1VQLP

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqlP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqlP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqlP02
1VQ6P 1S72P 1VQ8P 1Q7YQ 1YIJP 2QEXP 1QVGO 1JJ2O 1VQ7P 3CXCO 1VQ4P 3I55P 3G71P 1YJNP 3G4SP 3CC4P 3CCEP 1NJIQ 1YITP 1K9MQ 1VQNP 1VQMP 1YJ9P 1M90Q 1K73Q 1VQLP 1W2BO 3CCRP 3CCSP 3OW2O 3CCLP 3CCVP 2OTLP 3CCMP 1KD1Q 3CCUP 2OTJP 3I56P 3CCJP 3CPWO 1KC8Q 1K8AQ 1KQSO 2QA4P 1VQ5P 1Q81Q 3G6EP 1VQPP 1VQ9P 3CD6P 1QVFO 1M1KQ 3CC2P 3CMAP 1VQOP 3CMEP 3CCQP 1YI2P 3CC7P 1VQKP 1Q86Q 1Q82Q 1YJWP 1YHQP 1N8RQ
chains in the Genus database with same CATH superfamily
3USSA 3HE5B 1JCCA 1FAVA 1QVGO 4I2LC 2C0WA 1YQ4C 3H1LG 1SQPG 1N7SC 4GKGA 1VQNP 1FZGA 2KOQA 2JBGA 3HYBA 2FFDB 1L0NJ 4PH1A 1M6NA 1UIIA 3H1LJ 1SQPJ 5AVSB 1S9KE 1DD4A 2LL8A 1YTZT 2MKVA 2LTEA 3CWBD 2CGQA 3WUTA 1VQ7P 2A45H 2KLVA 2R32A 1Q2NA 1AVYA 2GZFA 2L9FA 5AVVB 3CCRP 1VF5C 3CWBG 2KWLA 1M6EX 1JOCA 4H2XC 4IPYA 2ONTA 2QJYC 4GDOA 3CWBJ 4U0CA 1X8YA 2GZEA 3RK3E 1SVFA 2OYHA 3L75G 1FDOA 1VKUA 2AF8A 4A7PA 3SWFA 3U59A 4PWVB 1A43A 4OWFA 1NTKE 1H89A 2Z45A 2C9LY 3L75J 1ZN5A 2KS1A 2LXCB 1EZVD 1PEOA 2N9YB 1OVUA 2GDXA 1JMBA 4QNBA 1VHNA 1Z56A 1MFZA 3V4QA 3Q3DA 4EDFA 2FYZA 2KGCA 3NFQA 1FZAA 5AW0B 2PEOA 1WT6A 4GODA 3RL0D 1HF9A 2KG9A 4EIJA 3O6QB 4BPFA 1KMIZ 2YKOA 2HODB 3C8VA 1ZOYC 1CI6A 4KT0J 1N7LA 3MGNA 2BUOA 2KOSA 1USDA 2KNCB 1NTZK 1LT9C 3M0DC 1EXJA 2ZJSE 1AQ5A 1PEMA 2ZT9C 2BCCD 1KYOE 3NY7B 1BCCD 5TJHA 2Z4EA 2Y9ZA 4IL6H 2E5TA 3FXDA 2BCCG 3CXHI 1D1DA 4AYCA 1G1IA 2WSEJ 4ASVA 2N1TD 2Q1KA 1BE3D 1L4AB 1SQVG 1KV4A 2BCCJ 3H32A 1ZMBA 5KLVD 5CJ4A 5CBOA 2N50A 2N5HA 1BE3G 4D6TE 1GU4A 3B5NB 1BGYD 1NTMD 3C9IA 1NU1G 1SQVJ 1RF1B 4BPGA 5K5GB 2LOLA 1BGYG 1NTMG 1BE3J 2E74B 2KR5A 1KILC 1NU1J 1J1DB 3H4EA 1DV5A 2NPSD 2FVFA 3E2DA 2JKVA 1BGYJ 2WSEH 1NTMJ 5EFWB 3PTZA 2JWDA 4U0AA 3C1LA 4NPFX 2ZYDA 4GR6A 1KZUB 3H1JG 3CL3D 3H1HE 4I7ZB 5APQA 4JQ0D 1URQD 2AXTH 3TSIA 3F89A 2W8ZA 4L76A 3HUSC 1GL2C 4PD4I 3HE4A 3H1JJ 1EIAA 2XXMA 2WPVB 3A0BE 2QJKC 2KYVA 1FZBA 1PPJG 2LIWA 2J59M 2POHA 3DTJA 4HH2A 4WY4A 3HD7B 2EIAA 5DJTB 2FFDA 2RMZA 3CC7P 4GOEA 3RK2D 3DS4A 5GTHH 1R5SA 1AJYA 2M8PA 1M74A 5KTBA 1OMIA 2W27A 3BRVB 2D2CB 5CCHD 2GZGA 1LTJB 3VTPC 4EOTA 5CMZA 4WBAA 2OARA 2K1AA 1JMMA 3ABVC 2KOOA 1J1EC 1U7MA 2JAZA 2KG8A 1KILE 4PJ0E 2E76B 2CPBA 1RO0A 1W2BO 3HTKB 2BASA 2K37A 1T8ZA 3TF5A 2KG6A 1VL2A 2C0XA 4H44B 4COCA 1Q82Q 2GZJA 2QE7H 2CK3H 1OFCX 2ZXXA 2W6JH 3EJDA 3KXDA 2WWWA 1KQLA 1NTZE 1L0LD 3L70D 4JBZA 2PEQA 1E0HA 1SQQG 3CXHD 3MUDA 1YBKA 4JF7A 3G0VA 4DG9A 3TYYA 3L70G 1P84D 1IFNA 1IFJA 2B87B 1SQQJ 2YNYA 4H0LD 1M1JB 1VDFA 5APUA 1FOSE 2QG4A 2K94A 3L70J 3O6QA 1T2KD 3AEFC 2IBZE 4I6MC 5KLVK 2MR7A 1L0NE 1DH3A 1NTMK 1SP4A 1NHLA 4YTPC 4LGDE 5M1BA 3CCSP 2QNWA 2JB0A 4C46A 2LMLA 3M91A 1T6AA 1W5CE 3RK3B 4H13D 3EQ2A 3F5HA 2FYNC 2GM4A 4ZKUA 3RL0C 2YKQA 1L4AA 3CXHH 3CWBE 4MRTC 3II6A 1IK7A 1GMJA 1X9VA 2H89C 1MZ9A 5APYA 4DZOA 2IFMA 2LIUA 3AE7C 2QM7A 1N7SB 1Y47A 2FAEA 1S72P 3P05A 3L72G 1PL5A 1BAJA 2YIUC 2FYUD 3WMM0 5F2NA 3DS2A 1Z6MA 5AW9B 1KTMA 4RO0A 3VP9A 3IN6A 3L72J 2DGYA 2MD9A 2FYUG 1EQ7A 2EFJA 2KXPB 2N1TC 1X22A 3G29A 4IL6E 3PHLA 3EFGA 3W67A 2FYUJ 2CNRA 1HJBA 1R8EA 1BSNA 2HYNA 2YMKA 2KB7P 1FR2A 3GKLC 4BRYB 3WBHA 1X0TA 4NPEA 4IFDK 4PD4H 3D70A 3JCUE 4IL6X 3A7OA 2Y0EA 4AQRD 1WRGA 3M1MA 5HV8A 4I1LA 2WMMA 1EDIA 3G4SP 2E75C 4U0BA 2NPSC 3E1RA 4QMAA 3KPEA 1QL2A 4XFYA 2M5AA 2RH0A 2YXRB 1URQC 1Q90D 2HG5D 1L0LK 3KYQA 2Q3EA 5AW5B 4M0IA 3SWYA 2KK7A 1AF8A 1K05A 3CCVP 2BCCE 2JR8A 2K9JA 4WY4D 4AUWA 3I56P 1KFNA 1LJ2A 1NO4A 4BPHA 1GK4A 1LWUA 4NPDA 1BCCE 3E1IA 5APTA 4UB8H 1NAFA 4K35A 4XE5B 1PP9D 1SQVE 3H47A 3PLNA 1GXHA 5AVUB 2KSJA 2K92A 3PP5A 1BE3E 1LT9B 2KIKA 1VQMP 1SQBG 