1VQLP

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqlP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqlP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqlP02
1VQOP 3G6EP 1YHQP 1K9MQ 1VQ7P 3CMEP 1QVFO 3CCQP 3I55P 1VQ8P 1VQ5P 1YITP 1VQ9P 1VQ6P 1VQ4P 1YI2P 1Q82Q 1Q81Q 1W2BO 1M1KQ 1YIJP 1S72P 3CCLP 3CCEP 3CD6P 3CCUP 1K8AQ 1VQMP 1KC8Q 1Q7YQ 2OTLP 1VQLP 1QVGO 3CCJP 3OW2O 2OTJP 1JJ2O 1VQNP 3CCRP 1N8RQ 3I56P 1VQPP 1YJWP 1K73Q 1YJ9P 1YJNP 3G71P 3CMAP 3CCVP 1M90Q 1VQKP 1NJIQ 3CPWO 3CCSP 3CCMP 2QA4P 1Q86Q 3CXCO 1KD1Q 3CC4P 3CC2P 3CC7P 2QEXP 1KQSO 3G4SP
chains in the Genus database with same CATH superfamily
1VQ7P 3PHLA 3L36A 2N9BA 3RK3D 5AW6B 4N6JA 5KP8B 3L74G 1N8RQ 1KLPA 4IFDK 2D2CD 5APVA 4DJGA 3SWKA 5AW3B 1R8EA 1SQXE 4L75A 2OYOA 4KT0J 3GJNA 1VKUA 4UB6H 2IBZE 2WZ7A 2K0XA 5APTA 1EQ7A 4HKZH 3AE5C 3H32A 3CCSP 2LXBA 3HE4A 3L70G 4H0LB 1N7SB 2E43A 1MUUA 3L72G 4AQRD 2FKWB 2XU6A 5I4TG 1YI2P 3B5NA 1Q90D 3MIWA 1YTZI 3L71J 2FVEA 2M8NA 1K8AQ 1FOSF 2WPTA 2K37A 2C9LY 4WVZA 1QX8A 2K0YA 1KB9I 3MZWB 2PEQA 1HJBA 2E42A 3VP9A 3G4SP 2YNYA 1MKMA 1VF5B 1RE3C 2K1AA 1W2BO 4U7JA 1GU5A 1PEQA 3RBXA 2MD9A 2KR5A 2GDWA 1KILC 1Z56A 3LW5J 1LT1A 2Z46A 2NPSD 1DX7A 3H1LG 1LT9C 2FYNB 3P8CD 1M74A 2LMLA 3LRYA 1T3JA 2WSCJ 4I7ZB 2I8DA 2XNXA 3H1KG 2LXCB 4U0BA 2ZYGA 3H1JJ 1M8OB 5K5GB 1NO4A 2CNRA 3L74J 1E0HA 3H1JD 3IF4A 4DOJA 4WY4D 1LTTC 1BE3D 2JGPA 2XV5A 1H8AA 1N73C 2XV6A 1EC5A 2VLQA 4K35A 3TF5A 3AEFC 5AVSB 4N78E 1U57A 1VPCA 1YQ3C 2W90A 4YTPC 1LTJC 3P8CE 3L70J 2Y0DA 1L0NK 2OYIA 5AW7B 3L72J 1KYOI 5HGNA 3DS1A 2O01H 1KQGB 3CE7A 5EFWB 2O01N 2ROQA 2KORA 1GU4A 3V4WA 1Z6MA 4M3LA 1FDMA 1DEBA 2K9JA 4U0AA 1Y47A 1QVGO 3AEDC 1S5LX 1SQVK 2CWOA 3CWBE 2GZFA 1KZUB 5DCKA 2LKMA 2EG5A 1RF0A 3M9BA 1AV1A 3SWYA 1S9KE 1VQ4P 2MKVA 1G2CB 2ZXXA 3E1IA 4U0FA 3HTKA 5CZDB 1E5WA 1BSHA 4COPA 4C7NA 4DT0A 5EJDA 2L4BA 3H1KJ 3HZQA 1GL2D 2W6BA 3KHUA 5AW0B 4PV1D 3M0AA 2N1TD 2L0QA 1IMQA 1HF9A 1KILB 2K88A 1BSNA 3L75G 5APWA 5BVZA 1MZ8A 2RN0A 3JC22 1YJWP 1M1JB 3B71A 3O6QB 3RBZA 2Y9YA 2POHA 1P84E 1NH4A 2FQ2A 1K30A 3KPEA 4IOIH 2M5AB 1N73B 1SLQA 1M56D 1URQA 1FZAA 2OTKE 1NVOA 2OQQA 3HD7C 2K9YA 1SQBE 3H1HG 3L73G 2ITAA 1DD4A 3KZIH 1LTJB 2GUSA 2MF4A 3GZMA 1T6AA 2JO0A 1S72P 4XFXA 1EZVD 2Q5UA 2C9NY 1GDTA 2M8LA 1K73Q 3CMAP 1JO5A 1RQVA 2NO8A 2D2CC 4H2WC 1JMBA 1FDIA 3G28A 3AE2C 1PP9E 1NKZB 2KG6A 4AUWA 3PRJA 1R5SA 3M9HA 1FZFA 3M91A 3VMZA 2B89A 2AF8A 4H13D 5APXA 4BPHA 2LF4A 3V5BA 3L75J 2KWLA 4ZNCA 3U59A 1VQ9P 2Q9IA 5CJ4A 2P10A 3Q2YA 2QJKC 4XFYA 4BWNA 4U3FE 2Q3IA 2XZRA 1AJYA 1FS0E 2P9XA 3DS5A 3V4QA 1RO2A 2KODA 2G3AA 1VQ8P 3H1ID 3CL3D 2P58A 2MJZA 4ZKPA 2OTLP 3H1HJ 3AEGC 4JF7A 2JWDA 2LOLA 4D6TG 2RMZA 3FXEA 3GG2A 1RE4A 2VRSA 2FYUE 1Y9BA 1FZBA 2OGUA 1AF8A 1YHQP 3CX5E 1YQ4C 4PD4E 5APQA 1FZGA 1JY3N 2AXTE 3HD7B 2ZT9C 1KQFB 4GODA 1NU1E 5CHXA 3RG2A 4WY4C 4KHXA 2K3RA 2HFED 1NTMD 3U1AA 2VLPA 1VQKP 3H1IE 3TGUD 1VQOP 3I55P 3BRTB 1ZRTE 5B66H 1NTKD 2Q7CA 2WPSA 2FADA 1RNIA 2GZIA 2X2BA 1EDIA 2N5HA 1J1EC 2FQ1A 4NEOA 2E74C 1HWTC 3VP8A 3Q5SA 1SQBK 2IYPA 3LMOA 1QGKB 2MVVA 1AYIA 3N4XA 2SPZA 1BCCD 1X9VA 1N86A 1VQLP 3CXHE 1AUMA 3B5IA 2Z5IA 2Z44A 4HH2A 4IZ6A 1PIXA 2FACA 2KK7A 1Y8AA 3JCUH 2IFNA 2LTEA 1MV8A 2PRRA 3VOPA 2IX7C 4I6MC 3CCEP 4D6TJ 1SQXG 2JO1A 1GXHA 3II6A 4D6TD 1OVUA 2IBZG 2JWAA 2B87B 1SVFA 1M90Q 3R2PA 2YMKA 5BU8B 2PNGA 1JCDA 1NTZE 3MP7B 5APUA 1SQQG 3B5ND 1CW5A 1OW8A 2OYHC 1ZW0A 1HGZA 5KAFE 2J58A 1Q82Q 3C8VA 5BS1A 2AXTH 1PPJE 2KP8A 1KC8Q 2KSJA 1IJDB 2HPCB 2K2QA 2W27A 3O8ZA 4GOFA 1PZQA 2GDYA 1KQSO 2ZT9B 3DS4A 2WTYA 1OVVA 1IC2A 5KAIH 3BCCD 2BCCE 4JYBA 2YKPA 1JY3P 5KLVD 4H2XC 1G2CA 1RF1C 4XA4A 2QJYC 3CPWO 2O1JA 1BGYD 2FYUK 5HVCA 1RE3A 1X22A 1J1EB 1L0NE 2E74B 2N9YB 1KILA 3P05A 3CXHH 2OARA 