1VQLP

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqlP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqlP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqlP02
3CC2P 1K9MQ 1YHQP 2QA4P 3CCQP 1YI2P 2QEXP 1S72P 1VQ5P 1Q81Q 3CCVP 1KD1Q 1JJ2O 3CCSP 3CCMP 3OW2O 3G4SP 1VQ8P 1M1KQ 3CMEP 3CC7P 1VQPP 1QVFO 3CD6P 2OTLP 2OTJP 1VQOP 3CCEP 3G6EP 1Q7YQ 1QVGO 1VQLP 1YJNP 1YITP 3I55P 1VQMP 3CMAP 1M90Q 3G71P 3CCJP 1W2BO 3CPWO 3I56P 1VQ7P 1VQ6P 3CCLP 3CCRP 1Q86Q 1KC8Q 1K73Q 1NJIQ 1VQNP 1VQKP 1Q82Q 1YIJP 3CXCO 1VQ4P 1N8RQ 1KQSO 1VQ9P 3CC4P 3CCUP 1YJ9P 1YJWP 1K8AQ
chains in the Genus database with same CATH superfamily
1N73B 2DNWA 5HGLA 1NTKE 2JJLA 2L4BA 3AEBC 1NTZG 2J58A 2KSEA 2IBZD 3M9BA 2FYUD 2IX7C 5GTHH 4I2LC 2Y9YA 1VL2A 1OFCX 1NU1E 1KILD 2E5YA 2JGPA 1SS1A 4DJGA 5AVXB 1YJWP 2PRRA 5AW0B 4YXDC 3CC2P 2PP6A 4TT3H 2LMLA 4L76A 1KTMA 2MJZA 1VQ5P 1PEUA 1YQ3C 3RL0g 3CCSP 3WU2H 4BRYA 1VQ8P 3MIWA 4W7YA 1T2KC 1S9KE 4H44C 3M0DA 5KLVK 1A02F 2KP8A 3G3ZA 3RK3C 4AUWA 5KLVD 2LKMA 1GK6A 1AFOA 1KQFB 3L75G 1IFDA 1GL2C 1VPCA 2KLVA 1E5WA 1KB9I 1S5LE 3II6A 4U3FJ 1NOHA 5KAIH 1YTZT 2WSSH 4DG9A 4GODA 4XA4A 1BCCG 3OJAB 4WYMA 1T2KD 1HVVA 3D6YA 3G4SP 7CEIA 4H44D 1QVFO 1SQBJ 1OW6A 3M9HA 3RK3D 1GMJA 2Y9ZA 3EJDA 3OAKA 3LW5J 4XROA 2CG5B 4D6TE 4QNBA 3L73J 4IL6X 4PJ0H 1VF5D 2WZ7A 1KB9D 1EZVG 1M56D 3H1HJ 1T3JA 2VLQA 2KLUA 3Q5SA 2WPVB 4F37A 1FZCB 2C0WA 1R8EA 1LT9B 4IFDK 2KGAA 4H13B 4EDFA 4UB6H 4NEOA 1SQBD 1S72P 3F5HA 5B66H 1BAJA 3EWKA 3PLNA 2WSFJ 1RE4C 2EIAA 3CPWO 2YO2A 2X2BA 2ZYDA 1HH0A 2KOPA 1OWAA 1OW7A 1NTKJ 1PFIA 2XZ1C 1ZNVA 1QGKB 3AE7C 3HE4A 1JY2N 1VQLP 3HUSC 2FFDC 4RJTA 3G1IA 1SQQE 3O8ZA 1A8OA 1NU1J 2GZIA 3P05A 2JYLA 1Q2NA 4KJMA 5APXA 3L70E 1RF0A 1JCDA 2K88A 2KG6A 1NTKD 1A02J 2MF4A 4WWIA 3L72G 5KLIC 4HKGA 2IFNA 2Q6QA 2K0XA 1NH4A 4IL6E 2R44A 1NU1D 2OTJP 1GXGA 1Q7YQ 3H1JG 5AW1B 1FU1A 2D2CB 2IYOA 2GDWA 1RF1A 1LWUA 3RG6C 3L36A 2K9JA 4Y99C 4RO0A 1UIIA 5CBNA 1DD3A 2JKVA 1OW8A 3KPEA 1NTZE 1S9KD 5CZDB 3Q5PA 1J1EB 2PEOA 1S1CX 1EOQA 1Y8AA 2KGCA 1D7MA 1PGJA 1L0IA 2GM4A 3H1KG 4IFMA 1HGVA 3MZWB 5CBOA 1R5LA 3GG2A 2J5UA 4D6TJ 3K5BA 4RESB 2K9YA 4GT1A 3VOPA 2N5IA 3A2AA 2BQ1E 5C39A 5HGNA 2FACA 3H1LE 1GU5A 1EDJA 3HE4B 1BGYG 3GHGC 2ZT9B 3BATA 2EG5A 2MY5A 3SFDC 