5CHXA 1CSBA 5KLVE 2OYOA 5AW2B 1KC8Q 1QL1A 2ZT9B 5CCHC 3IAOA 3L35A 5JPAA 2ZYGA 1SQXG 5AVYB 1BGYE 1NTME 2IDBA 1AFOA 2VLNA 1SQBJ 1S5LE 1N8RQ 3GW6A 4UB6E 4PV1B 1N2DC 2KW2A 1LP1B 1RH5B 2B9BA 1SQXJ 5CCGA 2EHSA 5TISH 2HPCB 2B87A 1EDKA 3AEAC 1M1JA 4RESB 2WSCJ 5CBNA 3V2QA 1GTWA 3GHGA 1NYHA 3RG6C 2LF4A 5APSA 1Q86Q 3H1LD 1SQPD 1IFPA 1F80D 1G2CA 3MHVA 4JPZB 5AVXB 3GZMA 3GZLA 2VLQA 2BEZF 1MZ8A 2J5UA 2HFED 3K5BA 1KILB 1E79H 4RJTA 3KZIH 5B5EE 1N73A 1SFCA 4XRQA 2FYUK 1KB9H 1RHZB 3L73G 1DEEG 2WSCH 1RQVA 4H0LC 4BWNA 3L74D 2IYPA 3B4SA 4L73A 1FOSF 1LTAC 1T2KC 4XA4A 4NEOA 3E7KA 3L73J 3AE6C 3HUSB 3UIAA 1GL2B 1NWQA 3N4XA 4U7JA 3B5IA 3L74G 2QM8A 1PZQA 1HBWA 2QJKB 2XV6A 3L75D 2QEXP 5KKZC 1FC2C 5GTIH 1BDCA 4L74A 5BU8B 1YITP 4JYCA 2JQ4A 1FZCA 3L74J 1SS1A 3L71D 3A0HH 2Q7CA 3CC2P 1RE4A 1X3OA 5AW1B 2ITAA 1ZR4A 3L71G 3TNUB 2XDJA 2VRSA 1L4AD 4ZNCA 3ZDMA 2ZFCA 1YJNP 2QJPC 1ZW0A 3PRJA 4KJMA 2MVVA 4WWIA 1JTHB 3L71J 3CE7A 1L0LE 3MZWB 2I1JA 3L70E 2KP8A 2FXOA 2PNGA 3SWKA 3M06A 3CXHE 3TGUG 3U1CA 1VPCA 2RN0A 4DT0A 2A06D 2GDWA 1P84E 1CEIA 3CCEP 5F2KA 1EDJA 5HGNA 1FDIA 1JY2P 3TGUJ 4H2WC 2A06G 5B66H 1Q81Q 2N6YA 2AXCA 2B89A 1L2PA 1FS0E 3V4WA 1M56D 2Q3IA 2R5DA 3AE9C 5AVZB 1M7LA 1SQVD 2JO1A 1JCDA 2P67A 1X79B 5H2FH 1HWTC 5KAFH 4F37A 1VQOP 2P9XA 1VQKP 1VQ6P 5DJUB 1NU1D 3T97B 1L0NK 3CC4P 2K0DX 5EW5E 4U0DA 4XROA 1U7JA 3CCMP 1JY3P 1SQPK 2O01J 1ZV8A 3GLMA 3NTEA 2WTYA 2Q6QA 2UWJE 1QX8A 3H1JD 2L91A 2OYIA 2PY8A 5BS1A 1KYOI 4WY4C 1OR5A 2FYUE 2FYNB 3RL0B 2L22A 4IOIH 4GOFA 2ERHA 3D6ZA 1Q7YQ 1S2EA 1PPJD 4H44D 4YXWH 1OVRA 3H1KG 1HTLC 5HGOA 2KUBA 3HE5A 3D71A 2O01H 3JC22 3Q20A 3L36A 3CMAP 3H1KJ 1ZR2A 1OWAA 3Q1MA 2R5BA 4DJGA 2XZRA 2OTKE 5KLIC 4HB1A 2GYKA 4TT3H 2FACA 1AV1A 5CCGD 3MGEA 2AEJA 5AW8B 4JYBA 1JY3O 1DIPA 3VMXA 2PEJA 4W7ZA 3B71A 3SFEC 5TISE 2P10A 2Z5HA 3VP8A 4GT1A 1K73Q 3V2NA 2R3CA 3U43A 2FQ0A 3MUDC 3CMEP 2WPQA 1SFCD 2E75B 2MJZA 5AW3B 2NPSB 3CI9A 1CW5A 3BCCD 3G28A 1SQQD 4Y99C 3AE5C 1PP9E 4O9BA 4N78D 1HGVA 2YO3A 5AVQB 2WPRA 3KZIE 1QEXA 3CCJP 3BCCG 3LRYA 2LKIA 2IFNA 1NTKG 5L8RJ 1JTHA 1BXIA 1K04A 4K3AA 1MFTA 1IUQA 1RE3A 2QVAA 3I5CA 3BCCJ 1OZHA 4DOJA 2Q9IA 4EI2A 1NTKJ 2VLOA 1SQVK 2O3JA 2KGEA 2HODA 1YI2P 1NU1K 3P8CD 2LKMA 1JO5A 2CG5B 5KJ7A 2FBWC 2KNCA 5GTIE 2JGPA 2LXBA 5APXA 1S1CX 2XZ1C 3H1LE 3GG2A 1L4AC 1SQPE 1FBMA 1KB9I 3OA7A 3A0HE 3DS3A 1DD3A 1FE6A 3VYIA 2FY8A 1HGZA 2JP3A 2K0XA 1IFIA 5AW4B 2P1JA 3PH0A 1JEKA 2MY5A 3CX5I 1MUUA 2JWAA 4PD4D 4WVZA 1IO4A 2M8NA 2E1MA 1JB0J 2EG5A 2AVAA 1RY3A 3NTNA 4OGQD 5EJDA 5F2OA 4PH0A 3B5NA 5AVRB 2Z46A 1LGHB 3L72D 3L74E 2PEKA 1PGQA 5AW7B 1RF1A 3H1ID 1EDLA 2JYGA 3Q2YA 1RF0C 4W80A 3AEDC 2M0BA 4D6TG 1VQLP 3H1IG 3L75E 1M8OB 2K88A 2JDIH 3DPHA 3M9HA 4COPA 3EFFK 1H0TB 1ZNVA 4D6TJ 1UJZA 4H0LB 2XNDH 3H1IJ 3L71E 3AE8C 1OVVA 1VF5B 2OQQA 1LTGC 2PENA 2IX7C 2KODA 1U57A 3B8EB 1KYOH 5KAFE 5C39A 3QWOC 2L6EA 3KQGA 2KS1B 2QJYB 1TU3F 5KKZB 5I4TG 2ZT9D 4EYYQ 3HD7A 2H7HA 2NZ2A 2K0YA 1YIJP 3AE1C 2N6ZA 3V2PA 1GW3A 2V7QJ 3FWNA 2PAJA 4HYTB 4PV1D 1DEBA 1HH0A 4W7YA 3CCUP 2A06E 1LWUC 1CZQA 2K93A 1AUMA 2QJPB 1EOQA 1SQQK 3VMYA 3JSVC 1LTJA 4HJGH 2JYLA 1LNQA 1A02F 2FXMA 2QA4P 2AXTE 1Y9BA 3HTKA 1EZVI 2V7QH 5HGLA 2DNWA 1NVOA 2OGUA 1SQBD 1VQ8P 1JJ2O 3RK2C 2PRRA 2FVEA 2W90A 1YTZI 1K9MQ 3EJEA 5CCGC 3RBXA 3LW5J 1KB9D 4XFJA 1SQXD 1KD1Q 3GMAA 1NU1E 1K8AQ 1FU1A 2W6BA 3GHGC 3H32B 2E42A 5GTHE 1PIXA 1KLPA 3PJSK 2I1KA 4N6JA 3CX5D 2K5XA 1NTZG 2MR8A 1L0IA 1XTGB 1LT1A 3EWKA 2K3RA 4UHPB 2FQ2A 1JM0A 1QGKB 3EJBA 3H1JE 1IMPA 1N73C 1NTZJ 3FWLA 2Q5UA 3ITKA 4OVNF 1SFCC 1RO2A 2KGAA 2N9BA 3LW5H 1S4XA 2WSSH 5E79H 3R4YA 3CCLP 1IC2A 1PPJE 2KZIA 2JEEA 3P32A 4GR2A 3G21A 1ZRTD 2GUSA 3MD0A 1JY3N 3L73D 3HE4B 4GIFA 3G9RA 2LR2A 4WY4B 1FDMA 2JO0A 1NH4A 1ZLLA 1PEQA 2PP6A 1SLQA 