A;  1GPJ A;  2PEO A;  1YJN P;  1Z6M A;  2K5X A;  1K30 A;  2K0D X;  2FQ2 A;  5DCK A;  4IZ6 A;  1M74 A;  2XZ1 C;  3EJE A;  3DTJ A;  1N8R Q;  5JPA A;  3G28 A;  1A8O A;  2VSQ A;  1MZ8 A;  2KWL A;  1BAJ A;  5EW5 E;  2KGE A;  5HVC A;  2LF4 A;  4XRQ A;  2FVF A;  1HY8 A;  2M8P A;  5F2O A;  2FAE A;  2N6Y A;  2ROQ A;  1IUQ A;  2KGC A;  3LRY A;  3MGE A;  4R0M A;  2KOS A;  5HGM A;  2N98 A;  2X2B A;  1M90 Q;  2NO8 A;  3G0V A;  1VQ5 P;  2M8N A;  3CME P;  2L0Q A;  2ERH A;  1K8A Q;  3G26 A;  3P05 A;  2PEQ A;  3CC2 P;  3VRL C;  3B4Q A;  2FHS C;  2JU2 A;  1VQP P;  1VQ6 P;  4XFX A;  4F37 A;  4HKG A;  2LL8 A;  1AUM A;  2FAC A;  4QKO A;  1OR5 A;  3G29 A;  1Q86 Q;  2JYG A;  2GZI A;  1KQS O;  3DS1 A;  3CCU P;  2OTJ P;  2MR8 A;  2AF8 A;  1RO2 A;  2CG5 B;  3CCL P;  3CCM P;  3NY7 B;  4U0F A;  2PY8 A;  3GJN A;  3G6E P;  2KG8 A;  3LMO A;  2BHV A;  1VQ8 P;  2PEN A;  2GZF A;  4QNB A;  3CCE P;  3H4E A;  2EHT A;  2KW2 A;  2QA4 P;  1YIT P;  2Z45 A;  2AFD A;  5BS1 A;  2GYK A;  2GDY A;  2MVV A;  1W2B O;  1VQ7 P;  4COC A;  3EJB A;  2GZE A;  5KP7 B;  2KG9 A;  2LKI A;  3I56 P;  1E0H A;  2EIA A;  2LIU A;  2K94 A;  2CGQ A;  2L6E A;  1CEI A;  4DG9 A;  5HGN A;  4XFY A;  1S72 P;  2N5H A;  5HGO A;  3U43 A;  1QVF O;  2EFJ A;  4GR6 A;  2QNW A;  3CC4 P;  2K92 A;  2VLO A;  5BS2 A;  3I55 P;  2FVE A;  2LIW A;  2ONT A;  2N6Z A;  3DS0 A;  1Q82 Q;  4H2W C;  3CPW O;  2QEX P;  1AYI A;  1QVG O;  2KGA A;  2WPT A;  3HYB A;  2VLP A;  2MF4 A;  2PEM A;  2JAZ A;  2XXM A;  1M1K Q;  1VQN P; 
#chains in the Genus database with same CATH homology
 2AF8 A;  4PWV B;  5HV8 A;  2CG5 B;  2JGP A;  2LTE A;  4BPG A;  2KOP A;  3NY7 B;  4NEO A;  1L0H A;  2L4B A;  2N5I A;  3GZL A;  2LOL A;  2GDX A;  2K0Y A;  4H2Y C;  2KG8 A;  3LMO A;  5KP6 B;  5KP8 B;  1DV5 A;  1X3O A;  2GDW A;  2DNW A;  2FQ2 A;  2EHT A;  4PXH B;  4IZ6 A;  2KW2 A;  2XZ1 C;  3RG2 A;  2K2Q A;  3EJE A;  2EHS A;  1F80 D;  4CA3 A;  3GZM A;  2FQ0 A;  2AFD A;  1ACP A;  1HQB A;  1DNY A;  2GDY A;  2MVV A;  2LML A;  2L9F A;  2XZ0 D;  5CZD B;  2FQ1 A;  2M5R A;  2VSQ A;  2KOQ A;  2KWL A;  2MY5 A;  3EJB A;  5KP7 B;  2KG9 A;  2LKI A;  2KGE A;  5HVC A;  2LPK A;  1KLP A;  3CE7 A;  2LIU A;  2FVF A;  2K94 A;  4BPH A;  1HY8 A;  2PNG A;  2CGQ A;  2FAD A;  5EJD A;  1NQ4 A;  2FAE A;  3EJD A;  2FVA A;  2AFE A;  2N6Y A;  2ROQ A;  2KR5 A;  2MR7 A;  2KGC A;  4DG9 A;  2CQ8 A;  2KGD A;  2KOR A;  2N5H A;  2CNR A;  1T8K A;  2KOO A;  1L0I A;  2L22 A;  4R0M A;  2QNW A;  2KOS A;  1VKU A;  1AF8 A;  2K92 A;  2N98 A;  2X2B A;  2JU1 A;  2FVE A;  2LIW A;  2N50 A;  2KG6 A;  2L0Q A;  2N6Z A;  2K93 A;  4H2W C;  2FHS C;  2JU2 A;  2KGA A;  2MVU A;  4HKG A;  2LL8 A;  2AVA A;  2FAC A;  4BPF A;  1OR5 A;  2MF4 A;  4MRT C;  2K0X A;  4H2X C;  2JQ4 A;  2MD9 A;  2MR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...