2KZIA 1VQMP 3CCJP 3CE7A 3V2PA 2OYHB 2YXRB 3CI9A 1KQSO 3M0AA 5CCGC 1YJ9P 3WUUA 5TISH 3H1IG 4R4MA 1MFTA 1Q81Q 1IZNB 3C9IA 3FWLA 3L37A 4D6TD 2ERHA 1IFPA 2K93A 4NPEA 1VQ7P 3USSA 5JPAA 1L0NK 2G8YA 1EDLA 1ZMBA 4EI2A 3LIEA 1L4AA 2YXQB 3AEGC 3PP5A 1WRGA 1FZGA 1L0HA 3H47A 1KYOE 2M8PA 5EW5E 2UWJE 3B71A 1LP1B 4JPZB 1RF1B 1LWUB 1SFCC 2K9JB 3IN6A 1ZR2A 4UHPB 4NPDA 2N6YA 3VMAA 3U59A 3F89A 3JCUE 1N2DC 1PP9G 2LXBA 3L70J 2L22A 3CCQP 2N9BA 3PRJA 3PH0A 1KD1Q 3CLQA 1KN7A 1BDCA 1VQOP 1FZEA 2QJKC 3VTPC 4KHXA 4W7ZA 1JTHA 2GZFA 3E7KA 2OGUA 1AV1A 1MFZA 2OYIC 1VDFA 1Q90D 1SQXK 1SQQK 3WUVA 2W83C 1IMPA 4ASVA 2ZYGA 2JU2A 2V7QH 1SQQD 2N50A 3B4QA 1RO0A 1FOSF 1SFCD 2PENA 1NO4A 1FOSE 3VMZA 2QSIA 2VRSA 3L70D 2ZXXA 1NJIQ 2XU6A 3IFMA 3HE5A 1NTZJ 2C0XA 2E5TA 3TK1A 3V6IA 2B87B 3E2DA 3AE2C 5EJDA 1R5SA 3G28A 5E79H 2O1KA 2KOGA 1FR2A 3CMEP 5AVWB 1G1IA 1JMMA 5KKZB 1PL5A 1PEMA 1N7LA 3M91A 1NTMG 2JYGA 3JC22 3D71A 1L4AB 3H1LJ 1OZHA 3HZQA 3OW2O 3L74G 1RQUA 3CD6P 1NTZK 4I1LA 3G6EP 1LTJB 3BASA 3NTNA 5I4TG 1RE3A 1XTGB 2HPCB 1NTZD 2P9XA 1DV5A 4U7JA 4BPHA 4BPGA 1P84H 1S2EA 5AVRB 1LTAC 1FZAA 1JY2P 1EC5A 1OXZA 3CCUP 1KFMA 1KORA 4WY4B 2O01N 5AVTB 3RBZA 1N73A 3P7KA 1OMIA 2ROQA 1ACPA 2FXPA 2POHA 4JQ0D 3QH9A 1JTHB 2JO1A 1OVVA 3H1LD 1L2PA 3B4SA 2CQ8A 3G1GA 4C46A 5BVZA 4LGDE 4OGQC 4DT0A 1HQBA 2E74B 4WVZA 2N6ZA 1KYOI 3G9RA 4CA3A 1DEEG 4AYCA 2A45H 2D2CC 3H1KE 2KG8A 1PEQA 1T3UA 1SQXG 2LKIA 5KAIE 3P32A 1YIJP 3HE5B 1EZVI 3MGNA 2V4HA 3BRTB 3W68A 3H0DA 1BGYE 3EJBA 4BXLA 1S5LX 1JO5A 3OA7A 5AW2B 2K1AA 4NPFX 3MD0A 3GKLC 2H89C 1Q82Q 3DS5A 3SWFA 2KODA 4OGQD 3H1IE 1KYOD 4HKZH 2PFXA 2L6EA 2D2CD 3PHLA 3ZDMA 2OTLP 1M1KQ 1M7LA 3B5NB 3M9QA 1IFNA 5KJ7A 2FADA 4R4LA 2FXMA 3TSIA 3KHUA 2PAJA 4UB6E 5H2FH 3A0BH 5KLVJ 4XRQA 2P10A 5B66E 1ZXGA 2C9LY 1QVGO 1Y47A 1FZCA 2CPSA 3HD7C 1LT9A 1LTSC 1HJBA 3NFQA 1PP9E 4U0AA 3C8VA 1BDDA 2ZVOB 2FQ2A 1RF1C 3H4EA 3CX5H 2BCCE 1HWTC 2FQ0A 5K5GB 5F2NA 1VQ6P 3Q5RA 3AE1C 1QL2A 5DJUB 1GK4A 4C7NB 3HTKB 2K2QA 3NY7B 1K8AQ 1G2CA 2B89A 1QX8A 1CZQA 1NHLA 2AEJA 1L0LG 1IFIA 1VF5C 2E75B 4HB1A 2XV6A 3AECC 3HD7D 2VLPA 3I55P 4R0MA 3KZIH 1M90Q 2KIKA 5HV8A 3H32A 1RNIA 4I7ZB 3RK2B 2WT7B 2K0YA 2R3CA 2ZVNB 1JY2O 5AW7B 3VMYA 3VN0A 5L8RJ 2B9BA 2B88A 2WPRA 1FJKA 3H1KJ 4MN4C 2DW3A 