3VOPA 5CJ0A 1FZCC 2OYHC 2NRGA 2XZ0D 4U0EA 1VQPP 3WUVA 1RE4C 3CX5H 5KJ7D 1E6JP 2MF4A 1YJWP 1GPJA 2E43A 3HZQA 1LTIC 1N7SA 2WPSA 3WU2H 4R0MA 4XFXA 4L75A 3RL0g 4TLFA 5KLIB 1MV8A 2CWOA 3LIEA 3G1GA 3TK1A 1H0TA 2KSEA 4HKGA 2KOGA 3Q5RA 2AEFA 4H13C 3G71P 1NKNA 3A3YB 1XTCC 1FZEA 1NJIQ 2P7JA 4YXDC 2ZVNB 3BCCE 3P7KA 2KLUA 4QKOA 1SQQE 3TGUD 2WSFJ 3B5ND 4N78E 2KOPA 1T3UA 1LTTC 2W83C 4OGQC 2EHTA 1J1EB 4BRYA 3G1IA 1ACPA 1GU5A 2GDYA 1ZXGA 2E74D 1ZP0C 1EZVG 1GK6A 2GZIA 1GW4A 3M0AA 4B86A 1DX7A 2N5IA 1SQBK 3G6EP 1EXIA 4Y99B 5KP6B 2GUVA 4LC1A 1SQXK 2XKMA 3P8CE 1YYCA 1GDTA 1FJPA 1OIPA 1BDDA 2XNXA 2WSFH 1AQTA 1YQ3C 2AFEA 1H8AA 5BVZA 3Q5SA 1QVFO 1QLED 5CZDB 3HD7D 4MN4C 4U3FD 1EMVA 2B88A 1IZNB 2BHVA 3V2RA 2HLOA 1JNMA 2M8RA 5KP8B 4U3FG 5BS2A 5HGMA 2R3SA 3OW2O 2OTLP 1DNYA 1PGJA 3AECC 2OYIC 1AA0A 4PV1C 1RNIA 1BCCG 1LT9A 4PD4E 1D7MA 3M0DA 1P84I 2ROQA 2D2CD 4U3FJ 1R5LA 3CLQA 2KZJA 2C9NY 3B4QA 4C7NB 2FVAA 1BCCJ 3L72E 1KN7A 3JCUH 4OH8B 1PEUA 3H1IE 5KLVG 2G3AA 1MKMA 2O01N 2YMYA 2XV5A 2E76D 1LP1A 3BASA 1M1KQ 2HPCA 1JY2O 1OX3A 2IZ0A 3H1KD 2FFDC 3BATA 4IFMA 3GF3A 5KLVJ 5DCKA 1OW7A 2L0QA 2IYOA 2E75D 4M3LA 2W6AA 2K2QA 1L0HA 2JU1A 1HJ0A 2M3BA 1AVOA 4UB8E 4U0FA 4CA3A 2FHSC 3VRLC 1J2JB 2YIUB 2YXQB 2XU6A 4KHXA 5KAIH 1KILA 1JUNA 3BVHA 4ZKPA 4ASWA 1M57D 2Y0CA 3MIWA 3SFDC 3NMDA 4RKUJ 1S9KD 2JU2A 5AVTB 2N1TB 3KDPB 1HUCA 3HUSA 2N98A 3H25A 1GL2A 2ZXEB 1S5LH 2XT1A 1USEA 4UB6H 2M5AB 3CPWO 2H43A 3AE3C 3NXSA 2O1KA 4WYMA 1S3JA 2GA1A 3RK3D 2CPSA 1KORA 5E79E 1RE3C 1GXGA 2G8YA 2K9JB 1LWUB 1FZFA 1NTKD 3TNUA 3W68A 1SQBE 3RBZA 3U1AA 1PFIA 5KP7B 1GZLA 1URQB 2Z44A 2R44A 2X2BA 1KQGB 2VSQA 1PGPA 1AYIA 2WT7B 3G3ZA 5APVA 4LLHA 1KB9E 1SQXE 3M9QA 1YHQP 5KJ7C 3S1KA 5B5EH 3LMOA 3FGAD 1N7SD 5AW6B 2RKLA 5APWA 1OW8A 3A5TA 3CX5E 2L4BA 2H8PD 3RK2B 1L0LG 3IFMA 1K30A 3VN0A 1RQUA 2CQ8A 2IZ1A 3Q5PA 3R2PA 4R4MA 3WU2E 4IFFA 2KI7B 3FXEA 1L0LJ 1QRJA 3GHGB 1VF5D 2PEIA 4HKZH 2M3EA 1OW6A 1G2CB 1KYOD 2WQYC 1E5WA 3B5NC 4WB4A 3WUUA 1RF1C 2LPKA 1ZRTE 3L73E 3QH9A 3GF7A 2E74C 2Z5IA 2QSIA 1IMQA 2A45I 2H88C 3KHUA 1J1DC 3LIDA 3SSUA 1N73B 2BEQD 3T97A 1SFCB 1HQBA 1T3JA 3S4RA 3H6PA 2P2UA 3M9BA 2FADA 2I8DA 2PGDA 2YO2A 4D6TD 3S9OA 1IK9A 2IBZI 4I7ZC 2IPPA 2WPTA 1GD2E 1NQ4A 2KORA 3V5BA 3BRTB 4C7NA 3IR9A 5B66E 1P84H 4H2YC 1LTBC 3GJNA 3P8MC 1A8OA 2KGDA 1BSHA 1OXZA 1IJDB 3HD7C 3L37A 3L4FA 1VQ9P 2Y0DA 1FZCB 2OYHB 3CXCO 2M5RA 2FXPA 3H1HD 2O1JA 3D6YA 5H2FE 1H88A 3MTUE 3N7NA 3H1HG 3AEGC 2D2CC 4Z1MH 2WITA 1NGMB 2L5GB 3TGUE 2JJLA 1RF0A 2WZ7A 1LTJC 2AFDA 3AE2C 2ZYAA 3H1HJ 1EZVE 2V4HA 1NOHA 4R4LA 1UIXA 4N3YB 3TDKA 2VLPA 2E76C 3VMZA 4H13B 1FJKA 1G1JA 1A02J 2N1TA 2NO8A 3HRNA 2MVUA 2ZAEB 1NTKK 1NAYA 1CI6B 2DW3A 3DS1A 2P58A 4BXLA 1PV3A 2PFXA 1W2EA 4H44C 1YJ9P 2SPZA 4OGQB 1HVVA 2YKPA 3O8ZA 3IF4A 3OAKA 3AEBC 1PGOA 4XFZA 2BQ1E 4CPGA 1KILD 1N86A 2WVRA 1IFMA 2E5YA 3I55P 3VMAA 2NPSA 4U3FE 4C7RA 7CEIA 5BU5A 1KQSO 1M1JC 3A0BH 3H0DA 5KAIE 1JY2N 5AVWB 3CCQP 1URQA 2HR3A 3MP7B 1GL2D 1NTZD 3AE4C 2WT7A 1KQFB 1VQ4P 1PP9G 2QIWA 1M90Q 2AEMA 2FQ1A 1IFDA 4DCKA 4PXHB 1ZMEC 1LTSC 1VQ5P 3CD6P 1KFMA 2Y9YA 1UNKA 4YPCA 1PP9J 2K9YA 2ZVOB 3V6IA 1EC5A 2A45G 1WMKA 2QRXA 3DS5A 3RK3C 2OYIB 1HY8A 2IBZD 3FX0A 3H1KE 2PEMA 5HVCA 3A2AA 3G26A 1T8KA 2OTJP 2FKWB 4ZMDA 1L0ND 3RG2A 4PJ0H 5CCHA 2J58A 4IZ6A 3DS0A 2IBZG 4Y28J 1NKZB 3OJAB 3RGUA 2M8LA 1Y8AA 1S5LX 3AEEC 1L0NG
chains in the Genus database with same CATH topology
