1VQLP

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqlP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqlP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqlP02
3CC7P 2OTLP 2QA4P 1VQ5P 1VQLP 1NJIQ 1Q82Q 3I56P 3CCRP 3OW2O 3CD6P 1YJNP 2OTJP 3G6EP 1VQMP 3CMEP 1YI2P 2QEXP 3CCEP 1KC8Q 1VQ7P 3CCUP 1VQ8P 3I55P 3CCQP 1VQNP 3CMAP 1VQ9P 1Q81Q 1KQSO 1K9MQ 1K73Q 3CXCO 1YJ9P 1N8RQ 1VQ6P 3CC4P 1YJWP 3CCLP 1K8AQ 1M1KQ 1YIJP 3CC2P 1VQOP 3CPWO 1KD1Q 1Q7YQ 1VQKP 1QVGO 1M90Q 1YHQP 3G71P 1Q86Q 1QVFO 1VQ4P 3CCJP 3CCMP 3CCSP 1S72P 3G4SP 3CCVP 1VQPP 1W2BO 1JJ2O 1YITP
chains in the Genus database with same CATH superfamily
4U0BA 5KJ7C 3L73G 2H7HA 4L74A 2HLOA 1LTIC 1OW8A 3RK2C 2M3EA 2E76C 2MR7A 5CZDB 1HBWA 1GW3A 4LGDE 2ZAEB 1NU1K 2PEOA 1NAYA 1NTKE 2JQ4A 1BGYJ 1ZMBA 2FYNC 1BGYD 1GZLA 4EOTA 1D7MA 1YTZT 3H1JE 5B5EH 2XV5A 2KORA 1URQD 2KZJA 1SQPG 5CHXA 2N98A 2O01J 1NTZE 4IFFA 1PP9J 1SQXG 1PP9D 3M0AA 5CCHA 2QIWA 2Z46A 3GF3A 3L72G 1A02F 2K37A 2WSSH 3MIWA 1X79B 3H47A 2YXQB 4GR2A 2B87B 3IN6A 2QJYC 1KILC 1LP1B 1SQVG 2K88A 3QH9A 1NTMJ 2P2UA 5HVCA 1NTMD 3HD7B 3A3YB 4NPFX 5CCGC 1BAJA 2E74C 2J59M 4U0AA 3AE5C 2PENA 1M6NA 1BGYE 2A06E 3R2PA 2GDXA 1QRJA 4TT3H 1LTTC 1JCCA 4JBZA 1VF5B 4XRQA 3CCMP 2FXMA 2J58A 1N7SD 1RO2A 4D6TJ 2MY5A 5APQA 4DJGA 2ZFCA 1Q90D 3MHVA 2EHTA 3L35A 3JCUE 4H44B 2OYHC 2N50A 4H13C 4H2WC 2HG5D 1NU1D 2B89A 2VLPA 3B5IA 1PP9E 1QVGO 2Y0EA 4ZKPA 1J1DC 2O1JA 3C1LA 1ZRTD 3CC7P 2GZEA 1VQLP 3W67A 4OVNF 2FVAA 4COCA 1MZ9A 4NPDA 1K30A 3A0HE 1NTME 1LT9B 2Q3IA 2QRXA 1X0TA 1ACPA 1GTWA 2SPZA 2E75B 1LT1A 5B66E 3V2RA 1YITP 1E0HA 1KN7A 1HJBA 4CPGA 1M56D 1OW7A 2N5IA 2Y9ZA 1KLPA 1SQVK 4C7RA 3AEEC 2XU6A 1JY2N 3EJBA 1X8YA 2K1AA 1N8RQ 2QNWA 2BUOA 3MUDC 1N73C 2GYKA 2XNDH 2K9JB 3L73J 1LNQA 3RL0C 3L70D 2FBWC 4AQRD 4PXHB 2KG8A 2KK7A 2K5XA 1ZRTE 4EI2A 2BCCG 3E1IA 3N7NA 1PZQA 1KYOI 2AEJA 3GKLC 3RK3B 1GL2A 4YXWH 4GKGA 2RH0A 3RL0g 1IFDA 4PWVB 2AXCA 4N78D 1FDOA 5AVUB 2PFXA 2PEJA 2E5TA 3M0DC 2R5DA 2K2QA 3B5ND 3M9QA 4JYCA 1S2EA 3C9IA 3DS0A 1JMBA 1OZHA 4XROA 2XKMA 1CI6A 2LKMA 2ZYGA 2R44A 3AEBC 1SQPJ 2GZJA 2Z5IA 1JB0J 3CCVP 2M8RA 2N5HA 1EDLA 2P10A 2WVRA 1SQXJ 1FDMA 2C0WA 2A45H 3L72J 5APSA 4MN4C 1KYOE 3L73E 3CMAP 1KV4A 1OIPA 3L75J 2GZFA 2H8PD 2CQ8A 3TDKA 5BVZA 2MF4A 2H88C 2KLVA 1SQVJ 1SQVD 1HWTC 2Z4EA 5AVTB 3RK2B 1WMKA 1GK4A 4NPEA 1AQTA 2E76B 3TGUG 1JY3N 1NOHA 4N78E 1VQNP 2Z44A 1YJWP 2QJPC 1FR2A 2JO0A 1OX3A 2FYNB 2FFDA 2WSEH 1DNYA 2POHA 3U1AA 1IJDB 1EQ7A 1SQPE 2W90A 1Z6MA 2N1TD 2YIUC 3G1GA 2KS1B 5B66H 3Q5SA 3O6QB 1UJZA 3L72E 4WY4C 1SQBK 2NPSC 3GZMA 5EW5E 3RK2D 1GPJA 1VL2A 3GJNA 3LW5H 4PV1C 2Q7CA 1JTHB 1SQVE 2PP6A 1KTMA 2Z45A 4PJ0H 1YJNP 1FZCC 3BVHA 1R5LA 2D2CD 2QJYB 1KILB 1HJ0A 4U3FD 3CCQP 1KQSO 2R3CA 1MZ8A 1PEMA 3G21A 2FAEA 5CCHD 3RGUA 2E74B 1URQA 4IFDK 3NFQA 3MP7B 3V4QA 3Q3DA 3A5TA 3U1CA 5APUA 2NZ2A 1ZLLA 3NXSA 3P05A 1JOCA 1W5CE 2UWJE 5BU8B 2AFEA 2W6BA 3H1KD 1ZV8A 4C7NA 4JPZB 4WVZA 4XA4A 2OYHB 4Y99C 4H13B 4AUWA 3KYQA 1YQ4C 1RE4A 3LRYA 2BCCJ 2J5UA 5KAIE 2L9FA 1M7LA 2Q9IA 3G3ZA 1EZVG 1RQVA 1HTLC 5CCGD 3VTPC 2CNRA 3M06A 1N7SA 3S9OA 5K5GB 2KB7P 2KOQA 3P7KA 1SQBD 3CMEP 2WPQA 1VF5C 2JYGA 2VLQA 5AW0B 1OW6A 2B87A 2A45G 2GDWA 1LP1A 3V2PA 2N6YA 2WPRA 2EFJA 4W7YA 4DCKA 3U43A 4OGQD 2Q5UA 2YNYA 1VKUA 1N73B 1S5LH 1IFMA 1U7JA 2C9LY 1MFZA 3E7KA 3RL0B 3H1LD 4QNBA 2BCCE 2L4BA 5AVWB 3EJEA 3TGUJ 1Q2NA 1U7MA 1RF0C 4BPFA 4UHPB 1XTCC 1EDIA 3KDPB 1L0IA 1YI2P 2B88A 2M5AB 1F80D 1LTAC 4DZOA 2CPBA 1ZR2A 2N6ZA 1NAFA 3V6IA 5AW7B 2KP8A 3RG6C 1FU1A 2YMKA 3RBZA 1RF1C 2WPTA 2N9BA 2HPCB 5L8RJ 1NU1G 1FZFA 1PV3A 1MKMA 3GHGA 2FKWB 1DH3A 1AYIA 2ZVNB 3B5NA 3IAOA 2VSQA 1L4AB 3TGUE 3RK3C 2H89C 3CXCO 1ZNVA 2FYZA 2IPPA 4L75A 2YXRB 1YIJP 1IC2A 1UNKA 3DS2A 1PIXA 5KKZC 