2BUOA 1MZ8A 4L74A 2RMZA 3CWBG 2IPPA 2QJPB 4U0EA 2WITA 3BCCE 1RHZB 2M5AB 3VMXA 2ZAEB 3EJEA 4M3LA 2KWLA 3LW5H 3G29A 5KP6B 2JP3A 2FAEA 4ZNCA 1LTBC 3R4YA 3MHVA 1CW5A 3NTEA 1J1DB 2PEJA 3UIAA 3SFEC 2XV5A 2XDJA 3L74E 4Z1MH 4C7RA 2E1MA 5KKZC 1L0NE 3WMM0 2A45G 2KZJA 2M8NA 1NKNA 2ZYAA 1Q86Q 1N86A 2K37A 3H1IJ 5KAFH 3FXEA 1L4AC 2VSQA 1E79H 3H1KD 3T97A 1H88A 2KS1B 2WMMA 5KP8B 4PH0A 2N1TB 4GR6A 2WQYC 3N7NA 2LR2A 1K04A 1M1JB 2FYNB 3I56P 2FY8A 5APWA 1FS0E 1BGYD 1GD2E 3GZLA 3CXCO 1N8RQ 1G2CB 5TISE 2YNYA 2AEFA 2AFEA 1YI2P 2H88C 1URQA 2NO8A 1JJ2O 1M74A 2CPBA 2AVAA 2QIWA 3H1ID 2YO3A 3H32B 2HLOA 1SQXE 2FQ1A 1L4AD 2AFDA 1RY3A 2OYHA 4IPYA 1CEIA 2XZ0D 1CSBA 1KQGB 2BCCJ 3FWNA 1LNQA 2M0BA 1PEOA 4YPCA 3RL0B 3AE4C 3FXDA 2XKMA 3GW6A 1F80D 5HGOA 1M57D 1KC8Q 3LMOA 1NWQA 4IOIH 2QJYC 1NAFA 2Y0DA 1PP9D 2O01J 5AW3B 5DCKA 1LP1A 2JR8A 2JDIH 1NGMB 2YIUB 1VQKP 2NZ2A 1BSHA 4N6JA 1FDMA 3T97B 2BCCD 1SQPK 3DS1A 1RE3C 1X22A 1E6JP 3W67A 1ZV8A 4ZKPA 1JB0J 2FXOA 1VKUA 1MZ9A 3BCCJ 3O6QA 3JSVC 3RG2A 1AQTA 2C9NY 4U3FG 1N73C 4W80A 2ZFCA 5B5EH 1JM0A 1URQB 1LJ2A 3L74J 1L0NJ 3A7OA 1LGHB 2G3AA 2E76B 3CXHH 1GL2A 2WSEH 3CL3D 3P8CE 1S4XA 5CJ4A 1HJ0A 3E1RA 5AVVB 2I1JA 1NTMK 1DEBA 2YKOA 2L5GB 3L73G 1T8KA 2QE7H 1KILB 3L75E 3BCCD 1T6AA 2B87A 1L0LE 3GF7A 4JYCA 3H1HG 2KGEA 4JF7A 5BU5A 4UB8H 3L74D 1VQNP 1P84E 2NPSA 2JWDA 4YXWH 2WPSA 3AE6C 1L0ND 1BCCE 2PEKA 2FBWC 3AEDC 2JO0A 3CWBE 3GMAA 1AF8A 2YMYA 2GYKA 3V2RA 1SQXJ 1AJYA 1SQQJ 1LTJA 3RK2C 3DTJA 1HUCA 2HPCA 1DX7A 1M8OB 3V2NA 2KGDA 2KXPB 1D1DA 1J2JB 1IO4A 1ZP0C 4WY4A 1EZVE 1K30A 5KJ7C 4GDOA 2QJPC 2FVAA 5APYA 2Z45A 3O6QB 2A06G 1Z6MA 2CNRA 2QNWA 3HYBA 3L4FA 1IJDB 4H44B 4H0LB 1SQPG 1J1DC 3RK3B 2E75D 2PEQA 5AVZB 2KOQA 1SQXD 5KP7B 5AW4B 2GUVA 1FZCC 2XZRA 4PD4H 1GL2B 4CPGA 3RK2D 1LT9C 2AXTH 1FZFA 2GDYA 2LXCB 2E43A 2QG4A 4H13C 2K92A 5BS2A 1H8AA 5AVUB 2QA4P 5EFWB 5KJ7D 3MUDA 4COCA 2GUSA 1AUMA 5BU8B 1GW4A 3M0DC 1SQVK 1PPJG 2K3RA 1NVOA 3D6ZA 1FAVA 2NPSB 3L71G 2WSCJ 1LTTC 5AVYB 2MR7A 5CJ0A 1IK9A 3TGUG 4H2XC 2LPKA 5H2FE 4GOFA 2IYPA 4EOTA 2MVVA 1ZLLA 2FVFA 3MP7B 1UJZA 5GTHE 4XFXA 2R5DA 3B5NA 1SVFA 4H13D 4B86A 1DD4A 2MKVA 2LOLA 1IMQA 3KDPB 4D6TG 5AW6B 3L72E 3L75J 4Y28J 2O3JA 3TDKA 2MVUA 3WU2E 3RL0C 2Z44A 1PGOA 3CX5E 3H1JE 2M3BA 2XXMA 1U7JA 