1VQ8P 2JYGA 1JJ2O 1QVGO 2BHVA 3DS1A 3HZQA 3NTEA 2XT1A 1EIAA 3G28A 1YJNP 1K9MQ 1VQNP 2XXMA 1YJ9P 1VQLP 5BS2A 5HGMA 2PY8A 3OW2O 2OTLP 1KD1Q 3HYBA 3DTJA 5BS1A 4PH1A 3CCJP 3WBHA 3CPWO 1K8AQ 2BUOA 1M6NA 3DPHA 1RNIA 4XFXA 3LRYA 4COPA 3RG6C 2EIAA 2CWOA 2LF4A 3G1GA 3CC7P 1Q86Q 4WYMA 4XFZA 2BQ1E 3DS4A 1PEMA 1IUQA 1Q7YQ 3M1MA 1VQ7P 2M8PA 2PENA 2KODA 1M74A 3I55P 3G71P 5HGOA 3G4SP 3CCEP 1NJIQ 4U0BA 1PEUA 5F2KA 3CCRP 3CCSP 5HGNA 1M6EX 1D1DA 2Z44A 1KQSO 4XFYA 2L6EA 3H0DA 3Q20A 1Q81Q 1A8OA 1M1KQ 3CMAP 3CCQP 1YI2P 5I4TG 3G1IA 4IPYA 2ONTA 4XRQA 2OARA 5DCKA 1YHQP 1VQ9P 1RO2A 1ZMBA 1YIJP 4U0CA 3CXCO 1VQ4P 4M0IA 1M90Q 1RO0A 1W2BO 3CCLP 3CCVP 3DS3A 3MGEA 3CCUP 3I56P 4GR2A 3G21A 1A43A 4U0FA 1VQ5P 3G6EP 3CD6P 1VQOP 1K30A 2P9XA 2Z45A 3B5IA 3VRLC 1VQKP 1AUMA 2PEJA 4COCA 1EOQA 1Q82Q 3H47A 3DS5A 1PEOA 1VQ6P 2XV6A 1S72P 3P05A 2QEXP 3H4EA 1YJWP 1BAJA 2JO0A 1QRJA 2JYLA 2PEMA 3CC4P 1PEQA 1YITP 1VQMP 3E2DA 2M8NA 4U0DA 1K73Q 4U0AA 2PEIA 3DS2A 4XROA 2E1MA 4QNBA 5F2NA 3CCMP 3G26A 2OTJP 4GR6A 2PEQA 1KC8Q 2EG5A 3DS0A 4U0EA 2QA4P 1VQPP 2DGYA 3G0VA 5JPAA 1QVFO 5F2OA 4PH0A 2M8LA 3CC2P 2Z46A 3CMEP 2PEKA 1E6JP 5HGLA 2EFJA 2PEOA 1N8RQ 3G29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 P;  1S72 P;  1VQ8 P;  1Q7Y Q;  1YIJ P;  2QEX P;  1QVG O;  1JJ2 O;  1VQ7 P;  3CXC O;  1VQ4 P;  3I55 P;  3G71 P;  1YJN P;  3G4S P;  3CC4 P;  3CCE P;  1NJI Q;  1YIT P;  1K9M Q;  1VQN P;  1VQM P;  1YJ9 P;  1M90 Q;  1K73 Q;  1VQL P;  1W2B O;  3CCR P;  3CCS P;  3OW2 O;  3CCL P;  3CCV P;  2OTL P;  3CCM P;  1KD1 Q;  3CCU P;  2OTJ P;  3I56 P;  3CCJ P;  3CPW O;  1KC8 Q;  1K8A Q;  1KQS O;  2QA4 P;  1VQ5 P;  1Q81 Q;  3G6E P;  1VQP P;  1VQ9 P;  3CD6 P;  1QVF O;  1M1K Q;  3CC2 P;  3CMA P;  1VQO P;  3CME P;  3CCQ P;  1YI2 P;  3CC7 P;  1VQK P;  1Q86 Q;  1Q82 Q;  1YJW P;  1YHQ P;  1N8R Q; 
#chains in the Genus database with same CATH topology
 3USS A;  3HE5 B;  1JCC A;  1FAV A;  1QVG O;  4I2L C;  2C0W A;  1YQ4 C;  3H1L G;  1SQP G;  1N7S C;  4GKG A;  1VQN P;  1FZG A;  2KOQ A;  2JBG A;  3HYB A;  2FFD B;  1L0N J;  4PH1 A;  1M6N A;  1UII A;  3H1L J;  1SQP J;  5AVS B;  1S9K E;  1DD4 A;  2LL8 A;  1YTZ T;  2MKV A;  2LTE A;  3CWB D;  2CGQ A;  3WUT A;  1VQ7 P;  2A45 H;  2KLV A;  2R32 A;  1Q2N A;  1AVY A;  2GZF A;  2L9F A;  5AVV B;  3CCR P;  1VF5 C;  3CWB G;  2KWL A;  1M6E X;  1JOC A;  4H2X C;  4IPY A;  2ONT A;  2QJY C;  4GDO A;  3CWB J;  4U0C A;  1X8Y A;  2GZE A;  3RK3 E;  1SVF A;  2OYH A;  3L75 G;  1FDO A;  1VKU A;  2AF8 A;  4A7P A;  3SWF A;  3U59 A;  4PWV B;  1A43 A;  4OWF A;  1NTK E;  1H89 A;  2Z45 A;  2C9L Y;  3L75 J;  1ZN5 A;  2KS1 A;  2LXC B;  1EZV D;  1PEO A;  2N9Y B;  1OVU A;  2GDX A;  1JMB A;  4QNB A;  1VHN A;  1Z56 A;  1MFZ A;  3V4Q A;  3Q3D A;  4EDF A;  2FYZ A;  2KGC A;  3NFQ A;  1FZA A;  5AW0 B;  2PEO A;  1WT6 A;  4GOD A;  3RL0 D;  1HF9 A;  2KG9 A;  4EIJ A;  3O6Q B;  4BPF A;  1KMI Z;  2YKO A;  2HOD B;  3C8V A;  1ZOY C;  1CI6 A;  4KT0 J;  1N7L A;  3MGN A;  2BUO A;  2KOS A;  1USD A;  2KNC B;  1NTZ K;  1LT9 C;  3M0D C;  1EXJ A;  2ZJS E;  1AQ5 A;  1PEM A;  2ZT9 C;  2BCC D;  1KYO E;  3NY7 B;  1BCC D;  5TJH A;  2Z4E A;  2Y9Z A;  4IL6 H;  2E5T A;  3FXD A;  2BCC G;  3CXH I;  1D1D A;  4AYC A;  1G1I A;  2WSE J;  4ASV A;  2N1T D;  2Q1K A;  1BE3 D;  1L4A B;  1SQV G;  1KV4 A;  2BCC J;  3H32 A;  1ZMB A;  5KLV D;  5CJ4 A;  5CBO A;  2N50 A;  2N5H A;  1BE3 G;  4D6T E;  1GU4 A;  3B5N B;  1BGY D;  1NTM D;  3C9I A;  1NU1 G;  1SQV J;  1RF1 B;  4BPG A;  5K5G B;  2LOL A;  1BGY G;  1NTM G;  1BE3 J;  2E74 B;  2KR5 A;  1KIL C;  1NU1 J;  1J1D B;  3H4E A;  1DV5 A;  2NPS D;  2FVF A;  3E2D A;  2JKV A;  1BGY J;  2WSE H;  1NTM J;  5EFW B;  3PTZ A;  2JWD A;  4U0A A;  3C1L A;  4NPF X;  2ZYD A;  4GR6 A;  1KZU B;  3H1J G;  3CL3 D;  3H1H E;  4I7Z B;  5APQ A;  4JQ0 D;  1URQ D;  2AXT H;  3TSI A;  3F89 A;  2W8Z A;  4L76 A;  3HUS C;  1GL2 C;  4PD4 I;  3HE4 A;  3H1J J;  1EIA A;  2XXM A;  2WPV B;  3A0B E;  2QJK C;  2KYV A;  1FZB A;  1PPJ G;  2LIW A;  2J59 M;  2POH A;  3DTJ A;  4HH2 A;  4WY4 A;  3HD7 B;  