1NU1K 1EMVA 2PEKA 2A06G 1CEIA 3RK2D 4PJ0H 3Q20A 1ZR4A 1AFOA 1SQXJ 2PENA 1M1JA 3O6QA 1MFTA 1M1KQ 2XT1A 1QEXA 1SQVE 1MZ9A 3OAKA 3L4FA 5L8RJ 1JY2N 2M5AA 1SQQJ 4WWIA 3EWKA 1N73A 1BGYE 2O01J 1L0LE 1LP1B 2RH0A 3MUDC 2IBZI 1EIAA 2KB7P 2KYVA 5CCGC 3N7NA 4OGQD 1IFNA 2K5XA 1T2KD 4NPEA 3KYQA 1SQPE 3CD6P 2KOOA 3B8EB 4DCKA 4NPFX 5AVRB 1LTJA 1A8OA 1KFNA 2P1JA 4EOTA 1NYHA 2WVRA 3CWBG 3CC4P 1KD1Q 3E2DA 4O9BA 5CCHC 4U0CA 4YPCA 3RK3E 1PGOA 2ERHA 2LIUA 3MGNA 3BASA 2KOPA 2HLOA 4ASWA 2C0XA 1ZNVA 1N2DC 2GZGA 2HG5D 1SFCB 3L71D 1K05A 1KB9D 5AW4B 4Y99C 3PP5A 1GK6A 2O1KA 1JY3O 1OIPA 4QNBA 2E75C 2JAZA 2CG5B 3Q3DA 5AW2B 1NTZK 3G3ZA 2CGQA 1EDLA 1RF1B 2E76C 3W68A 4IL6E 2QJYB 2DGYA 2WPQA 2QE7H 2EHTA 1PL5A 2BASA 2XNDH 3HUSC 1HJ0A 2KLVA 4BRYB 4ZMDA 3RL0D 2VLNA 4QKOA 5M1BA 1URQD 4AYCA 2MR7A 1ZLLA 3UIAA 1T8KA 1IK7A 1LTGC 1VL2A 3V2PA 4OH8B 3L74D 1JCCA 3ABVC 5GTHE 3ZDMA 2JYGA 2KGAA 3CI9A 3EFFK 1ZV8A 5KKZC 1SQBG 3AE4C 3H0DA 3PJSK 4GT1A 1KN7A 2KNCB 3GKLC 1L4AC 4CPGA 1NAFA 2KGCA 1KYOD 2PP6A 3A0HE 3HD7A 2FXMA 3L70D 4QMAA 3A0BE 3V2QA 3M0DC 1QRJA 3G6EP 3L72D 2M8RA 3H1JE 1L0IA 2KGEA 3HE5B 3S4RA 1AQ5A 1BE3E 2UWJE 1PP9G 3TDKA 4BPFA 2JJLA 4H44C 2E5TA 2W83C 3CCRP 5AW1B 5AVZB 2QJPC 1FJKA 4PXHB 4HYTB 3VTPC 3U43A 5GTIE 1L0LK 5AW5B 4OVNF 1QVFO 3CMEP 3HRNA 2LKIA 4RESB 1EOQA 4UHPB 3EJDA 1L0HA 1KORA 3RGUA 1HTLC 1KYOE 2KOQA 4HB1A 3H1LJ 1FOSE 2IZ1A 1SQPK 3EJEA 4BPGA 2E75B 2BEQD 3H1LD 1GD2E 2GYKA 3Q1MA 4U3FG 3MGEA 3G0VA 5AVYB 2E76B 3H1KD 1DH3A 3AECC 5KJ7A 1P84I 3H6PA 1LT9B 1GW4A 3HUSB 4RO0A 4KJMA 1PGQA 1GXGA 1SQBJ 2AFDA 5AVWB 2LIWA 2JYLA 2PEIA 2FYUG 4H0LD 1N7SD 3HYBA 1OX3A 3BRVB 2B87A 1OXZA 2AEJA 2KSEA 3V2NA 1RY3A 2EIAA 4Z1MH 1NU1G 2JQ4A 4EYYQ 1SFCD 3A0HH 3A0BH 5JPAA 2QM7A 1LNQA 1K9MQ 1PP9J 2HPCA 1L4AB 4K3AA 1JY2O 3TSIA 1AVOA 4JQ0D 1VF5D 1OMIA 3RK3C 4W7ZA 1DV5A 2QVAA 2J5UA 1EXIA 1FDOA 3E7KA 2FXOA 1GK4A 2HYNA 3CC7P 3GF7A 5GTIH 3AE8C 1AA0A 4H44B 2PEJA 5APSA 5KP7B 1M57D 1KV4A 2QJPB 2ZXEB 2WSEH 1T8ZA 4U3FJ 4WYMA 1VQNP 2R32A 3MHVA 2G8YA 4ZKUA 2CQ8A 3R4YA 2KW2A 3D6ZA 3A2AA 2GUVA 3S1KA 2ZAEB 7CEIA 1QLED 3JSVC 1EZVE 1USDA 3L75D 1CI6B 5AVVB 3IFMA 1UJZA 5BU5A 3SFDC 3GMAA 2FYUJ 3CCVP 3CXCO 1P84H 1N7LA 4JPZB 5TISE 4R0MA 1VQ6P 3G9RA 4IFMA 2YXQB 1LP1A 3C1LA 3D71A 3CX5I 2L5GB 4PD4I 5KTBA 3GF3A 5DJTB 2N6YA 1PPJG 2NPSC 1R5LA 1LTBC 1DIPA 3L73J 2LL8A 3SFEC 2FXPA 4L73A 3GLMA 1S5LE 3H1HD 3L73D 2JU2A 2KIKA 2FFDC 4TLFA 1LTIC 2RKLA 5B5EE 5H2FE 1N7SA 2BCCG 2MVUA 1QL2A 2WQYC 3RK3B 1SFCA 2XDJA 5E79E 2C0WA 2Z4EA 1KILD 3LIEA 2WT7B 2AXCA 1VHNA 2JB0A 4RJTA 1XTCC 1L0NG 1M6NA 2D2CB 1KQLA 2EHSA 1LTAC 5DJUB 4CA3A 3CXHI 2ZYAA 1RF1A 3VYIA 3DPHA 1BXIA 3LIDA 2PGDA 3CCLP 1RH5B 1NTME 2FVAA 2WWWA 4BRYA 1SQVG 2GDXA 3TGUE 3L37A 3IN6A 4XRQA 1HGVA 2ZFCA 2DW3A 1S4XA 2GZJA 3QH9A 1L0LG 2JP3A 5TISH 2QJKB 1NTKE 5F2NA 1E79H 2M8PA 1D7MA 1SQPG 2IFMA 3AE1C 3AE3C 1YJ9P 1LTSC 2KNCA 1GL2C 1LWUC 3MUDA 4PV1C 2N1TC 3WU2E 1BCCE 5CCGA 3CX5H 2R3CA 4PD4H 5CMZA 2NPSB 1JTHB 2PEOA 2BCCJ 1KMIZ 2HODB 4LC1A 2V7QH 1WT6A 1OVRA 3KQGA 1FE6A 1H89A 1G1JA 1NHLA 3FXDA 3HE5A 4GDOA 3ITKA 2FFDB 2KOSA 2CPSA 3GHGC 3CCMP 4W7YA 1SS1A 2ZVNB 2QEXP 2M5RA 2FHSC 2BEZF 2N6ZA 1FZEA 5CCHA 4H0LC 4WY4B 1WMKA 1L0NJ 1FZCC 1YTZT 1YYCA 4UB6E 4D6TE 1EDKA 2IZ0A 2MR8A 1KFMA 2YO3A 4N3YB 4EDFA 5F2KA 1MFZA 1G1IA 1BDCA 3BATA 2J59M 3H4EA 1SQVJ 1JMMA 5AVUB 3OA7A 3G26A 3PTZA 1L0LJ 2H89C 1FJPA 2KS1B 2KZIA 4LLHA 5TJHA 1LT9A 2KLUA 3MTUE 3HUSA 2K94A 3T97B 2B9BA 3BCCE 3EFGA 2A45I 3VMYA 2Z45A 1SQPJ 4I7ZC 3CLQA 5KLVE 3FWLA 1M6EX 1RO0A 2L9FA 1Q7YQ 1SQXD 3HD7D 2Q3EA 1FR2A 2ZVOB 2IBZD 2IDBA 4H13C 1OFCX 2ZJSE 4NPDA 1SQQD 3WU2H 2GZEA 1ZOYC 1YBKA 4YXWH 3MD0A 3V6IA 5KAFH 2WSSH 1T3UA 3H1JG 3CCUP 3D70A 2E1MA 1GL2B 1WRGA 1LWUB 1BE3G 2KGDA 1PGPA 3IAOA 2QNWA 1F80D 