2WTYA 1P84I 2GZJA 3VP8A 1W5CE 2FHSC 1BCCJ 1QLED 3P8CD 1M6NA 2PEIA 3CWBJ 2KG9A 4N3YB 1BXIA 1RH5B 3VRLC 1L0LK 3KZIE 5APTA 3HUSB 2FFDB 4GIFA 3L75D 1L0LD 4U3FE 5AW8B 2KORA 2W8ZA 1EIAA 4C7NA 3BRVB 3HTKA 1J1EC 1YYCA 4U0DA 2QEXP 5CCGA 2R32A 3Q2YA 1JOCA 3RL0D 2R3SA 2A45I 1X0TA 1HF9A 1FJPA 1P84D 3ABVC 3ITKA 4QKOA 1MV8A 4L73A 5CCHA 1BCCD 2JB0A 5GTIH 3V4QA 2JAZA 1URQC 3CWBD 3L73E 2WT7A 2I8DA 1RO2A 1BE3G 4BWNA 4PJ0E 1SQVG 2HR3A 3L70G 2E76C 2OARA 3C1LA 2M3EA 3EFGA 3H1HE 2ZT9C 3GZMA 1UNKA 1EXIA 1NYHA 3AEAC 3RBXA 2OYHC 1X79B 2CWOA 3P8MC 1IFJA 1EZVD 2M5AA 3KXDA 2ZJSE 3I5CA 5KAFE 4WB4A 2ZXEB 4Y99B 3DPHA 1RF0C 1E0HA 2BEZF 4H2YC 3FGAD 1QRJA 1X3OA 2MD9A 1HGZA 3WBHA 1NQ4A 5BS1A 1KLPA 3M06A 1GU4A 2HODB 1ZR4A 4QMAA 3IR9A 1URQD 4ASWA 2HYNA 2OTKE 1T8ZA 1RQVA 3U1CA 3S1KA 2OYIA 2E76D 1X8YA 1GDTA 4RKUJ 2ZT9D 2LTEA 2FYUK 3S4RA 4L75A 1HTLC 2KS1A 2N1TA 2GZGA 2A06E 1LWUC 2P58A 5CHXA 2M8RA 3GHGB 5AVQB 2WVRA 4DOJA 1GW3A 3FX0A 2Q5UA 1M1JA 1SQPE 1PGPA 1KFNA 3L72J 3A3YB 1ZRTE 2P67A 2K0DX 2XT1A 3H1LG 1S3JA 2K5XA 2Y0EA 3CX5I 3H1JJ 3AE5C 2KK7A 4H0LC 2AEMA 1DH3A 1KB9H 1GTWA 2QRXA 1H0TA 3A0HH 3AE9C 1EDIA 2RKLA 4ZKUA 1YQ4C 1PGQA 5APUA 2KW2A 5HGMA 3CCVP 2H43A 1WT6A 1PPJE 4PV1B 1SLQA 3H6PA 1JMBA 2M5RA 1JY3N 3L72D 2M8LA 1NTME 1H89A 3L71E 1SFCB 3TNUB 4XE5B 3TGUE 1JCCA 1N7SA 4YTPC 5F2KA 3CX5D 3H1JD 2YMKA 2W6JH 1KQLA 1BGYJ 3M1MA 2WWWA 4HH2A 4H0LD 2LIWA 3AE8C 3B5IA 2NPSC 3QWOC 2QJKB 5M1BA 2IZ1A 2W27A 1ZN5A 2P2UA 2K94A 2OYIB 1AYIA 5B5EE 1GL2D 4BPFA 3L35A 1LTJC 4U3FD 3CXHE 2RN0A 2WSFH 1OVUA 4U0BA 4A7PA 1SQBK 2GZEA 1K73Q 3KQGA 2IBZG 4WY4C 2DGYA 2FYUG 2BASA 3NMDA 4BRYB 1PIXA 2KUBA 3CCMP 5HVCA 3AE3C 2OQQA 2NPSD 4OH8B 3L73D 3DS4A 4UB8E 3CMAP 2QM8A 1H0TB 5APSA 1BSNA 3DS3A 2W6BA 1PP9J 3H1HD 1AVOA 2E74C 3H25A 3LRYA 3Q3DA 1MKMA 1KILA 3V2QA 5KLVG 2P7JA 1FDOA 1MUUA 4KT0J 1AQ5A 2XNDH 1SQPJ 4WY4D 2Z5IA 3HRNA 1N7SB 2IZ0A 3MUDC 4OWFA 2N98A 3V4WA 1BE3E 4TLFA 4XFJA 4K35A 2LF4A 1OR5A 1SQVE 1G1JA 3MTUE 2EHSA 2CGQA 1IK7A 2Q1KA 1NTKK 2AF8A 5KTBA 3R2PA 2O01H 4LC1A 3TYYA 1EDKA 1X9VA 4LLHA 1S5LH 1ZOYC 4DZOA 3NXSA 2PNGA 5TJHA 2E74D 1IUQA 1AA0A 1KMIZ 3HD7A 3SWYA 2A06D 1NU1K 1DNYA 1FC2C 2XNXA 4OGQB 2JWAA 3B5NC 1SQPD 3CC7P 4PD4E 1SP4A 2GDXA 2P1JA 1NTMJ 2AXTE 3L71J 3PTZA 1ZW0A 1ZRTD 