3GF7A 1DIPA 3D6ZA 2ONTA 4U0FA 1LTSC 4R0MA 1GXHA 3BATA 2WPVB 2WWWA 3L71D 2BEQD 3TNUB 2OTKE 1M57D 4GODA 1EOQA 2YIUB 2I8DA 1J2JB 1DEEG 1T8ZA 5BS1A 4GOFA 2AVAA 4WY4B 3I56P 2NPSB 5CBOA 3L70G 3TF5A 1EZVD 3PTZA 1MFTA 4PV1B 2RKLA 2H43A 2NRGA 4I1LA 1FZCB 2ZT9D 1GU5A 3CCJP 2IX7C 2QA4P 3V2QA 1L0LK 2N1TA 1EZVI 1FBMA 3AE2C 2KOPA 4BRYB 1YYCA 3FXEA 4K3AA 3TSIA 1FS0E 2KGAA 3G28A 5KJ7A 4WYMA 5CJ0A 1SFCC 1GK6A 1HVVA 3HRNA 4EIJA 2ZVOB 1IFJA 1BDCA 1KB9D 1FZGA 1LTJC 2A45I 3E1RA 5AVYB 4ZMDA 1T2KC 1NH4A 1JMMA 3OAKA 4PV1D 4Y99B 2WT7B 2KR5A 1KB9I 1HQBA 1EZVE 1KZUB 1GU4A 1IZNB 3HYBA 2PEQA 3IF4A 2WSEJ 3S4RA 4C46A 3O6QA 1DV5A 1PFIA 5HGNA 1WT6A 1M1KQ 1FJPA 3AE4C 3D71A 1JTHA 1USEA 4TLFA 2FQ2A 2W83C 1AJYA 1KILA 3LW5J 2V4HA 1GW4A 2JWDA 3H0DA 1KB9E 5AW8B 1HH0A 2XZ1C 3H4EA 4H0LC 5CCGA 1NU1J 1L0LD 2KW2A 2PY8A 3M9BA 1FAVA 3HTKB 2ZXEB 5KTBA 2KOSA 3HD7D 3VP8A 4IPYA 2JO1A 1AVYA 4Y28J 4U3FG 3CCLP 2G3AA 3CWBD 3SWYA 2OYHA 2LXBA 1JY2O 1VF5D 2KOGA 2LL8A 1ZR4A 3K5BA 2FXPA 3GW6A 3MD0A 3O8ZA 2O1KA 2IBZD 1CEIA 4H44D 4IFMA 3P8MC 5APVA 2DW3A 4PJ0E 1Q86Q 3H1KG 4ZNCA 2WSFH 1NU1E 1RF1B 4N6JA 2OTLP 3L70J 3G29A 1G2CB 3G9RA 1EDJA 2WPSA 4KJMA 3EJDA 2C0XA 5CMZA 3RBXA 2GZGA 2E75D 1FOSE 2KOOA 3CWBE 2GDYA 3CCSP 2K3RA 3MUDA 1ZOYC 5APYA 4B86A 1CW5A 3CCRP 3USSA 5KKZB 1J1EB 1QL1A 1SQBG 2QJKC 3HUSC 4DOJA 4OH8B 5DJUB 3FX0A 2QVAA 1RNIA 1QEXA 1AUMA 2RN0A 3L74G 2OGUA 1XTGB 4GT1A 5HGMA 1PEUA 2WTYA 1S72P 2ERHA 1H89A 4R4LA 1YBKA 1KFNA 2AF8A 2YKPA 2M5AA 1L2PA 2WITA 2QSIA 2FXOA 3L70E 3WUVA 2OARA 4HH2A 1LWUC 3S1KA 5BU5A 1JY3O 3H25A 2ZJSE 3RK3D 3H1LG 1L4AC 1KB9H 3BRTB 4UB8E 2OYIC 3A0BH 4YXDC 1OWAA 3CD6P 1MV8A 4U7JA 2DGYA 3AE7C 1VQ8P 2HPCA 2PEKA 2W8ZA 2BHVA 2FFDC 1S5LE 4ASVA 3SSUA 2K93A 1PGQA 2FADA 1M1JC 2I1KA 3DS3A 2PRRA 3VMAA 2R32A 3A7OA 1SFCB 3SFEC 1JUNA 3C8VA 3QWOC 3DS4A 2M8NA 1H88A 5DJTB 2Y0DA 3P8CD 4HKZH 3L4FA 2FACA 1G1IA 1LTJB 3ZDMA 2FY8A 3WUUA 1RO0A 2AXTH 5KJ7D 2V7QH 2XV6A 2KNCA 4IOIH 3UIAA 2ROQA 3KQGA 2BASA 1Y8AA 1X22A 3V5BA 3WMM0 5HGLA 3VN0A 2E76D 1S5LX 3HZQA 3P32A 5AVRB 3TNUA 2GUSA 4U3FJ 2BEZF 1URQC 1FZAA 3Q20A 2JU2A 1JCDA 1L0HA 3KHUA 2KGDA 1EMVA 2AEFA 4ZKUA 3CLQA 4WY4A 2NPSA 1SFCD 5I4TG 4YPCA 2WQYC 1OFCX 3M1MA 2KSEA 1JY2P 3Q5RA 2CWOA 3H32B 1FZCA 3FWLA 3P8CE 3H1KJ 1S1CX 3L71G 3Q5PA 2MKVA 1DD3A 1OMIA 1IFPA 2Q6QA 4H0LB 1RE3C 3HE5B 3IR9A 3GG2A 3EWKA 3WBHA 4L76A 5KAFH 1KILD 1DEBA 5JPAA 1M6EX 1DD4A 3AE1C 2L91A 1HF9A 4U3FE 2E74D 2CK3H 2M5RA 2XZRA 5F2OA 2VRSA 2K0XA 4IL6E 3B71A 1SQBJ 3G6EP 3I5CA 2VLOA 2IFMA 5GTHE 4UB8H 4JF7A 3L74J 1LTBC 3L74D 2I1JA 2HR3A 1E79H 2R3SA 3AEFC 1SS1A 2RMZA 3H1KE 1L0NK 3HD7A 2WZ7A 4H13D 4BWNA 3ITKA 1NWQA 5AW1B 4U0CA 4IL6X 3H1LJ 5AW3B 1KILE 2YMYA 1IK9A 1N2DC 3DS5A 3H1HD 1KQFB 4QMAA 2JGPA 4W7ZA 3WU2E 1AQ5A 2L6EA 1E5WA 2K94A 3LMOA 2Y9YA 4KT0J 1JY3P 1NTKK 2P1JA 1X9VA 2HODB 1Q81Q 5CJ4A 1SQBE 3U59A 5AVSB 3II6A 2GA1A 2QM8A 1CI6B 3L74E 1AA0A 4PH1A 2QJKB 3HUSB 4GIFA 4I2LC 1VDFA 1AF8A 1LT9A 1RF0A 3BCCG 4RJTA 1VQ9P 3WUTA 3RL0D 1PL5A 3AEGC 3MTUE 2JAZA 1OVRA 1L0LG 2C9NY 3H1LE 3B5NC 3H1ID 1LWUB 3H1HE 3VRLC 1CSBA 2JU1A 5AW2B 4D6TG 1IMPA 5M1BA 2OYIB 1IUQA 1SQQG 1NGMB 1FOSF 3M9HA 1L0ND 2K9JA 2K9YA 1RF1A 4EYYQ 2IZ1A 1EXIA 5APTA 4I7ZC 5CBNA 2IYPA 2O01N 3CWBG 1J1EC 1G2CA 3SWFA 2Y0CA 1VQPP 2ZXXA 1W2BO 3BASA 2WSFJ 2JB0A 3AEAC 2FFDB 4Z1MH 3D6YA 2FVEA 3MZWB 2KGCA 1Y47A 2LF4A 2KYVA 1M1JB 1NHLA 3L71J 4DG9A 1NYHA 1R8EA 2IBZG 4IL6H 3OA7A 5HV8A 1K8AQ 4BPGA 1T3UA 3H6PA 2AFDA 4I6MC 1NTKD 3VMYA 1WRGA 1VHNA 5GTHH 3V4WA 3ABVC 2LKIA 2JR8A 1HGZA 2JDIH 1L4AD 3H1JD 3PH0A 3JSVC 1PGOA 5E79E 3JC22 2EHSA 3RG2A 1FZBA 3CX5D 2IFNA 3TK1A 3HE4B 1PGPA 3B4SA 2N1TC 2KG9A 2FYUG 4YTPC 1URQB 1FDIA 4XFJA 1JJ2O 2OYOA 2KLUA 1KMIZ 2EG5A 1P84D 2LXCB 1BSNA 3CX5I 2VLNA 3PJSK 1M74A 3WU2H 