4PV1B 1L4AA 2KZJA 2N1TB 1NTMK 2BUOA 2OYHB 3DS2A 4OWFA 2QIWA 1EDJA 2KXPB 1KTMA 3M0DA 5HGMA 2JKVA 3V2RA 3USSA 4PH0A 1NTKK 1H0TB 2JR8A 3FGAD 1A43A 3GHGB 1S2EA 1JM0A 1VQPP 1SQQE 2FBWC 3M9QA 3TK1A 2N98A 2EFJA 5KJ7D 4C46A 4DG9A 1FZCB 2JU1A 2WSFH 3A7OA 2BQ1E 3VMXA 2AEMA 3AE7C 1D1DA 3I5CA 4JYCA 3F89A 1YJNP 1GZLA 4R4MA 1NWQA 2H7HA 1NJIQ 2A06D 1CI6A 1X8YA 2CPBA 2N50A 2Y9ZA 2P7JA 1OR5A 2WPVB 3VMAA 4N78D 2Y0EA 4C7RA 2JDIH 3L71E 1GTWA 3PH0A 1KB9E 3EQ2A 2WITA 3E1RA 1IFJA 3TNUB 3IR9A 3DS3A 2A45H 1M1JC 2BHVA 1E6JP 4XE5B 2I1KA 1BE3J 5AW8B 2GM4A 2ZT9D 1YIJP 1PFIA 1IUQA 2W6AA 1RHZB 3NMDA 4H13B 3CWBJ 2A06E 3H47A 4H2YC 1X0TA 2O3JA 3CC2P 1JY2P 3CWBD 1ZN5A 3TYYA 5HV8A 4EI2A 1U7JA 2WSEJ 1NQ4A 2FVFA 1S9KD 1NAYA 4XFZA 2JEEA 2KUBA 3L74E 1IO4A 3C9IA 3D6YA 5KLVK 4R4LA 2I1JA 2E74D 2YIUC 5F2OA 2YMYA 2WT7A 1IZNB 3KZIE 3AEEC 2W6JH 3B5NC 1PEOA 3OJAB 1JUNA 3P32A 1BDDA 4Y99B 4IL6H 1BAJA 1EZVG 1K04A 4HKGA 3L70E 4I2LC 2QSIA 3L72E 1IFDA 2XXMA 4XFJA 1P84D 3NTNA 3PLNA 1U7MA 1ACPA 1UIXA 3B4SA 4WB4A 1SQXK 1KB9H 3WBHA 3CCJP 5APYA 3NFQA 4M0IA 3W67A 5AW9B 5GTHH 1SQQK 3RL0g 2H43A 1SQBD 3CCQP 3SWFA 2AFEA 4YXDC 3H1LE 3LW5H 2IPPA 4RKUJ 1FU1A 5KKZB 2NPSA 1JTHA 3H1KE 4ASVA 2HODA 1UIIA 2R5DA 1DD3A 3RK2C 3AEAC 2WSCH 5AVTB 3G29A 3H1IG 4F37A 3P7KA 1TU3F 2FFDA 3GW6A 1QL1A 4W80A 1PP9D 2M0BA 2OYIC 1JNMA 2LR2A 3Q5PA 1RQUA 3BVHA 4WY4A 5CBNA 3G71P 2XZ0D 4GR2A 2FYZA 4OGQC 2NZ2A 3KXDA 1Q81Q 2L6EA 1AQTA 1JOCA 1T2KC 3H32B 5KLIC 3HE4B 2YIUB 1KYOH 3G1GA 1EZVI 1NTMG 3B5NB 4U3FD 3AE6C 4IPYA 1RF0C 3TGUG 3B4QA 1NOHA 1IK9A 1OWAA 1HBWA 5B66E 2KS1A 1NTKG 1FAVA 1ZR2A 3T97A 3NXSA 2KG8A 2PAJA 2V4HA 1ZMEC 2B88A 1A02F 1PEUA 1ZP0C 2XKMA 5CCGD 5KJ7C 3K5BA 2QM8A 1Q2NA 1X79B 2WPRA 2FYUD 4GIFA 2WMMA 1PGJA 2Y0CA 1HQBA 3QWOC 1LGHB 1NTZG 1S1CX 1BCCG 3CX5D 2V7QJ 1NU1J 4PD4D 1NGMB 1J1DC 4GKGA 3AEBC 1NKNA 2XZ1C 3NTEA 2YKOA 2OTJP 1NU1D 3S9OA 3U1CA 1USEA 1CZQA 2PEMA 3H1IJ 3JCUE 2QA4P 3A5TA 1IFIA 5CCHD 4PH1A 1GL2A 4JBZA 1LWUA 3RL0C 2N1TA 3L75E 3KDPB 1XTGB 3FX0A 2OYHA 1PV3A 1URQC 1J2JB 2R44A 3AE9C 1ZRTD 1JB0J 3RK2B 3P8MC 3RG6C 5C39A 4I1LA 2E5YA 2H8PD 2P67A 1H0TA 2M3BA 1Q86Q 4COCA 1VDFA 3GHGA 2E75D 2OYIB 4U0EA 1SP4A 2P2UA 1H88A 1UNKA 2E76D 3GZLA 1NTMJ 4HJGH 2FY8A 1FZCA 3TGUJ 2ONTA 1A02J 3H1HE 2Z5HA 4OGQB 3CXHD 3L73E 3FWNA 4Y28J 2K0DX 1PEMA 3WUVA 1NTKJ 4LGDE 5KLIB 2K9JB 3WUUA 2AEFA 5HGLA 1IFPA 2M3EA 1AVYA 5KAIE 2Q1KA 2L22A 1GPJA 5KP6B 3BCCG 4L76A 2N5IA 4UB8E 1CSBA 1GW3A 5KLVG 3NY7B 4IFFA 2Q6QA 5EW5E 3HTKB 4PWVB 1NTZJ 1BCCJ 5HGOA 1BGYG 1W5CE 4C7NB 4U0DA 1KILE 2VLOA 1YITP 2A45G 3TNUA 1NTZD 2L91A 3Q5RA 2GA1A 1OW6A 4TT3H 1L4AD 2DNWA 2IYOA 1PPJD 2K93A 3I56P 2ZYDA 4PJ0E 3DTJA 1M7LA 2YXRB 4IL6X 1S5LH 4DZOA 1J1DB 1LJ2A 5B5EH 1IMPA 1HVVA 3F5HA 2JBGA 2QG4A 5H2FH 5CBOA 2KOGA 4H44D 3H25A 1FC2C 2YKQA 2FAEA 3OW2O 3M1MA 2BCCD 1RE4C 1X3OA 2VSQA 3RL0B 5BS2A 1URQB 4MRTC 3WMM0 1EXJA 2K92A 2FQ0A 1ZMBA 2WSFJ 2HR3A 1FBMA 2R3SA 1N7SC 5E79H 3DS0A 2PY8A 3VRLC 2NRGA 1VQMP 3VN0A 1HY8A 1OW7A 2CK3H 1L0ND 5AVXB 1GMJA 2AVAA 1S3JA 4MN4C 1SFCC 2KI7B 3BCCJ 3EJBA 1VQ5P 1DEEG 3SSUA 4L74A 5KLVJ 3WUTA 1VF5C 4UB8H 2W8ZA 1L2PA 4A7PA 1SQVD 4BXLA 3L71G 1JJ2O 1BGYJ 1IFMA 1JEKA 4B86A 2YO2A 1W2EA 2PFXA 2R5BA 3L35A 1L0LD 2KG9A 2H88C 2FYNC 1OZHA 3A3YB 4GOEA 1ZXGA 4WBAA 3G1IA 3G21A 2MY5A 3M06A 4GR6A 2LPKA 5CJ0A 4XROA 1SQPD 2QRXA 1DNYA 5AVQB 4EIJA 1HUCA 1HH0A
chains in the Genus database with same CATH topology