4EIJA 3TGUJ 2QM7A 3SWKA 4XFYA 3TF5A 4MRTC 2E42A 5E79E 4JYBA 5AVSB 2KI7B 2KR5A 1YJNP 1SQBG 1OX3A 1U7MA 2ONTA 1PPJD 2BHVA 4DCKA 4ZMDA 1UIXA 3D70A 3B5ND 1LT1A 2RH0A 1NTMD 1IFMA 3L71D 2FVEA 4N78E 3CXHI 3IF4A 3TGUD 2WSEJ 1WMKA 3PJSK 1YITP 1HY8A 4GKGA 4PWVB 2L0QA 1QEXA 1VQ9P 1LTIC 2N9YB 4H2WC 2YKQA 2E75C 5CCHC 2Y0CA 2AXCA 2Z46A 1GXHA 4I7ZC 2WPTA 3EFFK 2H8PD 1FBMA 4IZ6A 3HD7B 1W2EA 2HFED 4M0IA 3CXHD 2N5HA 3E1IA 2KB7P 4PV1C 1NTKG 1XTCC 2JBGA 1NAYA 2KSJA 5AW9B 1YTZI 4AQRD 1JNMA 5CCGD 3N4XA 1DIPA 1RE4A 1A43A 1NU1G 2Z4EA 1BE3J 1SQVJ 1JY3P 1K9MQ 5CCHD 2KYVA 3EQ2A 2ITAA 4IL6H 3LIDA 1VF5B 1FE6A 2I1KA 2BCCG 3B8EB 2L91A 4OVNF 5GTIE 4PH1A 2IBZE 3HUSA 2FFDA 2PEMA 2FYUE 1VQ4P 4PV1D 2N1TC 2V7QJ 2O1JA 4PD4I 1KILE 4O9BA 2JEEA 3SSUA 2KOOA 2MR8A 3CCEP 1M1JC 2FYNC 1OVRA 1BE3D 1SQVD 2Z5HA 4WBAA 5DJTB 1K05A 2WSCH 1GPJA 5CMZA 3S9OA 1USDA 4JBZA 3A0BE 5KLVE 1FDIA 2KNCA 3IAOA 2FKWB 3G21A 2IDBA 1Z56A 3BCCG 3MGEA 2BEQD 2QVAA 2N1TD 1QL1A 1M6EX 4PD4D 3GF3A 2H7HA 2JU1A 2WPQA 1FZBA 1NKZB 1L0LJ 2Q7CA 1IC2A 1GZLA 1USEA 1HBWA 1CI6A 1U57A 3Q20A 1L0NG 4IFFA 1N7SC 1VHNA 2HODA 2W90A 3Q1MA 3BVHA 4GOEA 3RK3E 2L9FA 4U0CA 1LTGC 3A5TA 4U0FA 3U1AA 5APVA 2NRGA 1AVYA 1KYOH 1VQPP 4K3AA 3GJNA 3AEFC 1TU3F 1W2BO 1KB9E 2YIUC 3GHGA 3A0HE 1JUNA 3JCUH 4N78D 1EMVA 4HJGH 1JEKA 2VLOA 1YHQP 1PZQA 1EXJA 3RGUA 1KZUB 1OIPA 4COPA 3G26A 2HG5D 3GLMA 2GA1A 3DS2A 1N7SD 1SQBE 2PGDA 2IFMA 2FYZA 2YKPA 3G71P 3G0VA 1SQQG 3CCLP 3CCRP 2CK3H 2SPZA 3KYQA 1PV3A 4XFZA 1YBKA 2J59M 4EYYQ 2PY8A 5AW5B 3V5BA 2Q9IA 2OYOA 4HYTB 5KLIB 2QJYB 3VYIA 2KNCB 5F2OA 3WUTA 2Q3IA 4PXHB 1Y9BA 5APQA 1EQ7A 2IBZI 2EHTA 2JQ4A 3AEEC 2R5BA 2FYUJ 1ZMEC 3U43A 1SFCA 3TNUA 3CC4P 2EFJA 1JY3O 1KILC 4I6MC 3VP9A 1CI6B 2LL8A 2KOSA 2W6AA 2VLNA 2Q3EA 4GR2A 1KV4A 3DS0A 2LIUA
chains in the Genus database with same CATH topology
2L6EA 4XFYA 5HGLA 2QA4P 4U0CA 1K9MQ 3HZQA 4U0DA 2QEXP 4U0FA 4COCA 2XT1A 1AUMA 3CCMP 3OW2O 3H47A 2OTLP 1M1KQ 2BUOA 2OTJP 1VQPP 2M8PA 3CD6P 3G6EP 1Q7YQ 1PEOA 1YJNP 5I4TG 4U0EA 3DS4A 3CMAP 1W2BO 3RG6C 2P9XA 5HGOA 4PH1A 1KC8Q 1VQNP 3DS3A 2ONTA 2PEMA 3G29A 1VQ4P 2BHVA 3CCUP 1YJWP 3CC2P 1YHQP 3NTEA 1RO2A 2PEJA 5HGMA 3CCQP 3LRYA 2PEKA 1S72P 1VQ5P 1PEUA 2PEOA 4COPA 3G26A 3CCVP 1KD1Q 1EOQA 2OARA 3CCSP 2E1MA 4XRQA 