2EIA A;  5DJT B;  2FFD A;  2RMZ A;  3CC7 P;  4GOE A;  3RK2 D;  3DS4 A;  5GTH H;  1R5S A;  1AJY A;  2M8P A;  1M74 A;  5KTB A;  1OMI A;  2W27 A;  3BRV B;  2D2C B;  5CCH D;  2GZG A;  1LTJ B;  3VTP C;  4EOT A;  5CMZ A;  4WBA A;  2OAR A;  2K1A A;  1JMM A;  3ABV C;  2KOO A;  1J1E C;  1U7M A;  2JAZ A;  2KG8 A;  1KIL E;  4PJ0 E;  2E76 B;  2CPB A;  1RO0 A;  1W2B O;  3HTK B;  2BAS A;  2K37 A;  1T8Z A;  3TF5 A;  2KG6 A;  1VL2 A;  2C0X A;  4H44 B;  4COC A;  1Q82 Q;  2GZJ A;  2QE7 H;  2CK3 H;  1OFC X;  2ZXX A;  2W6J H;  3EJD A;  3KXD A;  2WWW A;  1KQL A;  1NTZ E;  1L0L D;  3L70 D;  4JBZ A;  2PEQ A;  1E0H A;  1SQQ G;  3CXH D;  3MUD A;  1YBK A;  4JF7 A;  3G0V A;  4DG9 A;  3TYY A;  3L70 G;  1P84 D;  1IFN A;  1IFJ A;  2B87 B;  1SQQ J;  2YNY A;  4H0L D;  1M1J B;  1VDF A;  5APU A;  1FOS E;  2QG4 A;  2K94 A;  3L70 J;  3O6Q A;  1T2K D;  3AEF C;  2IBZ E;  4I6M C;  5KLV K;  2MR7 A;  1L0N E;  1DH3 A;  1NTM K;  1SP4 A;  1NHL A;  4YTP C;  4LGD E;  5M1B A;  3CCS P;  2QNW A;  2JB0 A;  4C46 A;  2LML A;  3M91 A;  1T6A A;  1W5C E;  3RK3 B;  4H13 D;  3EQ2 A;  3F5H A;  2FYN C;  2GM4 A;  4ZKU A;  3RL0 C;  2YKQ A;  1L4A A;  3CXH H;  3CWB E;  4MRT C;  3II6 A;  1IK7 A;  1GMJ A;  1X9V A;  2H89 C;  1MZ9 A;  5APY A;  4DZO A;  2IFM A;  2LIU A;  3AE7 C;  2QM7 A;  1N7S B;  1Y47 A;  2FAE A;  1S72 P;  3P05 A;  3L72 G;  1PL5 A;  1BAJ A;  2YIU C;  2FYU D;  3WMM 0;  5F2N A;  3DS2 A;  1Z6M A;  5AW9 B;  1KTM A;  4RO0 A;  3VP9 A;  3IN6 A;  3L72 J;  2DGY A;  2MD9 A;  2FYU G;  1EQ7 A;  2EFJ A;  2KXP B;  2N1T C;  1X22 A;  3G29 A;  4IL6 E;  3PHL A;  3EFG A;  3W67 A;  2FYU J;  2CNR A;  1HJB A;  1R8E A;  1BSN A;  2HYN A;  2YMK A;  2KB7 P;  1FR2 A;  3GKL C;  4BRY B;  3WBH A;  1X0T A;  4NPE A;  4IFD K;  4PD4 H;  3D70 A;  3JCU E;  4IL6 X;  3A7O A;  2Y0E A;  4AQR D;  1WRG A;  3M1M A;  5HV8 A;  4I1L A;  2WMM A;  1EDI A;  3G4S P;  2E75 C;  4U0B A;  2NPS C;  3E1R A;  4QMA A;  3KPE A;  1QL2 A;  4XFY A;  2M5A A;  2RH0 A;  2YXR B;  1URQ C;  1Q90 D;  2HG5 D;  1L0L K;  3KYQ A;  2Q3E A;  5AW5 B;  4M0I A;  3SWY A;  2KK7 A;  1AF8 A;  1K05 A;  3CCV P;  2BCC E;  2JR8 A;  2K9J A;  4WY4 D;  4AUW A;  3I56 P;  1KFN A;  1LJ2 A;  1NO4 A;  4BPH A;  1GK4 A;  1LWU A;  4NPD A;  1BCC E;  3E1I A;  5APT A;  4UB8 H;  1NAF A;  4K35 A;  4XE5 B;  1PP9 D;  1SQV E;  3H47 A;  3PLN A;  1GXH A;  5AVU B;  2KSJ A;  2K92 A;  3PP5 A;  1BE3 E;  1LT9 B;  2KIK A;  1VQM P;  1SQB G;  5CHX A;  1CSB A;  5KLV E;  2OYO A;  5AW2 B;  1KC8 Q;  1QL1 A;  2ZT9 B;  5CCH C;  3IAO A;  3L35 A;  5JPA A;  2ZYG A;  1SQX G;  5AVY B;  1BGY E;  1NTM E;  2IDB A;  1AFO A;  2VLN A;  1SQB J;  1S5L E;  1N8R Q;  3GW6 A;  4UB6 E;  4PV1 B;  1N2D C;  2KW2 A;  1LP1 B;  1RH5 B;  2B9B A;  1SQX J;  5CCG A;  2EHS A;  5TIS H;  2HPC B;  2B87 A;  1EDK A;  3AEA C;  1M1J A;  4RES B;  2WSC J;  5CBN A;  3V2Q A;  1GTW A;  3GHG A;  1NYH A;  3RG6 C;  2LF4 A;  5APS A;  1Q86 Q;  3H1L D;  1SQP D;  1IFP A;  1F80 D;  1G2C A;  3MHV A;  4JPZ B;  5AVX B;  3GZM A;  3GZL A;  2VLQ A;  2BEZ F;  1MZ8 A;  2J5U A;  2HFE D;  3K5B A;  1KIL B;  1E79 H;  4RJT A;  3KZI H;  5B5E E;  1N73 A;  1SFC A;  4XRQ A;  2FYU K;  1KB9 H;  1RHZ B;  3L73 G;  1DEE G;  2WSC H;  1RQV A;  4H0L C;  4BWN A;  3L74 D;  2IYP A;  3B4S A;  4L73 A;  1FOS F;  1LTA C;  1T2K C;  4XA4 A;  4NEO A;  3E7K A;  3L73 J;  3AE6 C;  3HUS B;  3UIA A;  1GL2 B;  1NWQ A;  3N4X A;  4U7J A;  3B5I A;  3L74 G;  2QM8 A;  1PZQ A;  1HBW A;  2QJK B;  2XV6 A;  3L75 D;  2QEX P;  5KKZ C;  1FC2 C;  5GTI H;  1BDC A;  4L74 A;  5BU8 B;  1YIT P;  4JYC A;  2JQ4 A;  1FZC A;  3L74 J;  1SS1 A;  3L71 D;  3A0H H;  2Q7C A;  3CC2 P;  1RE4 A;  1X3O A;  5AW1 B;  2ITA A;  1ZR4 A;  3L71 G;  3TNU B;  2XDJ A;  2VRS A;  