1VQ7P 1QVFO 3CMEP 4U0BA 3G29A 1EOQA 5HGMA 1VQ9P 2PEJA 4PH0A 4XFZA 4XFYA 1A43A 2DGYA 1VQLP 3P05A 4QNBA 1AUMA 3OW2O 1M6NA 3B5IA 3M1MA 4WYMA 2OARA 2Z44A 3RG6C 2XV6A 1VQNP 1N8RQ 1VQPP 1YJWP 2PEKA 3G71P 1Q86Q 5F2OA 2P9XA 2EFJA 3MGEA 5F2KA 4COCA 3DS5A 5BS2A 3DPHA 1K30A 3G0VA 4GR2A 3Q20A 2QEXP 1RO2A 1ZMBA 2KODA 1VQ8P 4U0EA 2PENA 1PEOA 1Q81Q 3H4EA 2L6EA 1M1KQ 3DS0A 2XT1A 2PY8A 3VRLC 3CCLP 3CCEP 2BQ1E 1VQMP 2OTLP 1D1DA 1BAJA 3G1GA 3G26A 2ONTA 1YJNP 4XRQA 3CCVP 1M90Q 1NJIQ 3CCSP 4IPYA 1EIAA 5HGNA 3DS1A 3CXCO 1PEMA 2JYGA 2JYLA 2PEIA 2XXMA 1YHQP 5HGLA 1VQ5P 5I4TG 5F2NA 3HYBA 1VQ6P 2M8PA 2Z45A 3H0DA 1YI2P 1Q82Q 2JO0A 5BS1A 1S72P 4XFXA 3CD6P 2M8NA 1M6EX 1K8AQ 1RO0A 1KC8Q 1Q7YQ 4U0AA 2EIAA 1QVGO 3WBHA 3CCJP 2CWOA 1JJ2O 1A8OA 4M0IA 2M8LA 1K73Q 1YJ9P 1PEUA 3DS3A 3CMAP 2PEQA 1VQKP 3CC4P 1KD1Q 3E2DA 5DCKA 5JPAA 2EG5A 1KQSO 3G4SP 5HGOA 1QRJA 1VQOP 4U0CA 3G6EP 2BHVA 1K9MQ 4U0DA 1E6JP 3I55P 3CCQP 1YITP 3G28A 1VQ4P 3G1IA 3G21A 3DS4A 2PEOA 4U0FA 1W2BO 1PEQA 1YIJP 1IUQA 4GR6A 3CCUP 2E1MA 2Z46A 4COPA 4XROA 3NTEA 4PH1A 1RNIA 3H47A 2OTJP 3CCRP 3HZQA 3I56P 2BUOA 2PEMA 1M74A 3DS2A 3LRYA 3CPWO 2QA4P 3CCMP 3CC2P 2LF4A 3CC7P 3DTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO P;  3G6E P;  1YHQ P;  1K9M Q;  1VQ7 P;  3CME P;  1QVF O;  3CCQ P;  3I55 P;  1VQ8 P;  1VQ5 P;  1YIT P;  1VQ9 P;  1VQ6 P;  1VQ4 P;  1YI2 P;  1Q82 Q;  1Q81 Q;  1W2B O;  1M1K Q;  1YIJ P;  1S72 P;  3CCL P;  3CCE P;  3CD6 P;  3CCU P;  1K8A Q;  1VQM P;  1KC8 Q;  1Q7Y Q;  2OTL P;  1VQL P;  1QVG O;  3CCJ P;  3OW2 O;  2OTJ P;  1JJ2 O;  1VQN P;  3CCR P;  1N8R Q;  3I56 P;  1VQP P;  1YJW P;  1K73 Q;  1YJ9 P;  1YJN P;  3G71 P;  3CMA P;  3CCV P;  1M90 Q;  1VQK P;  1NJI Q;  3CPW O;  3CCS P;  3CCM P;  2QA4 P;  1Q86 Q;  3CXC O;  1KD1 Q;  3CC4 P;  3CC2 P;  3CC7 P;  2QEX P;  1KQS O;  3G4S P; 
#chains in the Genus database with same CATH topology
 1VQ7 P;  3PHL A;  3L36 A;  2N9B A;  3RK3 D;  5AW6 B;  4N6J A;  5KP8 B;  3L74 G;  1N8R Q;  1KLP A;  4IFD K;  2D2C D;  5APV A;  4DJG A;  3SWK A;  5AW3 B;  1R8E A;  1SQX E;  4L75 A;  2OYO A;  4KT0 J;  3GJN A;  1VKU A;  4UB6 H;  2IBZ E;  2WZ7 A;  2K0X A;  5APT A;  1EQ7 A;  4HKZ H;  3AE5 C;  3H32 A;  3CCS P;  2LXB A;  3HE4 A;  3L70 G;  4H0L B;  1N7S B;  2E43 A;  1MUU A;  3L72 G;  4AQR D;  2FKW B;  2XU6 A;  5I4T G;  1YI2 P;  3B5N A;  1Q90 D;  3MIW A;  1YTZ I;  3L71 J;  2FVE A;  2M8N A;  1K8A Q;  1FOS F;  2WPT A;  2K37 A;  2C9L Y;  4WVZ A;  1QX8 A;  2K0Y A;  1KB9 I;  3MZW B;  2PEQ A;  1HJB A;  2E42 A;  3VP9 A;  3G4S P;  2YNY A;  1MKM A;  1VF5 B;  1RE3 C;  2K1A A;  1W2B O;  4U7J A;  1GU5 A;  1PEQ A;  3RBX A;  2MD9 A;  2KR5 A;  2GDW A;  1KIL C;  1Z56 A;  3LW5 J;  1LT1 A;  2Z46 A;  2NPS D;  1DX7 A;  3H1L G;  1LT9 C;  2FYN B;  3P8C D;  1M74 A;  2LML A;  3LRY A;  1T3J A;  2WSC J;  4I7Z B;  2I8D A;  2XNX A;  3H1K G;  2LXC B;  4U0B A;  2ZYG A;  3H1J J;  1M8O B;  5K5G B;  1NO4 A;  2CNR A;  3L74 J;  1E0H A;  3H1J D;  3IF4 A;  4DOJ A;  4WY4 D;  1LTT C;  1BE3 D;  2JGP A;  2XV5 A;  1H8A A;  1N73 C;  2XV6 A;  1EC5 A;  2VLQ A;  4K35 A;  3TF5 A;  3AEF C;  5AVS B;  4N78 E;  1U57 A;  1VPC A;  1YQ3 C;  2W90 A;  4YTP C;  1LTJ C;  3P8C E;  3L70 J;  2Y0D A;  1L0N K;  2OYI A;  5AW7 B;  3L72 J;  1KYO I;  5HGN A;  3DS1 A;  2O01 H;  1KQG B;  3CE7 A;  5EFW B;  2O01 N;  2ROQ A;  2KOR A;  1GU4 A;  3V4W A;  1Z6M A;  4M3L A;  1FDM A;  1DEB A;  2K9J A;  4U0A A;  1Y47 A;  1QVG O;  3AED C;  1S5L X;  1SQV K;  2CWO A;  3CWB E;  2GZF A;  1KZU B;  5DCK A;  2LKM A;  2EG5 A;  1RF0 A;  3M9B A;  1AV1 A;  3SWY A;  1S9K E;  1VQ4 P;  2MKV A;  1G2C B;  2ZXX A;  3E1I A;  4U0F A;  3HTK A;  5CZD B;  1E5W A;  1BSH A;  4COP A;  4C7N A;  4DT0 A;  5EJD A;  2L4B A;  3H1K J;  3HZQ A;  1GL2 D;  2W6B A;  3KHU A;  5AW0 B;  4PV1 D;  3M0A A;  2N1T D;  2L0Q A;  1IMQ A;  1HF9 A;  1KIL B;  2K88 A;  1BSN A;  3L75 G;  5APW A;  5BVZ A;  1MZ8 A;  2RN0 A;  3JC2 2;  1YJW P;  1M1J B;  3B71 A;  3O6Q B;  3RBZ A;  2Y9Y A;  2POH A;  1P84 E;  1NH4 A;  2FQ2 A;  1K30 A;  3KPE A;  4IOI H;  2M5A B;  1N73 B;  