2JO0A 1VQ8P 3DS2A 1VQOP 3CCEP 1BAJA 1QVGO 2M8NA 4XFXA 5DCKA 1YITP 2M8LA 2EIAA 3G71P 3G0VA 3CPWO 3DTJA 3CCLP 2CWOA 3CCRP 1Q86Q 1VQKP 4XFZA 1VQ9P 3G1GA 4U0AA 5F2KA 3DPHA 2BQ1E 2PY8A 1D1DA 2LF4A 3DS1A 5HGNA 1QRJA 4PH0A 3M1MA 1K30A 5F2OA 1RO0A 4GR6A 3WBHA 1E6JP 5BS1A 3H4EA 2PENA 2Z44A 2EG5A 3B5IA 1VQLP 2Z45A 3G21A 2XXMA 1PEQA 3HYBA 1VQMP 3G1IA 2Z46A 5F2NA 3CCJP 1A8OA 3I56P 1VQ6P 3MGEA 1NJIQ 1IUQA 3CXCO 1YIJP 1N8RQ 1KQSO 3CC4P 3P05A 1M6EX 2JYLA 4M0IA 1YJ9P 2EFJA 1K8AQ 2PEQA 1YI2P 3E2DA 3G28A 4WYMA 3H0DA 1M6NA 1Q81Q 2PEIA 1JJ2O 1M74A 3G4SP 3CMEP 3CC7P 1QVFO 2XV6A 3Q20A 3VRLC 3I55P 1PEMA 1M90Q 1VQ7P 4U0BA 5JPAA 1RNIA 4GR2A 1K73Q 4XROA 2JYGA 1ZMBA 1A43A 3DS0A 3DS5A 5BS2A 1Q82Q 4QNBA 2KODA 4IPYA 2DGYA 1EIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 P;  1K9M Q;  1YHQ P;  2QA4 P;  3CCQ P;  1YI2 P;  2QEX P;  1S72 P;  1VQ5 P;  1Q81 Q;  3CCV P;  1KD1 Q;  1JJ2 O;  3CCS P;  3CCM P;  3OW2 O;  3G4S P;  1VQ8 P;  1M1K Q;  3CME P;  3CC7 P;  1VQP P;  1QVF O;  3CD6 P;  2OTL P;  2OTJ P;  1VQO P;  3CCE P;  3G6E P;  1Q7Y Q;  1QVG O;  1VQL P;  1YJN P;  1YIT P;  3I55 P;  1VQM P;  3CMA P;  1M90 Q;  3G71 P;  3CCJ P;  1W2B O;  3CPW O;  3I56 P;  1VQ7 P;  1VQ6 P;  3CCL P;  3CCR P;  1Q86 Q;  1KC8 Q;  1K73 Q;  1NJI Q;  1VQN P;  1VQK P;  1Q82 Q;  1YIJ P;  3CXC O;  1VQ4 P;  1N8R Q;  1KQS O;  1VQ9 P;  3CC4 P;  3CCU P;  1YJ9 P;  1YJW P;  1K8A Q; 
#chains in the Genus database with same CATH topology
 1N73 B;  2DNW A;  5HGL A;  1NTK E;  2JJL A;  2L4B A;  3AEB C;  1NTZ G;  2J58 A;  2KSE A;  2IBZ D;  3M9B A;  2FYU D;  2IX7 C;  5GTH H;  4I2L C;  2Y9Y A;  1VL2 A;  1OFC X;  1NU1 E;  1KIL D;  2E5Y A;  2JGP A;  1SS1 A;  4DJG A;  5AVX B;  1YJW P;  2PRR A;  5AW0 B;  4YXD C;  3CC2 P;  2PP6 A;  4TT3 H;  2LML A;  4L76 A;  1KTM A;  2MJZ A;  1VQ5 P;  1PEU A;  1YQ3 C;  3RL0 g;  3CCS P;  3WU2 H;  4BRY A;  1VQ8 P;  3MIW A;  4W7Y A;  1T2K C;  1S9K E;  4H44 C;  3M0D A;  5KLV K;  1A02 F;  2KP8 A;  3G3Z A;  3RK3 C;  4AUW A;  5KLV D;  2LKM A;  1GK6 A;  1AFO A;  1KQF B;  3L75 G;  1IFD A;  1GL2 C;  1VPC A;  2KLV A;  1E5W A;  1KB9 I;  1S5L E;  3II6 A;  4U3F J;  1NOH A;  5KAI H;  1YTZ T;  2WSS H;  4DG9 A;  4GOD A;  4XA4 A;  1BCC G;  3OJA B;  4WYM A;  1T2K D;  1HVV