1L4A D;  4ZNC A;  3ZDM A;  2ZFC A;  1YJN P;  2QJP C;  1ZW0 A;  3PRJ A;  4KJM A;  2MVV A;  4WWI A;  1JTH B;  3L71 J;  3CE7 A;  1L0L E;  3MZW B;  2I1J A;  3L70 E;  2KP8 A;  2FXO A;  2PNG A;  3SWK A;  3M06 A;  3CXH E;  3TGU G;  3U1C A;  1VPC A;  2RN0 A;  4DT0 A;  2A06 D;  2GDW A;  1P84 E;  1CEI A;  3CCE P;  5F2K A;  1EDJ A;  5HGN A;  1FDI A;  1JY2 P;  3TGU J;  4H2W C;  2A06 G;  5B66 H;  1Q81 Q;  2N6Y A;  2AXC A;  2B89 A;  1L2P A;  1FS0 E;  3V4W A;  1M56 D;  2Q3I A;  2R5D A;  3AE9 C;  5AVZ B;  1M7L A;  1SQV D;  2JO1 A;  1JCD A;  2P67 A;  1X79 B;  5H2F H;  1HWT C;  5KAF H;  4F37 A;  1VQO P;  2P9X A;  1VQK P;  1VQ6 P;  5DJU B;  1NU1 D;  3T97 B;  1L0N K;  3CC4 P;  2K0D X;  5EW5 E;  4U0D A;  4XRO A;  1U7J A;  3CCM P;  1JY3 P;  1SQP K;  2O01 J;  1ZV8 A;  3GLM A;  3NTE A;  2WTY A;  2Q6Q A;  2UWJ E;  1QX8 A;  3H1J D;  2L91 A;  2OYI A;  2PY8 A;  5BS1 A;  1KYO I;  4WY4 C;  1OR5 A;  2FYU E;  2FYN B;  3RL0 B;  2L22 A;  4IOI H;  4GOF A;  2ERH A;  3D6Z A;  1Q7Y Q;  1S2E A;  1PPJ D;  4H44 D;  4YXW H;  1OVR A;  3H1K G;  1HTL C;  5HGO A;  2KUB A;  3HE5 A;  3D71 A;  2O01 H;  3JC2 2;  3Q20 A;  3L36 A;  3CMA P;  3H1K J;  1ZR2 A;  1OWA A;  3Q1M A;  2R5B A;  4DJG A;  2XZR A;  2OTK E;  5KLI C;  4HB1 A;  2GYK A;  4TT3 H;  2FAC A;  1AV1 A;  5CCG D;  3MGE A;  2AEJ A;  5AW8 B;  4JYB A;  1JY3 O;  1DIP A;  3VMX A;  2PEJ A;  4W7Z A;  3B71 A;  3SFE C;  5TIS E;  2P10 A;  2Z5H A;  3VP8 A;  4GT1 A;  1K73 Q;  3V2N A;  2R3C A;  3U43 A;  2FQ0 A;  3MUD C;  3CME P;  2WPQ A;  1SFC D;  2E75 B;  2MJZ A;  5AW3 B;  2NPS B;  3CI9 A;  1CW5 A;  3BCC D;  3G28 A;  1SQQ D;  4Y99 C;  3AE5 C;  1PP9 E;  4O9B A;  4N78 D;  1HGV A;  2YO3 A;  5AVQ B;  2WPR A;  3KZI E;  1QEX A;  3CCJ P;  3BCC G;  3LRY A;  2LKI A;  2IFN A;  1NTK G;  5L8R J;  1JTH A;  1BXI A;  1K04 A;  4K3A A;  1MFT A;  1IUQ A;  1RE3 A;  2QVA A;  3I5C A;  3BCC J;  1OZH A;  4DOJ A;  2Q9I A;  4EI2 A;  1NTK J;  2VLO A;  1SQV K;  2O3J A;  2KGE A;  2HOD A;  1YI2 P;  1NU1 K;  3P8C D;  2LKM A;  1JO5 A;  2CG5 B;  5KJ7 A;  2FBW C;  2KNC A;  5GTI E;  2JGP A;  2LXB A;  5APX A;  1S1C X;  2XZ1 C;  3H1L E;  3GG2 A;  1L4A C;  1SQP E;  1FBM A;  1KB9 I;  3OA7 A;  3A0H E;  3DS3 A;  1DD3 A;  1FE6 A;  3VYI A;  2FY8 A;  1HGZ A;  2JP3 A;  2K0X A;  1IFI A;  5AW4 B;  2P1J A;  3PH0 A;  1JEK A;  2MY5 A;  3CX5 I;  1MUU A;  2JWA A;  4PD4 D;  4WVZ A;  1IO4 A;  2M8N A;  2E1M A;  1JB0 J;  2EG5 A;  2AVA A;  1RY3 A;  3NTN A;  4OGQ D;  5EJD A;  5F2O A;  4PH0 A;  3B5N A;  5AVR B;  2Z46 A;  1LGH B;  3L72 D;  3L74 E;  2PEK A;  1PGQ A;  5AW7 B;  1RF1 A;  3H1I D;  1EDL A;  2JYG A;  3Q2Y A;  1RF0 C;  4W80 A;  3AED C;  2M0B A;  4D6T G;  1VQL P;  3H1I G;  3L75 E;  1M8O B;  2K88 A;  2JDI H;  3DPH A;  3M9H A;  4COP A;  3EFF K;  1H0T B;  1ZNV A;  4D6T J;  1UJZ A;  4H0L B;  2XND H;  3H1I J;  3L71 E;  3AE8 C;  1OVV A;  1VF5 B;  2OQQ A;  1LTG C;  2PEN A;  2IX7 C;  2KOD A;  1U57 A;  3B8E B;  1KYO H;  5KAF E;  5C39 A;  3QWO C;  2L6E A;  3KQG A;  2KS1 B;  2QJY B;  1TU3 F;  5KKZ B;  5I4T G;  2ZT9 D;  4EYY Q;  3HD7 A;  2H7H A;  2NZ2 A;  2K0Y A;  1YIJ P;  3AE1 C;  2N6Z A;  3V2P A;  1GW3 A;  2V7Q J;  3FWN A;  2PAJ A;  4HYT B;  4PV1 D;  1DEB A;  1HH0 A;  4W7Y A;  3CCU P;  2A06 E;  1LWU C;  1CZQ A;  2K93 A;  1AUM A;  2QJP B;  1EOQ A;  1SQQ K;  3VMY A;  3JSV C;  1LTJ A;  4HJG H;  2JYL A;  1LNQ A;  1A02 F;  2FXM A;  2QA4 P;  2AXT E;  1Y9B A;  3HTK A;  1EZV I;  2V7Q H;  5HGL A;  2DNW A;  1NVO A;  2OGU A;  1SQB D;  1VQ8 P;  1JJ2 O;  3RK2 C;  2PRR A;  2FVE A;  2W90 A;  1YTZ I;  1K9M Q;  3EJE A;  5CCG C;  3RBX A;  3LW5 J;  1KB9 D;  4XFJ A;  1SQX D;  1KD1 Q;  3GMA A;  1NU1 E;  1K8A Q;  1FU1 A;  2W6B A;  3GHG C;  3H32 B;  2E42 A;  5GTH E;  