1SLQ A;  1M56 D;  1URQ A;  1FZA A;  2OTK E;  1NVO A;  2OQQ A;  3HD7 C;  2K9Y A;  1SQB E;  3H1H G;  3L73 G;  2ITA A;  1DD4 A;  3KZI H;  1LTJ B;  2GUS A;  2MF4 A;  3GZM A;  1T6A A;  2JO0 A;  1S72 P;  4XFX A;  1EZV D;  2Q5U A;  2C9N Y;  1GDT A;  2M8L A;  1K73 Q;  3CMA P;  1JO5 A;  1RQV A;  2NO8 A;  2D2C C;  4H2W C;  1JMB A;  1FDI A;  3G28 A;  3AE2 C;  1PP9 E;  1NKZ B;  2KG6 A;  4AUW A;  3PRJ A;  1R5S A;  3M9H A;  1FZF A;  3M91 A;  3VMZ A;  2B89 A;  2AF8 A;  4H13 D;  5APX A;  4BPH A;  2LF4 A;  3V5B A;  3L75 J;  2KWL A;  4ZNC A;  3U59 A;  1VQ9 P;  2Q9I A;  5CJ4 A;  2P10 A;  3Q2Y A;  2QJK C;  4XFY A;  4BWN A;  4U3F E;  2Q3I A;  2XZR A;  1AJY A;  1FS0 E;  2P9X A;  3DS5 A;  3V4Q A;  1RO2 A;  2KOD A;  2G3A A;  1VQ8 P;  3H1I D;  3CL3 D;  2P58 A;  2MJZ A;  4ZKP A;  2OTL P;  3H1H J;  3AEG C;  4JF7 A;  2JWD A;  2LOL A;  4D6T G;  2RMZ A;  3FXE A;  3GG2 A;  1RE4 A;  2VRS A;  2FYU E;  1Y9B A;  1FZB A;  2OGU A;  1AF8 A;  1YHQ P;  3CX5 E;  1YQ4 C;  4PD4 E;  5APQ A;  1FZG A;  1JY3 N;  2AXT E;  3HD7 B;  2ZT9 C;  1KQF B;  4GOD A;  1NU1 E;  5CHX A;  3RG2 A;  4WY4 C;  4KHX A;  2K3R A;  2HFE D;  1NTM D;  3U1A A;  2VLP A;  1VQK P;  3H1I E;  3TGU D;  1VQO P;  3I55 P;  3BRT B;  1ZRT E;  5B66 H;  1NTK D;  2Q7C A;  2WPS A;  2FAD A;  1RNI A;  2GZI A;  2X2B A;  1EDI A;  2N5H A;  1J1E C;  2FQ1 A;  4NEO A;  2E74 C;  1HWT C;  3VP8 A;  3Q5S A;  1SQB K;  2IYP A;  3LMO A;  1QGK B;  2MVV A;  1AYI A;  3N4X A;  2SPZ A;  1BCC D;  1X9V A;  1N86 A;  1VQL P;  3CXH E;  1AUM A;  3B5I A;  2Z5I A;  2Z44 A;  4HH2 A;  4IZ6 A;  1PIX A;  2FAC A;  2KK7 A;  1Y8A A;  3JCU H;  2IFN A;  2LTE A;  1MV8 A;  2PRR A;  3VOP A;  2IX7 C;  4I6M C;  3CCE P;  4D6T J;  1SQX G;  2JO1 A;  1GXH A;  3II6 A;  4D6T D;  1OVU A;  2IBZ G;  2JWA A;  2B87 B;  1SVF A;  1M90 Q;  3R2P A;  2YMK A;  5BU8 B;  2PNG A;  1JCD A;  1NTZ E;  3MP7 B;  5APU A;  1SQQ G;  3B5N D;  1CW5 A;  1OW8 A;  2OYH C;  1ZW0 A;  1HGZ A;  5KAF E;  2J58 A;  1Q82 Q;  3C8V A;  5BS1 A;  2AXT H;  1PPJ E;  2KP8 A;  1KC8 Q;  2KSJ A;  1IJD B;  2HPC B;  2K2Q A;  2W27 A;  3O8Z A;  4GOF A;  1PZQ A;  2GDY A;  1KQS O;  2ZT9 B;  3DS4 A;  2WTY A;  1OVV A;  1IC2 A;  5KAI H;  3BCC D;  2BCC E;  4JYB A;  2YKP A;  1JY3 P;  5KLV D;  4H2X C;  1G2C A;  1RF1 C;  4XA4 A;  2QJY C;  3CPW O;  2O1J A;  1BGY D;  2FYU K;  5HVC A;  1RE3 A;  1X22 A;  1J1E B;  1L0N E;  2E74 B;  2N9Y B;  1KIL A;  3P05 A;  3CXH H;  2OAR A;  1NU1 K;  1EMV A;  2PEK A;  2A06 G;  1CEI A;  3RK2 D;  4PJ0 H;  3Q20 A;  1ZR4 A;  1AFO A;  1SQX J;  2PEN A;  1M1J A;  3O6Q A;  1MFT A;  1M1K Q;  2XT1 A;  1QEX A;  1SQV E;  1MZ9 A;  3OAK A;  3L4F A;  5L8R J;  1JY2 N;  2M5A A;  1SQQ J;  4WWI A;  3EWK A;  1N73 A;  1BGY E;  2O01 J;  1L0L E;  1LP1 B;  2RH0 A;  3MUD C;  2IBZ I;  1EIA A;  2KB7 P;  2KYV A;  5CCG C;  3N7N A;  4OGQ D;  1IFN A;  2K5X A;  1T2K D;  4NPE A;  3KYQ A;  1SQP E;  3CD6 P;  2KOO A;  3B8E B;  4DCK A;  4NPF X;  5AVR B;  1LTJ A;  1A8O A;  1KFN A;  2P1J A;  4EOT A;  1NYH A;  2WVR A;  3CWB G;  3CC4 P;  1KD1 Q;  3E2D A;  4O9B A;  5CCH C;  4U0C A;  4YPC A;  3RK3 E;  1PGO A;  2ERH A;  2LIU A;  3MGN A;  3BAS A;  2KOP A;  2HLO A;  4ASW A;  2C0X A;  1ZNV A;  1N2D C;  2GZG A;  2HG5 D;  1SFC B;  3L71 D;  1K05 A;  1KB9 D;  5AW4 B;  4Y99 C;  3PP5 A;  1GK6 A;  2O1K A;  1JY3 O;  1OIP A;  4QNB A;  2E75 C;  2JAZ A;  2CG5 B;  3Q3D A;  5AW2 B;  1NTZ K;  3G3Z A;  2CGQ A;  1EDL A;  1RF1 B;  2E76 C;  3W68 A;  4IL6 E;  2QJY B;  2DGY A;  2WPQ A;  2QE7 H;  2EHT A;  1PL5 A;  2BAS A;  2XND H;  3HUS C;  1HJ0 A;  2KLV A;  4BRY B;  4ZMD A;  3RL0 D;  2VLN A;  4QKO A;  5M1B A;  1URQ D;  4AYC A;  2MR7 A;  1ZLL A;  3UIA A;  1T8K A;  1IK7 A;  1LTG C;  1VL2 A;  3V2P A;  4OH8 B;  