3AE9C 1CZQA 1SQQK 1VQOP 3L71E 1YHQP 1P84I 2D2CC 1UIXA 1JNMA 3MGEA 4C7NB 2K92A 2E5YA 1N86A 4UB6H 4WY4D 2NPSD 1T8KA 5CCHC 2QM7A 1S4XA 2A06D 2OQQA 3NY7B 4BPHA 2FHSC 1JEKA 3I55P 4K35A 4OWFA 5C39A 2QE7H 1GXGA 4IZ6A 3B8EB 1NKZB 1VQ4P 3CX5E 1SFCA 3VOPA 1KQGB 1N7SB 2JKVA 3L36A 5AW5B 1YQ3C 1RQUA 2KS1A 1LTJA 3F89A 1VQ7P 1TU3F 2HYNA 1P84E 3N4XA 1H8AA 2CGQA 3L75G 3SFDC 2V7QJ 2JP3A 4LC1A 2X2BA 3VP9A 3BCCJ 5APWA 2FYUK 3BCCD 1T6AA 1SVFA 4N3YB 1S9KD 2PGDA 2WSCJ 3A0BE 3LIEA 1L0LJ 1PEQA 1AV1A 2ZYAA 1NKNA 1JM0A 4RO0A 1VQ5P 1HGVA 3Q2YA 4D6TD 1OVUA 1SQQJ 2LR2A 1SQQD 3H32A 4ASWA 1BXIA 4U0EA 1DX7A 4OGQC 2FQ0A 2ITAA 3CWBJ 3AE3C 1H0TB 4HB1A 3KZIE 1Q7YQ 5KP7B 3HE5A 2DNWA 1QVFO 2JJLA 1KORA 2MVVA 4LLHA 5E79H 2CPSA 4PH0A 4XFXA 2LTEA 1BDDA 1GMJA 2KGEA 2AXTE 1ZXGA 2M0BA 1SQPK 1PEOA 3VMZA 3BCCE 1USDA 3IFMA 1SQXK 1S9KE 1SP4A 2P67A 1E6JP 2LOLA 3DPHA 1L0LE 4PD4D 3GZLA 1HUCA 2IBZI 2LIUA 3CL3D 2HFED 3GHGB 1OXZA 1VQMP 7CEIA 1D1DA 3B5NB 4D6TE 1PPJG 1R5SA 1G1JA 5AW4B 1SQQE 1GL2C 2Q1KA 3EFFK 4PD4I 1BE3G 2EIAA 2FYUJ 1QLED 2FYUD 4GDOA 4HKGA 3TYYA 1N73A 1KYOD 3L73D 3T97B 4I7ZB 3M91A 5KLIC 3CX5H 1LJ2A 2IDBA 3L37A 2IBZE 1VQKP 3D70A 3VYIA 1FJKA 2YO2A 5AW9B 5KAFE 2YKQA 1ZN5A 5KP6B 3CC4P 1P84H 2L22A 2M3BA 3FGAD 3DS1A 1U57A 5AW6B 2HODA 2KI7B 4PD4E 2NO8A 1GDTA 4BXLA 1LTGC 4COPA 1ZW0A 3LIDA 2QG4A 3M0DA 1NO4A 4L73A 1FZEA 4GR6A 5DCKA 4A7PA 3EFGA 1PGJA 4H2XC 2ZYDA 3HUSA 2XT1A 5BS2A 1SQPD 5TJHA 1IO4A 3CCEP 3H1HG 2FYUE 3AE6C 4NEOA 1SQXD 3CI9A 2N1TB 4KHXA 3L72D 3CXHD 1FE6A 3PRJA 2KG6A 2P9XA 1K9MQ 2E42A 1A02J 3L75D 2MD9A 4H2YC 1LWUA 4W80A 1RY3A 2IYOA 2FQ1A 2AEMA 3V2NA 2PAJA 2Z5HA 1A43A 3CXHI 3JCUH 1BSHA 1L4AA 3SWKA 2O01H 2OYIA 3AEDC 2FVFA 5F2NA 4QKOA 3KXDA 2O3JA 2ZT9C 3KZIH 2GM4A 2D2CB 5AVVB 3PLNA 2R5BA 2PEIA 1QL2A 2YKOA 1NVOA 3CPWO 4GOEA 5KLVG 1BCCG 3A0HH 2Q3EA 3RK3E 2M8PA 1EC5A 1M1JA 3H1IG 3BRVB 2XDJA 1N7LA 1FC2C 2WSCH 1SQXE 1K73Q 3CXHE 4AYCA 3NTEA 1KD1Q 5AVZB 1L0NG 3F5HA 3L75E 3G0VA 2MJZA 4EDFA 2KODA 2CG5B 2XXMA 1UIIA 1LGHB 4HYTB 4F37A 2E43A 3HE4A 5TISE 1S3JA 1KFMA 2KUBA 5H2FE 1QX8A 1T2KD 4M0IA 3B4QA 1RE4C 3MGNA 4BRYA 5GTIE 1NTKG 3FWNA 1AFOA 2XNXA 4O9BA 3OW2O 1PPJD 1ZP0C 1W2EA 1KC8Q 1BE3J 3H1JG 2PNGA 1BE3D 1N7SC 2GUVA 2L0QA 3G26A 4PD4H 1A8OA 1QGKB 1IFIA 1MUUA 1AVOA 5KLVK 4OGQB 2PEMA 1IFNA 1NTZG 2K0YA 3AECC 1RE3A 2BCCD 1J1DB 2WT7A 1KQLA 2B9BA 3W68A 1VQ6P 4RKUJ 5EFWB 3KPEA 1EXJA 2GZIA 3HD7C 3NMDA 3G1IA 2XZ0D 3G71P 2JWAA 2LIWA 1KYOH 2W27A 4H0LD 4WB4A 4XFZA 2WMMA 1OVVA 2JBGA 1BGYG 1PPJE 2A06G 2KWLA 1BE3E 3H1HJ 2IZ0A 1Y9BA 2KIKA 4DT0A 3PP5A 1JO5A 4H44C 1GL2B 2KXPB 3Q1MA 3PHLA 1YTZI 2N9YB 1SLQA 1IK7A 1PP9G 3AE8C 4UB6E 1HY8A 2P7JA 5KLIB 5HGOA 3FXDA 3HTKA 1GD2E 2MR8A 1K05A 3CE7A 1LT9C 3TGUD 5B5EE 3CXHH 1K04A 5AVXB 1NQ4A 4R4MA 2E1MA 2E75C 1NTMG 3EQ2A 3CCUP 5APXA 1NTZK 1H0TA 5KLVJ 3GLMA 5F2KA 5KLVD 1BCCJ 3CC2P 1BCCD 4WBAA 3GHGC 1VPCA 3E2DA 1EDKA 3H1IJ 3G4SP 1GL2D 1IMQA 5TISH 4JQ0D 3A2AA 5H2FH 4HJGH 2W6JH 4WWIA 5AVQB 4JYBA 5GTIH 1L0NJ 1ZMEC 2LMLA 1M8OB 1RH5B 1T3JA 5EJDA 2KZIA 2MVUA 1EIAA 2L5GB 3OJAB 2LPKA 1YJ9P 3DTJA 1OR5A 2ZT9B 1M90Q 1NTKJ 5KLVE 4XFYA 3T97A 4U0DA 5KAIH 1BCCE 2P58A 2YO3A 2KNCB 4M3LA 2QJPB 1NJIQ 1Q82Q 2BQ1E 5KP8B 2KSJA 3H1JJ 2JYLA 3H1IE 2JEEA 2OTJP 4RESB 2QEXP 2W6AA 3NTNA 2M8LA 1RHZB 2K0DX 1NTMK 1X3OA 1Z56A 4MRTC 3GMAA 4XE5B 4CA3A 3VMXA 3R4YA 1L0NE 2G8YA 1NTZJ 1NTZD
chains in the Genus database with same CATH topology