1PIX A;  1KLP A;  3PJS K;  2I1K A;  4N6J A;  3CX5 D;  2K5X A;  1NTZ G;  2MR8 A;  1L0I A;  1XTG B;  1LT1 A;  3EWK A;  2K3R A;  4UHP B;  2FQ2 A;  1JM0 A;  1QGK B;  3EJB A;  3H1J E;  1IMP A;  1N73 C;  1NTZ J;  3FWL A;  2Q5U A;  3ITK A;  4OVN F;  1SFC C;  1RO2 A;  2KGA A;  2N9B A;  3LW5 H;  1S4X A;  2WSS H;  5E79 H;  3R4Y A;  3CCL P;  1IC2 A;  1PPJ E;  2KZI A;  2JEE A;  3P32 A;  4GR2 A;  3G21 A;  1ZRT D;  2GUS A;  3MD0 A;  1JY3 N;  3L73 D;  3HE4 B;  4GIF A;  3G9R A;  2LR2 A;  4WY4 B;  1FDM A;  2JO0 A;  1NH4 A;  1ZLL A;  1PEQ A;  2PP6 A;  1SLQ A;  3VOP A;  5CJ0 A;  1FZC C;  2OYH C;  2NRG A;  2XZ0 D;  4U0E A;  1VQP P;  3WUV A;  1RE4 C;  3CX5 H;  5KJ7 D;  1E6J P;  2MF4 A;  1YJW P;  1GPJ A;  2E43 A;  3HZQ A;  1LTI C;  1N7S A;  2WPS A;  3WU2 H;  4R0M A;  4XFX A;  4L75 A;  3RL0 g;  4TLF A;  5KLI B;  1MV8 A;  2CWO A;  3LIE A;  3G1G A;  3TK1 A;  1H0T A;  2KSE A;  4HKG A;  2KOG A;  3Q5R A;  2AEF A;  4H13 C;  3G71 P;  1NKN A;  3A3Y B;  1XTC C;  1FZE A;  1NJI Q;  2P7J A;  4YXD C;  2ZVN B;  3BCC E;  3P7K A;  2KLU A;  4QKO A;  1SQQ E;  3TGU D;  2WSF J;  3B5N D;  4N78 E;  2KOP A;  1T3U A;  1LTT C;  2W83 C;  4OGQ C;  2EHT A;  1J1E B;  4BRY A;  3G1I A;  1ACP A;  1GU5 A;  2GDY A;  1ZXG A;  2E74 D;  1ZP0 C;  1EZV G;  1GK6 A;  2GZI A;  1GW4 A;  3M0A A;  4B86 A;  1DX7 A;  2N5I A;  1SQB K;  3G6E P;  1EXI A;  4Y99 B;  5KP6 B;  2GUV A;  4LC1 A;  1SQX K;  2XKM A;  3P8C E;  1YYC A;  1GDT A;  1FJP A;  1OIP A;  1BDD A;  2XNX A;  2WSF H;  1AQT A;  1YQ3 C;  2AFE A;  1H8A A;  5BVZ A;  3Q5S A;  1QVF O;  1QLE D;  5CZD B;  3HD7 D;  4MN4 C;  4U3F D;  1EMV A;  2B88 A;  1IZN B;  2BHV A;  3V2R A;  2HLO A;  1JNM A;  2M8R A;  5KP8 B;  4U3F G;  5BS2 A;  5HGM A;  2R3S A;  3OW2 O;  2OTL P;  1DNY A;  1PGJ A;  3AEC C;  2OYI C;  1AA0 A;  4PV1 C;  1RNI A;  1BCC G;  1LT9 A;  4PD4 E;  1D7M A;  3M0D A;  1P84 I;  2ROQ A;  2D2C D;  4U3F J;  1R5L A;  3CLQ A;  2KZJ A;  2C9N Y;  3B4Q A;  4C7N B;  2FVA A;  1BCC J;  3L72 E;  1KN7 A;  3JCU H;  4OH8 B;  1PEU A;  3H1I E;  5KLV G;  2G3A A;  1MKM A;  2O01 N;  2YMY A;  2XV5 A;  2E76 D;  1LP1 A;  3BAS A;  1M1K Q;  2HPC A;  1JY2 O;  1OX3 A;  2IZ0 A;  3H1K D;  2FFD C;  3BAT A;  4IFM A;  3GF3 A;  5KLV J;  5DCK A;  1OW7 A;  2L0Q A;  2IYO A;  2E75 D;  4M3L A;  2W6A A;  2K2Q A;  1L0H A;  2JU1 A;  1HJ0 A;  2M3B A;  1AVO A;  4UB8 E;  4U0F A;  4CA3 A;  2FHS C;  3VRL C;  1J2J B;  2YIU B;  2YXQ B;  2XU6 A;  4KHX A;  5KAI H;  1KIL A;  1JUN A;  3BVH A;  4ZKP A;  4ASW A;  1M57 D;  2Y0C A;  3MIW A;  3SFD C;  3NMD A;  4RKU J;  1S9K D;  2JU2 A;  5AVT B;  2N1T B;  3KDP B;  1HUC A;  3HUS A;  2N98 A;  3H25 A;  1GL2 A;  2ZXE B;  1S5L H;  2XT1 A;  1USE A;  4UB6 H;  2M5A B;  3CPW O;  2H43 A;  3AE3 C;  3NXS A;  2O1K A;  4WYM A;  1S3J A;  2GA1 A;  3RK3 D;  2CPS A;  1KOR A;  5E79 E;  1RE3 C;  1GXG A;  2G8Y A;  2K9J B;  1LWU B;  1FZF A;  1NTK D;  3TNU A;  3W68 A;  1SQB E;  3RBZ A;  3U1A A;  1PFI A;  5KP7 B;  1GZL A;  1URQ B;  2Z44 A;  2R44 A;  2X2B A;  1KQG B;  2VSQ A;  1PGP A;  1AYI A;  2WT7 B;  3G3Z A;  5APV A;  4LLH A;  1KB9 E;  1SQX E;  3M9Q A;  1YHQ P;  5KJ7 C;  3S1K A;  5B5E H;  3LMO A;  3FGA D;  1N7S D;  5AW6 B;  2RKL A;  5APW A;  1OW8 A;  3A5T A;  3CX5 E;  2L4B A;  2H8P D;  3RK2 B;  1L0L G;  3IFM A;  1K30 A;  3VN0 A;  1RQU A;  2CQ8 A;  2IZ1 A;  3Q5P A;  3R2P A;  4R4M A;  3WU2 E;  4IFF A;  2KI7 B;  3FXE A;  1L0L J;  1QRJ A;  3GHG B;  1VF5 D;  2PEI A;  4HKZ H;  2M3E A;  1OW6 A;  1G2C B;  1KYO D;  2WQY C;  1E5W A;  3B5N C;  4WB4 A;  3WUU A;  1RF1 C;  2LPK A;  1ZRT E;  3L73 E;  3QH9 A;  3GF7 A;  2E74 C;  2Z5I A;  2QSI A;  1IMQ A;  2A45 I;  2H88 C;  3KHU A;  1J1D C;  3LID A;  3SSU A;  1N73 B;  2BEQ D;  3T97 A;  1SFC B;  