3L74 D;  1JCC A;  3ABV C;  5GTH E;  3ZDM A;  2JYG A;  2KGA A;  3CI9 A;  3EFF K;  1ZV8 A;  5KKZ C;  1SQB G;  3AE4 C;  3H0D A;  3PJS K;  4GT1 A;  1KN7 A;  2KNC B;  3GKL C;  1L4A C;  4CPG A;  1NAF A;  2KGC A;  1KYO D;  2PP6 A;  3A0H E;  3HD7 A;  2FXM A;  3L70 D;  4QMA A;  3A0B E;  3V2Q A;  3M0D C;  1QRJ A;  3G6E P;  3L72 D;  2M8R A;  3H1J E;  1L0I A;  2KGE A;  3HE5 B;  3S4R A;  1AQ5 A;  1BE3 E;  2UWJ E;  1PP9 G;  3TDK A;  4BPF A;  2JJL A;  4H44 C;  2E5T A;  2W83 C;  3CCR P;  5AW1 B;  5AVZ B;  2QJP C;  1FJK A;  4PXH B;  4HYT B;  3VTP C;  3U43 A;  5GTI E;  1L0L K;  5AW5 B;  4OVN F;  1QVF O;  3CME P;  3HRN A;  2LKI A;  4RES B;  1EOQ A;  4UHP B;  3EJD A;  1L0H A;  1KOR A;  3RGU A;  1HTL C;  1KYO E;  2KOQ A;  4HB1 A;  3H1L J;  1FOS E;  2IZ1 A;  1SQP K;  3EJE A;  4BPG A;  2E75 B;  2BEQ D;  3H1L D;  1GD2 E;  2GYK A;  3Q1M A;  4U3F G;  3MGE A;  3G0V A;  5AVY B;  2E76 B;  3H1K D;  1DH3 A;  3AEC C;  5KJ7 A;  1P84 I;  3H6P A;  1LT9 B;  1GW4 A;  3HUS B;  4RO0 A;  4KJM A;  1PGQ A;  1GXG A;  1SQB J;  2AFD A;  5AVW B;  2LIW A;  2JYL A;  2PEI A;  2FYU G;  4H0L D;  1N7S D;  3HYB A;  1OX3 A;  3BRV B;  2B87 A;  1OXZ A;  2AEJ A;  2KSE A;  3V2N A;  1RY3 A;  2EIA A;  4Z1M H;  1NU1 G;  2JQ4 A;  4EYY Q;  1SFC D;  3A0H H;  3A0B H;  5JPA A;  2QM7 A;  1LNQ A;  1K9M Q;  1PP9 J;  2HPC A;  1L4A B;  4K3A A;  1JY2 O;  3TSI A;  1AVO A;  4JQ0 D;  1VF5 D;  1OMI A;  3RK3 C;  4W7Z A;  1DV5 A;  2QVA A;  2J5U A;  1EXI A;  1FDO A;  3E7K A;  2FXO A;  1GK4 A;  2HYN A;  3CC7 P;  3GF7 A;  5GTI H;  3AE8 C;  1AA0 A;  4H44 B;  2PEJ A;  5APS A;  5KP7 B;  1M57 D;  1KV4 A;  2QJP B;  2ZXE B;  2WSE H;  1T8Z A;  4U3F J;  4WYM A;  1VQN P;  2R32 A;  3MHV A;  2G8Y A;  4ZKU A;  2CQ8 A;  3R4Y A;  2KW2 A;  3D6Z A;  3A2A A;  2GUV A;  3S1K A;  2ZAE B;  7CEI A;  1QLE D;  3JSV C;  1EZV E;  1USD A;  3L75 D;  1CI6 B;  5AVV B;  3IFM A;  1UJZ A;  5BU5 A;  3SFD C;  3GMA A;  2FYU J;  3CCV P;  3CXC O;  1P84 H;  1N7L A;  4JPZ B;  5TIS E;  4R0M A;  1VQ6 P;  3G9R A;  4IFM A;  2YXQ B;  1LP1 A;  3C1L A;  3D71 A;  3CX5 I;  2L5G B;  4PD4 I;  5KTB A;  3GF3 A;  5DJT B;  2N6Y A;  1PPJ G;  2NPS C;  1R5L A;  1LTB C;  1DIP A;  3L73 J;  2LL8 A;  3SFE C;  2FXP A;  4L73 A;  3GLM A;  1S5L E;  3H1H D;  3L73 D;  2JU2 A;  2KIK A;  2FFD C;  4TLF A;  1LTI C;  2RKL A;  5B5E E;  5H2F E;  1N7S A;  2BCC G;  2MVU A;  1QL2 A;  2WQY C;  3RK3 B;  1SFC A;  2XDJ A;  5E79 E;  2C0W A;  2Z4E A;  1KIL D;  3LIE A;  2WT7 B;  2AXC A;  1VHN A;  2JB0 A;  4RJT A;  1XTC C;  1L0N G;  1M6N A;  2D2C B;  1KQL A;  2EHS A;  1LTA C;  5DJU B;  4CA3 A;  3CXH I;  2ZYA A;  1RF1 A;  3VYI A;  3DPH A;  1BXI A;  3LID A;  2PGD A;  3CCL P;  1RH5 B;  1NTM E;  2FVA A;  2WWW A;  4BRY A;  1SQV G;  2GDX A;  3TGU E;  3L37 A;  3IN6 A;  4XRQ A;  1HGV A;  2ZFC A;  2DW3 A;  1S4X A;  2GZJ A;  3QH9 A;  1L0L G;  2JP3 A;  5TIS H;  2QJK B;  1NTK E;  5F2N A;  1E79 H;  2M8P A;  1D7M A;  1SQP G;  2IFM A;  3AE1 C;  3AE3 C;  1YJ9 P;  1LTS C;  2KNC A;  1GL2 C;  1LWU C;  3MUD A;  4PV1 C;  2N1T C;  3WU2 E;  1BCC E;  5CCG A;  3CX5 H;  2R3C A;  4PD4 H;  5CMZ A;  2NPS B;  1JTH B;  2PEO A;  2BCC J;  1KMI Z;  2HOD B;  4LC1 A;  2V7Q H;  1WT6 A;  1OVR A;  3KQG A;  1FE6 A;  1H89 A;  1G1J A;  1NHL A;  3FXD A;  3HE5 A;  4GDO A;  3ITK A;  2FFD B;  2KOS A;  2CPS A;  3GHG C;  3CCM P;  4W7Y A;  1SS1 A;  2ZVN B;  2QEX P;  2M5R A;  2FHS C;  2BEZ F;  2N6Z A;  1FZE A;  5CCH A;  4H0L C;  4WY4 B;  1WMK A;  1L0N J;  1FZC C;  1YTZ T;  1YYC A;  4UB6 E;  4D6T E;  1EDK A;  2IZ0 A;  2MR8 A;  1KFM A;  2YO3 A;  4N3Y B;  4EDF A;  5F2K A;  1MFZ A;  1G1I A;  1BDC A;  3BAT A;  2J59 M;  3H4E A;  1SQV J;  1JMM A;  5AVU B;  3OA7 A;  3G26 A;  3PTZ A;  1L0L J;  2H89 