1RO2A 4U0FA 3VRLC 2OTLP 2PEJA 3G29A 3DS4A 4U0BA 2M8NA 3OW2O 2Z45A 1YJNP 3G6EP 1PEOA 2E1MA 1KC8Q 1IUQA 3CCUP 3I55P 3CCQP 2P9XA 1KQSO 1K9MQ 3DS0A 5HGNA 4XROA 4QNBA 5F2KA 1PEMA 1M1KQ 3G21A 3CC2P 1RO0A 3B5IA 1EOQA 1QVGO 1E6JP 3G26A 2XV6A 1A8OA 1VQ4P 3E2DA 5BS1A 3CCSP 1A43A 3DPHA 3G4SP 1VQPP 3CCVP 1W2BO 3CC7P 2PEMA 2PEOA 1VQLP 5HGLA 3I56P 3CCRP 3HZQA 5F2NA 3H0DA 4COCA 1ZMBA 1VQMP 1D1DA 1K30A 2LF4A 1YI2P 1VQ7P 3P05A 4U0CA 3CMAP 3H4EA 1VQ6P 3Q20A 2PEIA 2EIAA 1K8AQ 1RNIA 3CPWO 1AUMA 3DS5A 3G1IA 2PY8A 3G71P 5HGMA 3CCJP 1PEUA 1S72P 1YITP 2QA4P 2L6EA 5I4TG 2M8PA 1EIAA 3M1MA 4XFZA 3RG6C 3LRYA 4IPYA 1VQNP 2CWOA 3G28A 1Q81Q 2OARA 2Z46A 1K73Q 4WYMA 1YJ9P 3DTJA 1N8RQ 2Z44A 1YJWP 3CCLP 2BUOA 3NTEA 1KD1Q 1VQKP 2JO0A 1M90Q 1PEQA 3H47A 4GR2A 3G0VA 4XFYA 4U0DA 4PH1A 1JJ2O 3CC4P 1VQ5P 1NJIQ 3DS1A 1Q82Q 2KODA 2BQ1E 2XXMA 2EG5A 3CD6P 2JYLA 2OTJP 1BAJA 3CMEP 3WBHA 2QEXP 4PH0A 2DGYA 3G1GA 4U0AA 4U0EA 1VQ8P 2M8LA 2JYGA 1VQ9P 4COPA 3CXCO 5JPAA 2PEKA 2PENA 1M6EX 1M6NA 1M74A 2BHVA 1QRJA 4GR6A 5DCKA 1YIJP 1VQOP 1Q7YQ 3DS2A 2XT1A 1YHQP 1Q86Q 5HGOA 2EFJA 5BS2A 1QVFO 3HYBA 4M0IA 4XRQA 3CCMP 3MGEA 5F2OA 3CCEP 3DS3A 2ONTA 4XFXA 2PEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 P;  2OTL P;  2QA4 P;  1VQ5 P;  1VQL P;  1NJI Q;  1Q82 Q;  3I56 P;  3CCR P;  3OW2 O;  3CD6 P;  1YJN P;  2OTJ P;  3G6E P;  1VQM P;  3CME P;  1YI2 P;  2QEX P;  3CCE P;  1KC8 Q;  1VQ7 P;  3CCU P;  1VQ8 P;  3I55 P;  3CCQ P;  1VQN P;  3CMA P;  1VQ9 P;  1Q81 Q;  1KQS O;  1K9M Q;  1K73 Q;  3CXC O;  1YJ9 P;  1N8R Q;  1VQ6 P;  3CC4 P;  1YJW P;  3CCL P;  1K8A Q;  1M1K Q;  1YIJ P;  3CC2 P;  1VQO P;  3CPW O;  1KD1 Q;  1Q7Y Q;  1VQK P;  1QVG O;  1M90 Q;  1YHQ P;  3G71 P;  1Q86 Q;  1QVF O;  1VQ4 P;  3CCJ P;  3CCM P;  3CCS P;  1S72 P;  3G4S P;  3CCV P;  1VQP P;  1W2B O;  1JJ2 O;  1YIT P; 
#chains in the Genus database with same CATH topology
 4U0B A;  5KJ7 C;  3L73 G;  2H7H A;  4L74 A;  2HLO A;  1LTI C;  1OW8 A;  3RK2 C;  2M3E A;  2E76 C;  2MR7 A;  5CZD B;  1HBW A;  1GW3 A;  4LGD E;  2ZAE B;  1NU1 K;  2PEO A;  1NAY A;  1NTK E;  2JQ4 A;  1BGY J;  1ZMB A;  2FYN C;  1BGY D;  1GZL A;  4EOT A;  1D7M A;  1YTZ T;  3H1J E;  5B5E H;  2XV5 A;  2KOR A;  1URQ D;  2KZJ A;  1SQP G;  5CHX A;  2N98 A;  2O01 J;  1NTZ E;  4IFF A;  1PP9 J;  1SQX G;  1PP9 D;  3M0A A;  5CCH A;  2QIW A;  2Z46 A;  3GF3 A;  3L72 G;  1A02 F;  2K37 A;  2WSS H;  3MIW A;  1X79 B;  3H47 A;  2YXQ B;  4GR2 A;  2B87 B;  3IN6 A;  2QJY C;  1KIL C;  1LP1 B;  1SQV G;  2K88 A;  3QH9 A;  1NTM J;  2P2U A;  5HVC A;  1NTM D;  3HD7 B;  3A3Y B;  4NPF X;  5CCG C;  1BAJ A;  2E74 C;  2J59 M;  4U0A A;  3AE5 C;  2PEN A;  1M6N A;  1BGY E;  2A06 E;  3R2P A;  2GDX A;  1QRJ A;  4TT3 H;  1LTT C;  1JCC A;  4JBZ A;  1VF5 B;  4XRQ A;  3CCM P;  2FXM A;  2J58 A;  1N7S D;  1RO2 A;  4D6T J;  2MY5 A;  5APQ A;  4DJG A;  2ZFC A;  1Q90 D;  3MHV A;  2EHT A;  3L35 A;  3JCU E;  4H44 B;  2OYH C;  2N50 A;  4H13 C;  4H2W C;  2HG5 D;  1NU1 D;  2B89 A;  2VLP A;  3B5I A;  1PP9 E;  1QVG O;  2Y0E A;  4ZKP A;  1J1D C;  2O1J A;  3C1L A;  1ZRT D;  3CC7 P;  2GZE A;  1VQL P;  3W67 A;  4OVN F;  2FVA A;  4COC A;  1MZ9 A;  4NPD A;  1K30 A;  3A0H E;  1NTM E;  1LT9 B;  2Q3I A;  2QRX A;  1X0T A;  1ACP A;  1GTW A;  2SPZ A;  2E75 B;  1LT1 A;  5B66 E;  3V2R A;  1YIT P;  1E0H A;  1KN7 A;  1HJB A;  4CPG A;  1M56 D;  1OW7 A;  2N5I A;  2Y9Z A;  1KLP A;  1SQV K;  4C7R A;  3AEE C;  2XU6 A;  1JY2 N;  3EJB A;  1X8Y A;  2K1A A;  1N8R Q;  2QNW A;  2BUO A;  3MUD C;  1N73 C;  2GYK A;  2XND H;  2K9J B;  3L73 J;  1LNQ A;  3RL0 C;  3L70 D;  2FBW C;  4AQR D;  4PXH B;  2KG8 A;  2KK7 A;  2K5X A;  1ZRT E;  4EI2 A;  2BCC G;  3E1I A;  3N7N A;  1PZQ A;  1KYO I;  2AEJ A;  3GKL C;  3RK3 B;  1GL2 A;  4YXW H;  4GKG A;  2RH0 A;  3RL0 g;  1IFD A;  4PWV B;  2AXC A;  4N78 D;  1FDO A;  5AVU B;  2PFX A;  2PEJ A;  2E5T A;  3M0D C;  2R5D A;  2K2Q A;  3B5N D;  3M9Q A;  4JYC A;  1S2E A;  3C9I A;  3DS0 A;  1JMB A;  1OZH A;  4XRO A;  2XKM A;  1CI6 A;  2LKM A;  2ZYG A;  2R44 A;  3AEB C;  1SQP J;  2GZJ A;  