A;  3D6Y A;  3G4S P;  7CEI A;  4H44 D;  1QVF O;  1SQB J;  1OW6 A;  3M9H A;  3RK3 D;  1GMJ A;  2Y9Z A;  3EJD A;  3OAK A;  3LW5 J;  4XRO A;  2CG5 B;  4D6T E;  4QNB A;  3L73 J;  4IL6 X;  4PJ0 H;  1VF5 D;  2WZ7 A;  1KB9 D;  1EZV G;  1M56 D;  3H1H J;  1T3J A;  2VLQ A;  2KLU A;  3Q5S A;  2WPV B;  4F37 A;  1FZC B;  2C0W A;  1R8E A;  1LT9 B;  4IFD K;  2KGA A;  4H13 B;  4EDF A;  4UB6 H;  4NEO A;  1SQB D;  1S72 P;  3F5H A;  5B66 H;  1BAJ A;  3EWK A;  3PLN A;  2WSF J;  1RE4 C;  2EIA A;  3CPW O;  2YO2 A;  2X2B A;  2ZYD A;  1HH0 A;  2KOP A;  1OWA A;  1OW7 A;  1NTK J;  1PFI A;  2XZ1 C;  1ZNV A;  1QGK B;  3AE7 C;  3HE4 A;  1JY2 N;  1VQL P;  3HUS C;  2FFD C;  4RJT A;  3G1I A;  1SQQ E;  3O8Z A;  1A8O A;  1NU1 J;  2GZI A;  3P05 A;  2JYL A;  1Q2N A;  4KJM A;  5APX A;  3L70 E;  1RF0 A;  1JCD A;  2K88 A;  2KG6 A;  1NTK D;  1A02 J;  2MF4 A;  4WWI A;  3L72 G;  5KLI C;  4HKG A;  2IFN A;  2Q6Q A;  2K0X A;  1NH4 A;  4IL6 E;  2R44 A;  1NU1 D;  2OTJ P;  1GXG A;  1Q7Y Q;  3H1J G;  5AW1 B;  1FU1 A;  2D2C B;  2IYO A;  2GDW A;  1RF1 A;  1LWU A;  3RG6 C;  3L36 A;  2K9J A;  4Y99 C;  4RO0 A;  1UII A;  5CBN A;  1DD3 A;  2JKV A;  1OW8 A;  3KPE A;  1NTZ E;  1S9K D;  5CZD B;  3Q5P A;  1J1E B;  2PEO A;  1S1C X;  1EOQ A;  1Y8A A;  2KGC A;  1D7M A;  1PGJ A;  1L0I A;  2GM4 A;  3H1K G;  4IFM A;  1HGV A;  3MZW B;  5CBO A;  1R5L A;  3GG2 A;  2J5U A;  4D6T J;  3K5B A;  4RES B;  2K9Y A;  4GT1 A;  3VOP A;  2N5I A;  3A2A A;  2BQ1 E;  5C39 A;  5HGN A;  2FAC A;  3H1L E;  1GU5 A;  1EDJ A;  3HE4 B;  1BGY G;  3GHG C;  2ZT9 B;  3BAT A;  2EG5 A;  2MY5 A;  3SFD C;  2KZI A;  1VQM P;  3CCJ P;  3CE7 A;  3V2P A;  2OYH B;  2YXR B;  3CI9 A;  1KQS O;  3M0A A;  5CCG C;  1YJ9 P;  3WUU A;  5TIS H;  3H1I G;  4R4M A;  1MFT A;  1Q81 Q;  1IZN B;  3C9I A;  3FWL A;  3L37 A;  4D6T D;  2ERH A;  1IFP A;  2K93 A;  4NPE A;  1VQ7 P;  3USS A;  5JPA A;  1L0N K;  2G8Y A;  1EDL A;  1ZMB A;  4EI2 A;  3LIE A;  1L4A A;  2YXQ B;  3AEG C;  3PP5 A;  1WRG A;  1FZG A;  1L0H A;  3H47 A;  1KYO E;  2M8P A;  5EW5 E;  2UWJ E;  3B71 A;  1LP1 B;  4JPZ B;  1RF1 B;  1LWU B;  1SFC C;  2K9J B;  3IN6 A;  1ZR2 A;  4UHP B;  4NPD A;  2N6Y A;  3VMA A;  3U59 A;  3F89 A;  3JCU E;  1N2D C;  1PP9 G;  2LXB A;  3L70 