C;  1FJP A;  2KS1 B;  2KZI A;  4LLH A;  5TJH A;  1LT9 A;  2KLU A;  3MTU E;  3HUS A;  2K94 A;  3T97 B;  2B9B A;  3BCC E;  3EFG A;  2A45 I;  3VMY A;  2Z45 A;  1SQP J;  4I7Z C;  3CLQ A;  5KLV E;  3FWL A;  1M6E X;  1RO0 A;  2L9F A;  1Q7Y Q;  1SQX D;  3HD7 D;  2Q3E A;  1FR2 A;  2ZVO B;  2IBZ D;  2IDB A;  4H13 C;  1OFC X;  2ZJS E;  4NPD A;  1SQQ D;  3WU2 H;  2GZE A;  1ZOY C;  1YBK A;  4YXW H;  3MD0 A;  3V6I A;  5KAF H;  2WSS H;  1T3U A;  3H1J G;  3CCU P;  3D70 A;  2E1M A;  1GL2 B;  1WRG A;  1LWU B;  1BE3 G;  2KGD A;  1PGP A;  3IAO A;  2QNW A;  1F80 D;  4PV1 B;  1L4A A;  2KZJ A;  2N1T B;  1NTM K;  2BUO A;  2OYH B;  3DS2 A;  4OWF A;  2QIW A;  1EDJ A;  2KXP B;  1KTM A;  3M0D A;  5HGM A;  2JKV A;  3V2R A;  3USS A;  4PH0 A;  1NTK K;  1H0T B;  2JR8 A;  3FGA D;  1A43 A;  3GHG B;  1S2E A;  1JM0 A;  1VQP P;  1SQQ E;  2FBW C;  3M9Q A;  3TK1 A;  2N98 A;  2EFJ A;  5KJ7 D;  4C46 A;  4DG9 A;  1FZC B;  2JU1 A;  2WSF H;  3A7O A;  2BQ1 E;  3VMX A;  2AEM A;  3AE7 C;  1D1D A;  3I5C A;  4JYC A;  3F89 A;  1YJN P;  1GZL A;  4R4M A;  1NWQ A;  2H7H A;  1NJI Q;  2A06 D;  1CI6 A;  1X8Y A;  2CPB A;  2N50 A;  2Y9Z A;  2P7J A;  1OR5 A;  2WPV B;  3VMA A;  4N78 D;  2Y0E A;  4C7R A;  2JDI H;  3L71 E;  1GTW A;  3PH0 A;  1KB9 E;  3EQ2 A;  2WIT A;  3E1R A;  1IFJ A;  3TNU B;  3IR9 A;  3DS3 A;  2A45 H;  1M1J C;  2BHV A;  1E6J P;  4XE5 B;  2I1K A;  1BE3 J;  5AW8 B;  2GM4 A;  2ZT9 D;  1YIJ P;  1PFI A;  1IUQ A;  2W6A A;  1RHZ B;  3NMD A;  4H13 B;  3CWB J;  2A06 E;  3H47 A;  4H2Y C;  1X0T A;  2O3J A;  3CC2 P;  1JY2 P;  3CWB D;  1ZN5 A;  3TYY A;  5HV8 A;  4EI2 A;  1U7J A;  2WSE J;  1NQ4 A;  2FVF A;  1S9K D;  1NAY A;  4XFZ A;  2JEE A;  2KUB A;  3L74 E;  1IO4 A;  3C9I A;  3D6Y A;  5KLV K;  4R4L A;  2I1J A;  2E74 D;  2YIU C;  5F2O A;  2YMY A;  2WT7 A;  1IZN B;  3KZI E;  3AEE C;  2W6J H;  3B5N C;  1PEO A;  3OJA B;  1JUN A;  3P32 A;  1BDD A;  4Y99 B;  4IL6 H;  1BAJ A;  1EZV G;  1K04 A;  4HKG A;  3L70 E;  4I2L C;  2QSI A;  3L72 E;  1IFD A;  2XXM A;  4XFJ A;  1P84 D;  3NTN A;  3PLN A;  1U7M A;  1ACP A;  1UIX A;  3B4S A;  4WB4 A;  1SQX K;  1KB9 H;  3WBH A;  3CCJ P;  5APY A;  3NFQ A;  4M0I A;  3W67 A;  5AW9 B;  5GTH H;  1SQQ K;  3RL0 g;  2H43 A;  1SQB D;  3CCQ P;  3SWF A;  2AFE A;  4YXD C;  3H1L E;  3LW5 H;  2IPP A;  4RKU J;  1FU1 A;  5KKZ B;  2NPS A;  1JTH A;  3H1K E;  4ASV A;  2HOD A;  1UII A;  2R5D A;  1DD3 A;  3RK2 C;  3AEA C;  2WSC H;  5AVT B;  3G29 A;  3H1I G;  4F37 A;  3P7K A;  1TU3 F;  2FFD A;  3GW6 A;  1QL1 A;  4W80 A;  1PP9 D;  2M0B A;  2OYI C;  1JNM A;  2LR2 A;  3Q5P A;  1RQU A;  3BVH A;  4WY4 A;  5CBN A;  3G71 P;  2XZ0 D;  4GR2 A;  2FYZ A;  4OGQ C;  2NZ2 A;  3KXD A;  1Q81 Q;  2L6E A;  1AQT A;  1JOC A;  1T2K C;  3H32 B;  5KLI C;  3HE4 B;  2YIU B;  1KYO H;  3G1G A;  1EZV I;  1NTM G;  3B5N B;  4U3F D;  3AE6 C;  4IPY A;  1RF0 C;  3TGU G;  3B4Q A;  1NOH A;  1IK9 A;  1OWA A;  1HBW A;  5B66 E;  2KS1 A;  1NTK G;  1FAV A;  1ZR2 A;  3T97 A;  3NXS A;  2KG8 A;  2PAJ A;  2V4H A;  1ZME C;  2B88 A;  1A02 F;  1PEU A;  1ZP0 C;  2XKM A;  5CCG D;  5KJ7 C;  3K5B A;  2QM8 A;  1Q2N A;  1X79 B;  2WPR A;  2FYU D;  4GIF A;  2WMM A;  1PGJ A;  2Y0C A;  1HQB A;  3QWO C;  1LGH B;  1NTZ G;  1S1C X;  1BCC G;  3CX5 D;  2V7Q J;  1NU1 J;  4PD4 D;  1NGM B;  1J1D C;  4GKG A;  3AEB C;  1NKN A;  2XZ1 C;  3NTE A;  2YKO A;  2OTJ P;  1NU1 D;  3S9O A;  3U1C A;  1USE A;  1CZQ A;  2PEM A;  3H1I J;  3JCU E;  2QA4 P;  3A5T A;  1IFI A;  5CCH D;  4PH1 A;  1GL2 A;  4JBZ A;  1LWU A;  3RL0 C;  2N1T A;  3L75 E;  3KDP B;  1XTG B;  3FX0 A;  2OYH A;  1PV3 A;  1URQ C;  1J2J B;  2R44 A;  3AE9 C;  1ZRT D;  1JB0 J;  3RK2 B;  3P8M C;  3RG6 C;  5C39 A;  4I1L A;  2E5Y A;  2H8P D;  2P67 