2Z5I A;  1JB0 J;  3CCV P;  2M8R A;  2N5H A;  1EDL A;  2P10 A;  2WVR A;  1SQX J;  1FDM A;  2C0W A;  2A45 H;  3L72 J;  5APS A;  4MN4 C;  1KYO E;  3L73 E;  3CMA P;  1KV4 A;  1OIP A;  3L75 J;  2GZF A;  2H8P D;  2CQ8 A;  3TDK A;  5BVZ A;  2MF4 A;  2H88 C;  2KLV A;  1SQV J;  1SQV D;  1HWT C;  2Z4E A;  5AVT B;  3RK2 B;  1WMK A;  1GK4 A;  4NPE A;  1AQT A;  2E76 B;  3TGU G;  1JY3 N;  1NOH A;  4N78 E;  1VQN P;  2Z44 A;  1YJW P;  2QJP C;  1FR2 A;  2JO0 A;  1OX3 A;  2FYN B;  2FFD A;  2WSE H;  1DNY A;  2POH A;  3U1A A;  1IJD B;  1EQ7 A;  1SQP E;  2W90 A;  1Z6M A;  2N1T D;  2YIU C;  3G1G A;  2KS1 B;  5B66 H;  3Q5S A;  3O6Q B;  1UJZ A;  3L72 E;  4WY4 C;  1SQB K;  2NPS C;  3GZM A;  5EW5 E;  3RK2 D;  1GPJ A;  1VL2 A;  3GJN A;  3LW5 H;  4PV1 C;  2Q7C A;  1JTH B;  1SQV E;  2PP6 A;  1KTM A;  2Z45 A;  4PJ0 H;  1YJN P;  1FZC C;  3BVH A;  1R5L A;  2D2C D;  2QJY B;  1KIL B;  1HJ0 A;  4U3F D;  3CCQ P;  1KQS O;  2R3C A;  1MZ8 A;  1PEM A;  3G21 A;  2FAE A;  5CCH D;  3RGU A;  2E74 B;  1URQ A;  4IFD K;  3NFQ A;  3MP7 B;  3V4Q A;  3Q3D A;  3A5T A;  3U1C A;  5APU A;  2NZ2 A;  1ZLL A;  3NXS A;  3P05 A;  1JOC A;  1W5C E;  2UWJ E;  5BU8 B;  2AFE A;  2W6B A;  3H1K D;  1ZV8 A;  4C7N A;  4JPZ B;  4WVZ A;  4XA4 A;  2OYH B;  4Y99 C;  4H13 B;  4AUW A;  3KYQ A;  1YQ4 C;  1RE4 A;  3LRY A;  2BCC J;  2J5U A;  5KAI E;  2L9F A;  1M7L A;  2Q9I A;  3G3Z A;  1EZV G;  1RQV A;  1HTL C;  5CCG D;  3VTP C;  2CNR A;  3M06 A;  1N7S A;  3S9O A;  5K5G B;  2KB7 P;  2KOQ A;  3P7K A;  1SQB D;  3CME P;  2WPQ A;  1VF5 C;  2JYG A;  2VLQ A;  5AW0 B;  1OW6 A;  2B87 A;  2A45 G;  2GDW A;  1LP1 A;  3V2P A;  2N6Y A;  2WPR A;  2EFJ A;  4W7Y A;  4DCK A;  3U43 A;  4OGQ D;  2Q5U A;  2YNY A;  1VKU A;  1N73 B;  1S5L H;  1IFM A;  1U7J A;  2C9L Y;  1MFZ A;  3E7K A;  3RL0 B;  3H1L D;  4QNB A;  2BCC E;  2L4B A;  5AVW B;  3EJE A;  3TGU J;  1Q2N A;  1U7M A;  1RF0 C;  4BPF A;  4UHP B;  1XTC C;  1EDI A;  3KDP B;  1L0I A;  1YI2 P;  2B88 A;  2M5A B;  1F80 D;  1LTA C;  4DZO A;  2CPB A;  1ZR2 A;  2N6Z A;  1NAF A;  3V6I A;  5AW7 B;  2KP8 A;  3RG6 C;  1FU1 A;  2YMK A;  3RBZ A;  1RF1 C;  2WPT A;  2N9B A;  2HPC B;  5L8R J;  1NU1 G;  1FZF A;  1PV3 A;  1MKM A;  3GHG A;  2FKW B;  1DH3 A;  1AYI A;  2ZVN B;  3B5N A;  3IAO A;  2VSQ A;  1L4A B;  3TGU E;  3RK3 C;  2H89 C;  3CXC O;  1ZNV A;  2FYZ A;  2IPP A;  4L75 A;  2YXR B;  1YIJ P;  1IC2 A;  1UNK A;  3DS2 A;  1PIX A;  5KKZ C;  3GF7 A;  1DIP A;  3D6Z A;  2ONT A;  4U0F A;  1LTS C;  4R0M A;  1GXH A;  3BAT A;  2WPV B;  2WWW A;  3L71 D;  2BEQ D;  3TNU B;  2OTK E;  1M57 D;  4GOD A;  1EOQ A;  2YIU B;  2I8D A;  1J2J B;  1DEE G;  1T8Z A;  5BS1 A;  4GOF A;  2AVA A;  4WY4 B;  3I56 P;  2NPS B;  5CBO A;  3L70 G;  3TF5 A;  1EZV D;  3PTZ A;  1MFT A;  4PV1 B;  2RKL A;  2H43 A;  2NRG A;  4I1L A;  1FZC B;  2ZT9 D;  1GU5 A;  3CCJ P;  2IX7 C;  2QA4 P;  3V2Q A;  1L0L K;  2N1T A;  1EZV I;  1FBM A;  3AE2 C;  2KOP A;  4BRY B;  1YYC A;  3FXE A;  4K3A A;  3TSI A;  1FS0 E;  2KGA A;  3G28 A;  5KJ7 A;  4WYM A;  5CJ0 A;  1SFC C;  1GK6 A;  1HVV A;  3HRN A;  4EIJ A;  2ZVO B;  1IFJ A;  1BDC A;  1KB9 D;  1FZG A;  1LTJ C;  2A45 I;  3E1R A;  5AVY B;  4ZMD A;  1T2K C;  1NH4 A;  1JMM A;  3OAK A;  4PV1 D;  4Y99 B;  2WT7 B;  2KR5 A;  1KB9 I;  1HQB A;  1EZV E;  1KZU B;  1GU4 A;  1IZN B;  3HYB A;  2PEQ A;  3IF4 A;  2WSE J;  3S4R A;  4C46 A;  3O6Q A;  1DV5 A;  1PFI A;  5HGN A;  1WT6 A;  1M1K Q;  1FJP A;  3AE4 C;  3D71 A;  1JTH A;  1USE A;  4TLF A;  2FQ2 A;  2W83 C;  1AJY A;  1KIL A;  3LW5 J;  2V4H A;  1GW4 A;  2JWD A;  3H0D A;  1KB9 E;  5AW8 B;  1HH0 A;  2XZ1 C;  3H4E A;  4H0L C;  5CCG A;  1NU1 J;  1L0L D;  2KW2 A;  2PY8 A;  3M9B A;  1FAV A;  3HTK B;  2ZXE B;  5KTB A;  