1HQB A;  1T3J A;  3S4R A;  3H6P A;  2P2U A;  3M9B A;  2FAD A;  2I8D A;  2PGD A;  2YO2 A;  4D6T D;  3S9O A;  1IK9 A;  2IBZ I;  4I7Z C;  2IPP A;  2WPT A;  1GD2 E;  1NQ4 A;  2KOR A;  3V5B A;  3BRT B;  4C7N A;  3IR9 A;  5B66 E;  1P84 H;  4H2Y C;  1LTB C;  3GJN A;  3P8M C;  1A8O A;  2KGD A;  1BSH A;  1OXZ A;  1IJD B;  3HD7 C;  3L37 A;  3L4F A;  1VQ9 P;  2Y0D A;  1FZC B;  2OYH B;  3CXC O;  2M5R A;  2FXP A;  3H1H D;  2O1J A;  3D6Y A;  5H2F E;  1H88 A;  3MTU E;  3N7N A;  3H1H G;  3AEG C;  2D2C C;  4Z1M H;  2WIT A;  1NGM B;  2L5G B;  3TGU E;  2JJL A;  1RF0 A;  2WZ7 A;  1LTJ C;  2AFD A;  3AE2 C;  2ZYA A;  3H1H J;  1EZV E;  2V4H A;  1NOH A;  4R4L A;  1UIX A;  4N3Y B;  3TDK A;  2VLP A;  2E76 C;  3VMZ A;  4H13 B;  1FJK A;  1G1J A;  1A02 J;  2N1T A;  2NO8 A;  3HRN A;  2MVU A;  2ZAE B;  1NTK K;  1NAY A;  1CI6 B;  2DW3 A;  3DS1 A;  2P58 A;  4BXL A;  1PV3 A;  2PFX A;  1W2E A;  4H44 C;  1YJ9 P;  2SPZ A;  4OGQ B;  1HVV A;  2YKP A;  3O8Z A;  3IF4 A;  3OAK A;  3AEB C;  1PGO A;  4XFZ A;  2BQ1 E;  4CPG A;  1KIL D;  1N86 A;  2WVR A;  1IFM A;  2E5Y A;  3I55 P;  3VMA A;  2NPS A;  4U3F E;  4C7R A;  7CEI A;  5BU5 A;  1KQS O;  1M1J C;  3A0B H;  3H0D A;  5KAI E;  1JY2 N;  5AVW B;  3CCQ P;  1URQ A;  2HR3 A;  3MP7 B;  1GL2 D;  1NTZ D;  3AE4 C;  2WT7 A;  1KQF B;  1VQ4 P;  1PP9 G;  2QIW A;  1M90 Q;  2AEM A;  2FQ1 A;  1IFD A;  4DCK A;  4PXH B;  1ZME C;  1LTS C;  1VQ5 P;  3CD6 P;  1KFM A;  2Y9Y A;  1UNK A;  4YPC A;  1PP9 J;  2K9Y A;  2ZVO B;  3V6I A;  1EC5 A;  2A45 G;  1WMK A;  2QRX A;  3DS5 A;  3RK3 C;  2OYI B;  1HY8 A;  2IBZ D;  3FX0 A;  3H1K E;  2PEM A;  5HVC A;  3A2A A;  3G26 A;  1T8K A;  2OTJ P;  2FKW B;  4ZMD A;  1L0N D;  3RG2 A;  4PJ0 H;  5CCH A;  2J58 A;  4IZ6 A;  3DS0 A;  2IBZ G;  4Y28 J;  1NKZ B;  3OJA B;  3RGU A;  2M8L A;  1Y8A A;  1S5L X;  3AEE C;  1L0N G; 
#chains in the Genus database with same CATH homology
 1VQ8 P;  2JYG A;  1JJ2 O;  1QVG O;  2BHV A;  3DS1 A;  3HZQ A;  3NTE A;  2XT1 A;  1EIA A;  3G28 A;  1YJN P;  1K9M Q;  1VQN P;  2XXM A;  1YJ9 P;  1VQL P;  5BS2 A;  5HGM A;  2PY8 A;  3OW2 O;  2OTL P;  1KD1 Q;  3HYB A;  3DTJ A;  5BS1 A;  4PH1 A;  3CCJ P;  3WBH A;  3CPW O;  1K8A Q;  2BUO A;  1M6N A;  3DPH A;  1RNI A;  4XFX A;  3LRY A;  4COP A;  3RG6 C;  2EIA A;  2CWO A;  2LF4 A;  3G1G A;  3CC7 P;  1Q86 Q;  4WYM A;  4XFZ A;  2BQ1 E;  3DS4 A;  1PEM A;  1IUQ A;  1Q7Y Q;  3M1M A;  1VQ7 P;  2M8P A;  2PEN A;  2KOD A;  1M74 A;  3I55 P;  3G71 P;  5HGO A;  3G4S P;  3CCE P;  1NJI Q;  4U0B A;  1PEU A;  5F2K A;  3CCR P;  3CCS P;  5HGN A;  1M6E X;  1D1D A;  2Z44 A;  1KQS O;  4XFY A;  2L6E A;  3H0D A;  3Q20 A;  1Q81 Q;  1A8O A;  1M1K Q;  3CMA P;  3CCQ P;  1YI2 P;  5I4T G;  3G1I A;  4IPY A;  2ONT A;  4XRQ A;  2OAR A;  5DCK A;  1YHQ P;  1VQ9 P;  1RO2 A;  1ZMB A;  1YIJ P;  4U0C A;  3CXC O;  1VQ4 P;  4M0I A;  1M90 Q;  1RO0 A;  1W2B O;  3CCL P;  3CCV P;  3DS3 A;  3MGE A;  3CCU P;  3I56 P;  4GR2 A;  3G21 A;  1A43 A;  4U0F A;  1VQ5 P;  3G6E P;  3CD6 P;  1VQO P;  1K30 A;  2P9X A;  2Z45 A;  3B5I A;  3VRL C;  1VQK P;  1AUM A;  2PEJ A;  4COC A;  1EOQ A;  1Q82 Q;  3H47 A;  3DS5 A;  1PEO A;  1VQ6 P;  2XV6 A;  1S72 P;  3P05 A;  2QEX P;  3H4E A;  1YJW P;  1BAJ A;  2JO0 A;  1QRJ A;  2JYL A;  2PEM A;  3CC4 P;  1PEQ A;  1YIT P;  1VQM P;  3E2D A;  2M8N A;  4U0D A;  1K73 Q;  4U0A A;  2PEI A;  3DS2 A;  4XRO A;  2E1M A;  4QNB A;  5F2N A;  3CCM P;  3G26 A;  2OTJ P;  4GR6 A;  2PEQ A;  1KC8 Q;  2EG5 A;  3DS0 A;  4U0E A;  2QA4 P;  1VQP P;  2DGY A;  3G0V A;  5JPA A;  1QVF O;  5F2O A;  4PH0 A;  2M8L A;  3CC2 P;  2Z46 A;  3CME P;  2PEK A;  1E6J P;  5HGL A;  2EFJ A;  2PEO A;  1N8R Q;  3G29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...