A;  1H0T A;  2M3B A;  1Q86 Q;  4COC A;  1VDF A;  3GHG A;  2E75 D;  2OYI B;  4U0E A;  1SP4 A;  2P2U A;  1H88 A;  1UNK A;  2E76 D;  3GZL A;  1NTM J;  4HJG H;  2FY8 A;  1FZC A;  3TGU J;  2ONT A;  1A02 J;  3H1H E;  2Z5H A;  4OGQ B;  3CXH D;  3L73 E;  3FWN A;  4Y28 J;  2K0D X;  1PEM A;  3WUV A;  1NTK J;  4LGD E;  5KLI B;  2K9J B;  3WUU A;  2AEF A;  5HGL A;  1IFP A;  2M3E A;  1AVY A;  5KAI E;  2Q1K A;  2L22 A;  1GPJ A;  5KP6 B;  3BCC G;  4L76 A;  2N5I A;  4UB8 E;  1CSB A;  1GW3 A;  5KLV G;  3NY7 B;  4IFF A;  2Q6Q A;  5EW5 E;  3HTK B;  4PWV B;  1NTZ J;  1BCC J;  5HGO A;  1BGY G;  1W5C E;  4C7N B;  4U0D A;  1KIL E;  2VLO A;  1YIT P;  2A45 G;  3TNU A;  1NTZ D;  2L91 A;  3Q5R A;  2GA1 A;  1OW6 A;  4TT3 H;  1L4A D;  2DNW A;  2IYO A;  1PPJ D;  2K93 A;  3I56 P;  2ZYD A;  4PJ0 E;  3DTJ A;  1M7L A;  2YXR B;  4IL6 X;  1S5L H;  4DZO A;  1J1D B;  1LJ2 A;  5B5E H;  1IMP A;  1HVV A;  3F5H A;  2JBG A;  2QG4 A;  5H2F H;  5CBO A;  2KOG A;  4H44 D;  3H25 A;  1FC2 C;  2YKQ A;  2FAE A;  3OW2 O;  3M1M A;  2BCC D;  1RE4 C;  1X3O A;  2VSQ A;  3RL0 B;  5BS2 A;  1URQ B;  4MRT C;  3WMM 0;  1EXJ A;  2K92 A;  2FQ0 A;  1ZMB A;  2WSF J;  2HR3 A;  1FBM A;  2R3S A;  1N7S C;  5E79 H;  3DS0 A;  2PY8 A;  3VRL C;  2NRG A;  1VQM P;  3VN0 A;  1HY8 A;  1OW7 A;  2CK3 H;  1L0N D;  5AVX B;  1GMJ A;  2AVA A;  1S3J A;  4MN4 C;  1SFC C;  2KI7 B;  3BCC J;  3EJB A;  1VQ5 P;  1DEE G;  3SSU A;  4L74 A;  5KLV J;  3WUT A;  1VF5 C;  4UB8 H;  2W8Z A;  1L2P A;  4A7P A;  1SQV D;  4BXL A;  3L71 G;  1JJ2 O;  1BGY J;  1IFM A;  1JEK A;  4B86 A;  2YO2 A;  1W2E A;  2PFX A;  2R5B A;  3L35 A;  1L0L D;  2KG9 A;  2H88 C;  2FYN C;  1OZH A;  3A3Y B;  4GOE A;  1ZXG A;  4WBA A;  3G1I A;  3G21 A;  2MY5 A;  3M06 A;  4GR6 A;  2LPK A;  5CJ0 A;  4XRO A;  1SQP D;  2QRX A;  1DNY A;  5AVQ B;  4EIJ A;  1HUC A;  1HH0 A; 
#chains in the Genus database with same CATH homology
 1VQ7 P;  1QVF O;  3CME P;  4U0B A;  3G29 A;  1EOQ A;  5HGM A;  1VQ9 P;  2PEJ A;  4PH0 A;  4XFZ A;  4XFY A;  1A43 A;  2DGY A;  1VQL P;  3P05 A;  4QNB A;  1AUM A;  3OW2 O;  1M6N A;  3B5I A;  3M1M A;  4WYM A;  2OAR A;  2Z44 A;  3RG6 C;  2XV6 A;  1VQN P;  1N8R Q;  1VQP P;  1YJW P;  2PEK A;  3G71 P;  1Q86 Q;  5F2O A;  2P9X A;  2EFJ A;  3MGE A;  5F2K A;  4COC A;  3DS5 A;  5BS2 A;  3DPH A;  1K30 A;  3G0V A;  4GR2 A;  3Q20 A;  2QEX P;  1RO2 A;  1ZMB A;  2KOD A;  1VQ8 P;  4U0E A;  2PEN A;  1PEO A;  1Q81 Q;  3H4E A;  2L6E A;  1M1K Q;  3DS0 A;  2XT1 A;  2PY8 A;  3VRL C;  3CCL P;  3CCE P;  2BQ1 E;  1VQM P;  2OTL P;  1D1D A;  1BAJ A;  3G1G A;  3G26 A;  2ONT A;  1YJN P;  4XRQ A;  3CCV P;  1M90 Q;  1NJI Q;  3CCS P;  4IPY A;  1EIA A;  5HGN A;  3DS1 A;  3CXC O;  1PEM A;  2JYG A;  2JYL A;  2PEI A;  2XXM A;  1YHQ P;  5HGL A;  1VQ5 P;  5I4T G;  5F2N A;  3HYB A;  1VQ6 P;  2M8P A;  2Z45 A;  3H0D A;  1YI2 P;  1Q82 Q;  2JO0 A;  5BS1 A;  1S72 P;  4XFX A;  3CD6 P;  2M8N A;  1M6E X;  1K8A Q;  1RO0 A;  1KC8 Q;  1Q7Y Q;  4U0A A;  2EIA A;  1QVG O;  3WBH A;  3CCJ P;  2CWO A;  1JJ2 O;  1A8O A;  4M0I A;  2M8L A;  1K73 Q;  1YJ9 P;  1PEU A;  3DS3 A;  3CMA P;  2PEQ A;  1VQK P;  3CC4 P;  1KD1 Q;  3E2D A;  5DCK A;  5JPA A;  2EG5 A;  1KQS O;  3G4S P;  5HGO A;  1QRJ A;  1VQO P;  4U0C A;  3G6E P;  2BHV A;  1K9M Q;  4U0D A;  1E6J P;  3I55 P;  3CCQ P;  1YIT P;  3G28 A;  1VQ4 P;  3G1I A;  3G21 A;  3DS4 A;  2PEO A;  4U0F A;  1W2B O;  1PEQ A;  1YIJ P;  1IUQ A;  4GR6 A;  3CCU P;  2E1M A;  2Z46 A;  4COP A;  4XRO A;  3NTE A;  4PH1 A;  1RNI A;  3H47 A;  2OTJ P;  3CCR P;  3HZQ A;  3I56 P;  2BUO A;  2PEM A;  1M74 A;  3DS2 A;  3LRY A;  3CPW O;  2QA4 P;  3CCM P;  3CC2 P;  2LF4 A;  3CC7 P;  3DTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...