2KOS A;  3HD7 D;  3VP8 A;  4IPY A;  2JO1 A;  1AVY A;  4Y28 J;  4U3F G;  3CCL P;  2G3A A;  3CWB D;  3SWY A;  2OYH A;  2LXB A;  1JY2 O;  1VF5 D;  2KOG A;  2LL8 A;  1ZR4 A;  3K5B A;  2FXP A;  3GW6 A;  3MD0 A;  3O8Z A;  2O1K A;  2IBZ D;  1CEI A;  4H44 D;  4IFM A;  3P8M C;  5APV A;  2DW3 A;  4PJ0 E;  1Q86 Q;  3H1K G;  4ZNC A;  2WSF H;  1NU1 E;  1RF1 B;  4N6J A;  2OTL P;  3L70 J;  3G29 A;  1G2C B;  3G9R A;  1EDJ A;  2WPS A;  4KJM A;  3EJD A;  2C0X A;  5CMZ A;  3RBX A;  2GZG A;  2E75 D;  1FOS E;  2KOO A;  3CWB E;  2GDY A;  3CCS P;  2K3R A;  3MUD A;  1ZOY C;  5APY A;  4B86 A;  1CW5 A;  3CCR P;  3USS A;  5KKZ B;  1J1E B;  1QL1 A;  1SQB G;  2QJK C;  3HUS C;  4DOJ A;  4OH8 B;  5DJU B;  3FX0 A;  2QVA A;  1RNI A;  1QEX A;  1AUM A;  2RN0 A;  3L74 G;  2OGU A;  1XTG B;  4GT1 A;  5HGM A;  1PEU A;  2WTY A;  1S72 P;  2ERH A;  1H89 A;  4R4L A;  1YBK A;  1KFN A;  2AF8 A;  2YKP A;  2M5A A;  1L2P A;  2WIT A;  2QSI A;  2FXO A;  3L70 E;  3WUV A;  2OAR A;  4HH2 A;  1LWU C;  3S1K A;  5BU5 A;  1JY3 O;  3H25 A;  2ZJS E;  3RK3 D;  3H1L G;  1L4A C;  1KB9 H;  3BRT B;  4UB8 E;  2OYI C;  3A0B H;  4YXD C;  1OWA A;  3CD6 P;  1MV8 A;  4U7J A;  2DGY A;  3AE7 C;  1VQ8 P;  2HPC A;  2PEK A;  2W8Z A;  2BHV A;  2FFD C;  1S5L E;  4ASV A;  3SSU A;  2K93 A;  1PGQ A;  2FAD A;  1M1J C;  2I1K A;  3DS3 A;  2PRR A;  3VMA A;  2R32 A;  3A7O A;  1SFC B;  3SFE C;  1JUN A;  3C8V A;  3QWO C;  3DS4 A;  2M8N A;  1H88 A;  5DJT B;  2Y0D A;  3P8C D;  4HKZ H;  3L4F A;  2FAC A;  1G1I A;  1LTJ B;  3ZDM A;  2FY8 A;  3WUU A;  1RO0 A;  2AXT H;  5KJ7 D;  2V7Q H;  2XV6 A;  2KNC A;  4IOI H;  3UIA A;  2ROQ A;  3KQG A;  2BAS A;  1Y8A A;  1X22 A;  3V5B A;  3WMM 0;  5HGL A;  3VN0 A;  2E76 D;  1S5L X;  3HZQ A;  3P32 A;  5AVR B;  3TNU A;  2GUS A;  4U3F J;  2BEZ F;  1URQ C;  1FZA A;  3Q20 A;  2JU2 A;  1JCD A;  1L0H A;  3KHU A;  2KGD A;  1EMV A;  2AEF A;  4ZKU A;  3CLQ A;  4WY4 A;  2NPS A;  1SFC D;  5I4T G;  4YPC A;  2WQY C;  1OFC X;  3M1M A;  2KSE A;  1JY2 P;  3Q5R A;  2CWO A;  3H32 B;  1FZC A;  3FWL A;  3P8C E;  3H1K J;  1S1C X;  3L71 G;  3Q5P A;  2MKV A;  1DD3 A;  1OMI A;  1IFP A;  2Q6Q A;  4H0L B;  1RE3 C;  3HE5 B;  3IR9 A;  3GG2 A;  3EWK A;  3WBH A;  4L76 A;  5KAF H;  1KIL D;  1DEB A;  5JPA A;  1M6E X;  1DD4 A;  3AE1 C;  2L91 A;  1HF9 A;  4U3F E;  2E74 D;  2CK3 H;  2M5R A;  2XZR A;  5F2O A;  2VRS A;  2K0X A;  4IL6 E;  3B71 A;  1SQB J;  3G6E P;  3I5C A;  2VLO A;  2IFM A;  5GTH E;  4UB8 H;  4JF7 A;  3L74 J;  1LTB C;  3L74 D;  2I1J A;  2HR3 A;  1E79 H;  2R3S A;  3AEF C;  1SS1 A;  2RMZ A;  3H1K E;  1L0N K;  3HD7 A;  2WZ7 A;  4H13 D;  4BWN A;  3ITK A;  1NWQ A;  5AW1 B;  4U0C A;  4IL6 X;  3H1L J;  5AW3 B;  1KIL E;  2YMY A;  1IK9 A;  1N2D C;  3DS5 A;  3H1H D;  1KQF B;  4QMA A;  2JGP A;  4W7Z A;  3WU2 E;  1AQ5 A;  2L6E A;  1E5W A;  2K94 A;  3LMO A;  2Y9Y A;  4KT0 J;  1JY3 P;  1NTK K;  2P1J A;  1X9V A;  2HOD B;  1Q81 Q;  5CJ4 A;  1SQB E;  3U59 A;  5AVS B;  3II6 A;  2GA1 A;  2QM8 A;  1CI6 B;  3L74 E;  1AA0 A;  4PH1 A;  2QJK B;  3HUS B;  4GIF A;  4I2L C;  1VDF A;  1AF8 A;  1LT9 A;  1RF0 A;  3BCC G;  4RJT A;  1VQ9 P;  3WUT A;  3RL0 D;  1PL5 A;  3AEG C;  3MTU E;  2JAZ A;  1OVR A;  1L0L G;  2C9N Y;  3H1L E;  3B5N C;  3H1I D;  1LWU B;  3H1H E;  3VRL C;  1CSB A;  2JU1 A;  5AW2 B;  4D6T G;  1IMP A;  5M1B A;  2OYI B;  1IUQ A;  1SQQ G;  1NGM B;  1FOS F;  3M9H A;  1L0N D;  2K9J A;  2K9Y A;  1RF1 A;  4EYY Q;  2IZ1 A;  1EXI A;  5APT A;  4I7Z C;  5CBN A;  2IYP A;  2O01 N;  3CWB G;  1J1E C;  1G2C A;  3SWF A;  2Y0C A;  1VQP P;  2ZXX A;  1W2B O;  3BAS A;  2WSF J;  2JB0 A;  3AEA C;  2FFD B;  4Z1M H;  3D6Y A;  2FVE A;  3MZW B;  2KGC A;  1Y47 A;  2LF4 A;  2KYV A;  1M1J B;  1NHL A;  3L71 J;  4DG9 A;  1NYH A;  1R8E A;  2IBZ G;  4IL6 H;  3OA7 A;  5HV8 A;  1K8A Q;  4BPG A;  1T3U A;  3H6P A;  2AFD A;  4I6M C;  1NTK D;  3VMY A;  1WRG A;  1VHN A;  5GTH H;  3V4W A;  3ABV C;  2LKI A;  2JR8 A;  1HGZ A;  2JDI H;  1L4A D;  3H1J D;  3PH0 A;  3JSV C;  1PGO A;  5E79 E;  3JC2 2;  2EHS A;  3RG2 A;  1FZB A;  3CX5 D;  2IFN A;  3TK1 A;  3HE4 B;  1PGP A;  3B4S A;  2N1T C;  2KG9 A;  2FYU G;  4YTP C;  1URQ B;  1FDI A;  4XFJ A;  1JJ2 O;  2OYO A;  2KLU A;  1KMI Z;  2EG5 A;  1P84 D;  2LXC B;  1BSN A;  3CX5 I;  2VLN A;  3PJS K;  1M74 A;  3WU2 H;  3AE9 C;  1CZQ A;  1SQQ K;  1VQO P;  3L71 E;  1YHQ P;  1P84 I;  2D2C C;  1UIX A;  1JNM A;  3MGE A;  4C7N B;  2K92 A;  2E5Y A;  1N86 A;  4UB6 H;  4WY4 D;  2NPS D;  1T8K A;  5CCH C;  2QM7 A;  1S4X A;  2A06 D;  2OQQ A;  3NY7 B;  4BPH A;  2FHS C;  1JEK A;  3I55 P;  4K35 A;  4OWF A;  5C39 A;  2QE7 H;  1GXG A;  4IZ6 A;  3B8E B;  1NKZ B;  1VQ4 P;  3CX5 E;  1SFC A;  3VOP A;  1KQG B;  1N7S B;  2JKV A;  3L36 A;  5AW5 B;  1YQ3 C;  1RQU A;  2KS1 A;  1LTJ A;  3F89 A;  1VQ7 P;  1TU3 F;  2HYN A;  1P84 E;  3N4X A;  1H8A A;  2CGQ A;  3L75 G;  3SFD C;  2V7Q J;  2JP3 A;  4LC1 A;  2X2B A;  3VP9 A;  3BCC J;  5APW A;  2FYU K;  3BCC D;  1T6A A;  1SVF A;  4N3Y B;  1S9K D;  2PGD A;  2WSC J;  3A0B E;  3LIE A;  1L0L J;  1PEQ A;  1AV1 A;  2ZYA A;  1NKN A;  1JM0 A;  4RO0 A;  1VQ5 P;  1HGV A;  3Q2Y A;  4D6T D;  1OVU A;  1SQQ J;  2LR2 A;  1SQQ D;  3H32 A;  4ASW A;  1BXI A;  4U0E A;  1DX7 A;  4OGQ C;  2FQ0 A;  2ITA A;  3CWB J;  3AE3 C;  1H0T B;  4HB1 A;  3KZI E;  1Q7Y Q;  5KP7 B;  3HE5 A;  2DNW A;  1QVF O;  2JJL A;  1KOR A;  2MVV A;  4LLH A;  5E79 H;  2CPS A;  4PH0 A;  4XFX A;  2LTE A;  1BDD A;  1GMJ A;  2KGE A;  2AXT E;  1ZXG A;  2M0B A;  1SQP K;  1PEO A;  3VMZ A;  3BCC E;  1USD A;  3IFM A;  1SQX K;  1S9K E;  1SP4 A;  2P67 A;  1E6J P;  2LOL A;  3DPH A;  1L0L E;  4PD4 D;  3GZL A;  1HUC A;  2IBZ I;  2LIU A;  3CL3 D;  2HFE D;  3GHG B;  1OXZ A;  1VQM P;  7CEI A;  1D1D A;  3B5N B;  4D6T E;  1PPJ G;  1R5S A;  1G1J A;  5AW4 B;  1SQQ E;  1GL2 C;  2Q1K A;  3EFF K;  4PD4 I;  1BE3 G;  2EIA A;  2FYU J;  1QLE D;  2FYU D;  4GDO A;  4HKG A;  3TYY A;  1N73 A;  1KYO D;  3L73 D;  3T97 B;  4I7Z B;  3M91 A;  5KLI C;  3CX5 H;  1LJ2 A;  2IDB A;  3L37 A;  2IBZ E;  1VQK P;  3D70 A;  3VYI A;  1FJK A;  2YO2 A;  5AW9 B;  5KAF E;  2YKQ A;  1ZN5 A;  5KP6 B;  3CC4 P;  1P84 H;  2L22 A;  2M3B A;  3FGA D;  3DS1 A;  1U57 A;  5AW6 B;  2HOD A;  2KI7 B;  4PD4 E;  2NO8 A;  1GDT A;  4BXL A;  1LTG C;  4COP A;  1ZW0 A;  3LID A;  2QG4 A;  3M0D A;  1NO4 A;  4L73 A;  1FZE A;  4GR6 A;  5DCK A;  4A7P A;  3EFG A;  1PGJ A;  4H2X C;  2ZYD A;  3HUS A;  2XT1 A;  5BS2 A;  1SQP D;  5TJH A;  1IO4 A;  3CCE P;  3H1H G;  2FYU E;  3AE6 C;  4NEO A;  1SQX D;  3CI9 A;  2N1T B;  4KHX A;  3L72 D;  3CXH D;  1FE6 A;  3PRJ A;  2KG6 A;  2P9X A;  1K9M Q;  2E42 A;  1A02 J;  3L75 D;  2MD9 A;  4H2Y C;  1LWU A;  4W80 A;  1RY3 A;  2IYO A;  2FQ1 A;  2AEM A;  3V2N A;  2PAJ A;  2Z5H A;  1A43 A;  3CXH I;  3JCU H;  1BSH A;  1L4A A;  3SWK A;  2O01 H;  2OYI A;  3AED C;  2FVF A;  5F2N A;  4QKO A;  3KXD A;  2O3J A;  2ZT9 C;  3KZI H;  2GM4 A;  2D2C B;  5AVV B;  3PLN A;  2R5B A;  2PEI A;  1QL2 A;  2YKO A;  1NVO A;  3CPW O;  4GOE A;  5KLV G;  1BCC G;  3A0H H;  2Q3E A;  3RK3 E;  2M8P A;  1EC5 A;  1M1J A;  3H1I G;  3BRV B;  2XDJ A;  1N7L A;  1FC2 C;  2WSC H;  1SQX E;  1K73 Q;  3CXH E;  4AYC A;  3NTE A;  1KD1 Q;  5AVZ B;  1L0N G;  3F5H A;  3L75 E;  3G0V A;  2MJZ A;  4EDF A;  2KOD A;  2CG5 B;  2XXM A;  1UII A;  1LGH B;  4HYT B;  4F37 A;  2E43 A;  3HE4 A;  5TIS E;  1S3J A;  1KFM A;  2KUB A;  5H2F E;  1QX8 A;  1T2K D;  4M0I A;  3B4Q A;  1RE4 C;  3MGN A;  4BRY A;  5GTI E;  1NTK G;  3FWN A;  1AFO A;  2XNX A;  4O9B A;  3OW2 O;  1PPJ D;  1ZP0 C;  1W2E A;  1KC8 Q;  1BE3 J;  3H1J G;  2PNG A;  1BE3 D;  1N7S C;  2GUV A;  2L0Q A;  3G26 A;  4PD4 H;  1A8O A;  1QGK B;  1IFI A;  1MUU A;  1AVO A;  5KLV K;  4OGQ B;  2PEM A;  1IFN A;  1NTZ G;  2K0Y A;  3AEC C;  1RE3 A;  2BCC D;  1J1D B;  2WT7 A;  1KQL A;  2B9B A;  3W68 A;  1VQ6 P;  4RKU J;  5EFW B;  3KPE A;  1EXJ A;  2GZI A;  3HD7 C;  3NMD A;  3G1I A;  2XZ0 D;  3G71 P;  2JWA A;  2LIW A;  1KYO H;  2W27 A;  4H0L D;  4WB4 A;  4XFZ A;  2WMM A;  1OVV A;  2JBG A;  1BGY G;  1PPJ E;  2A06 G;  2KWL A;  1BE3 E;  3H1H J;  2IZ0 A;  1Y9B A;  2KIK A;  4DT0 A;  3PP5 A;  1JO5 A;  4H44 C;  1GL2 B;  2KXP B;  3Q1M A;  3PHL A;  1YTZ I;  2N9Y B;  1SLQ A;  1IK7 A;  1PP9 G;  3AE8 C;  4UB6 E;  1HY8 A;  2P7J A;  5KLI B;  5HGO A;  3FXD A;  3HTK A;  1GD2 E;  2MR8 A;  1K05 A;  3CE7 A;  1LT9 C;  3TGU D;  5B5E E;  3CXH H;  1K04 A;  5AVX B;  1NQ4 A;  4R4M A;  2E1M A;  2E75 C;  1NTM G;  3EQ2 A;  3CCU P;  5APX A;  1NTZ K;  1H0T A;  5KLV J;  3GLM A;  5F2K A;  5KLV D;  1BCC J;  3CC2 P;  1BCC D;  4WBA A;  3GHG C;  1VPC A;  3E2D A;  1EDK A;  3H1I J;  3G4S P;  1GL2 D;  1IMQ A;  5TIS H;  4JQ0 D;  3A2A A;  5H2F H;  4HJG H;  2W6J H;  4WWI A;  5AVQ B;  4JYB A;  5GTI H;  1L0N J;  1ZME C;  2LML A;  1M8O B;  1RH5 B;  1T3J A;  5EJD A;  2KZI A;  2MVU A;  1EIA A;  2L5G B;  3OJA B;  2LPK A;  1YJ9 P;  3DTJ A;  1OR5 A;  2ZT9 B;  1M90 Q;  1NTK J;  5KLV E;  4XFY A;  3T97 A;  4U0D A;  5KAI H;  1BCC E;  2P58 A;  2YO3 A;  2KNC B;  4M3L A;  2QJP B;  1NJI Q;  1Q82 Q;  2BQ1 E;  5KP8 B;  2KSJ A;  3H1J J;  2JYL A;  3H1I E;  2JEE A;  2OTJ P;  4RES B;  2QEX P;  2W6A A;  3NTN A;  2M8L A;  1RHZ B;  2K0D X;  1NTM K;  1X3O A;  1Z56 A;  4MRT C;  3GMA A;  4XE5 B;  4CA3 A;  3VMX A;  3R4Y A;  1L0N E;  2G8Y A;  1NTZ J;  1NTZ D; 
#chains in the Genus database with same CATH homology
 1RO2 A;  4U0F A;  3VRL C;  2OTL P;  2PEJ A;  3G29 A;  3DS4 A;  4U0B A;  2M8N A;  3OW2 O;  2Z45 A;  1YJN P;  3G6E P;  1PEO A;  2E1M A;  1KC8 Q;  1IUQ A;  3CCU P;  3I55 P;  3CCQ P;  2P9X A;  1KQS O;  1K9M Q;  3DS0 A;  5HGN A;  4XRO A;  4QNB A;  5F2K A;  1PEM A;  1M1K Q;  3G21 A;  3CC2 P;  1RO0 A;  3B5I A;  1EOQ A;  1QVG O;  1E6J P;  3G26 A;  2XV6 A;  1A8O A;  1VQ4 P;  3E2D A;  5BS1 A;  3CCS P;  1A43 A;  3DPH A;  3G4S P;  1VQP P;  3CCV P;  1W2B O;  3CC7 P;  2PEM A;  2PEO A;  1VQL P;  5HGL A;  3I56 P;  3CCR P;  3HZQ A;  5F2N A;  3H0D A;  4COC A;  1ZMB A;  1VQM P;  1D1D A;  1K30 A;  2LF4 A;  1YI2 P;  1VQ7 P;  3P05 A;  4U0C A;  3CMA P;  3H4E A;  1VQ6 P;  3Q20 A;  2PEI A;  2EIA A;  1K8A Q;  1RNI A;  3CPW O;  1AUM A;  3DS5 A;  3G1I A;  2PY8 A;  3G71 P;  5HGM A;  3CCJ P;  1PEU A;  1S72 P;  1YIT P;  2QA4 P;  2L6E A;  5I4T G;  2M8P A;  1EIA A;  3M1M A;  4XFZ A;  3RG6 C;  3LRY A;  4IPY A;  1VQN P;  2CWO A;  3G28 A;  1Q81 Q;  2OAR A;  2Z46 A;  1K73 Q;  4WYM A;  1YJ9 P;  3DTJ A;  1N8R Q;  2Z44 A;  1YJW P;  3CCL P;  2BUO A;  3NTE A;  1KD1 Q;  1VQK P;  2JO0 A;  1M90 Q;  1PEQ A;  3H47 A;  4GR2 A;  3G0V A;  4XFY A;  4U0D A;  4PH1 A;  1JJ2 O;  3CC4 P;  1VQ5 P;  1NJI Q;  3DS1 A;  1Q82 Q;  2KOD A;  2BQ1 E;  2XXM A;  2EG5 A;  3CD6 P;  2JYL A;  2OTJ P;  1BAJ A;  3CME P;  3WBH A;  2QEX P;  4PH0 A;  2DGY A;  3G1G A;  4U0A A;  4U0E A;  1VQ8 P;  2M8L A;  2JYG A;  1VQ9 P;  4COP A;  3CXC O;  5JPA A;  2PEK A;  2PEN A;  1M6E X;  1M6N A;  1M74 A;  2BHV A;  1QRJ A;  4GR6 A;  5DCK A;  1YIJ P;  1VQO P;  1Q7Y Q;  3DS2 A;  2XT1 A;  1YHQ P;  1Q86 Q;  5HGO A;  2EFJ A;  5BS2 A;  1QVF O;  3HYB A;  4M0I A;  4XRQ A;  3CCM P;  3MGE A;  5F2O A;  3CCE P;  3DS3 A;  2ONT A;  4XFX A;  2PEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...