J;  2L22 A;  3CCQ P;  2N9B A;  3PRJ A;  3PH0 A;  1KD1 Q;  3CLQ A;  1KN7 A;  1BDC A;  1VQO P;  1FZE A;  2QJK C;  3VTP C;  4KHX A;  4W7Z A;  1JTH A;  2GZF A;  3E7K A;  2OGU A;  1AV1 A;  1MFZ A;  2OYI C;  1VDF A;  1Q90 D;  1SQX K;  1SQQ K;  3WUV A;  2W83 C;  1IMP A;  4ASV A;  2ZYG A;  2JU2 A;  2V7Q H;  1SQQ D;  2N50 A;  3B4Q A;  1RO0 A;  1FOS F;  1SFC D;  2PEN A;  1NO4 A;  1FOS E;  3VMZ A;  2QSI A;  2VRS A;  3L70 D;  2ZXX A;  1NJI Q;  2XU6 A;  3IFM A;  3HE5 A;  1NTZ J;  2C0X A;  2E5T A;  3TK1 A;  3V6I A;  2B87 B;  3E2D A;  3AE2 C;  5EJD A;  1R5S A;  3G28 A;  5E79 H;  2O1K A;  2KOG A;  1FR2 A;  3CME P;  5AVW B;  1G1I A;  1JMM A;  5KKZ B;  1PL5 A;  1PEM A;  1N7L A;  3M91 A;  1NTM G;  2JYG A;  3JC2 2;  3D71 A;  1L4A B;  3H1L J;  1OZH A;  3HZQ A;  3OW2 O;  3L74 G;  1RQU A;  3CD6 P;  1NTZ K;  4I1L A;  3G6E P;  1LTJ B;  3BAS A;  3NTN A;  5I4T G;  1RE3 A;  1XTG B;  2HPC B;  1NTZ D;  2P9X A;  1DV5 A;  4U7J A;  4BPH A;  4BPG A;  1P84 H;  1S2E A;  5AVR B;  1LTA C;  1FZA A;  1JY2 P;  1EC5 A;  1OXZ A;  3CCU P;  1KFM A;  1KOR A;  4WY4 B;  2O01 N;  5AVT B;  3RBZ A;  1N73 A;  3P7K A;  1OMI A;  2ROQ A;  1ACP A;  2FXP A;  2POH A;  4JQ0 D;  3QH9 A;  1JTH B;  2JO1 A;  1OVV A;  3H1L D;  1L2P A;  3B4S A;  2CQ8 A;  3G1G A;  4C46 A;  5BVZ A;  4LGD E;  4OGQ C;  4DT0 A;  1HQB A;  2E74 B;  4WVZ A;  2N6Z A;  1KYO I;  3G9R A;  4CA3 A;  1DEE G;  4AYC A;  2A45 H;  2D2C C;  3H1K E;  2KG8 A;  1PEQ A;  1T3U A;  1SQX G;  2LKI A;  5KAI E;  3P32 A;  1YIJ P;  3HE5 B;  1EZV I;  3MGN A;  2V4H A;  3BRT B;  3W68 A;  3H0D A;  1BGY E;  3EJB A;  4BXL A;  1S5L X;  1JO5 A;  3OA7 A;  5AW2 B;  2K1A A;  4NPF X;  3MD0 A;  3GKL C;  2H89 C;  1Q82 Q;  3DS5 A;  3SWF A;  2KOD A;  4OGQ D;  3H1I E;  1KYO D;  4HKZ H;  2PFX A;  2L6E A;  2D2C D;  3PHL A;  3ZDM A;  2OTL P;  1M1K Q;  1M7L A;  3B5N B;  3M9Q A;  1IFN A;  5KJ7 A;  2FAD A;  4R4L A;  2FXM A;  3TSI A;  3KHU A;  2PAJ A;  4UB6 E;  5H2F H;  3A0B H;  5KLV J;  4XRQ A;  2P10 A;  5B66 E;  1ZXG A;  2C9L Y;  1QVG O;  1Y47 A;  1FZC A;  2CPS A;  3HD7 C;  1LT9 A;  1LTS C;  1HJB A;  3NFQ A;  1PP9 E;  4U0A A;  3C8V A;  1BDD A;  2ZVO B;  2FQ2 A;  1RF1 C;  3H4E A;  3CX5 H;  2BCC E;  1HWT C;  2FQ0 A;  5K5G B;  5F2N A;  1VQ6 P;  3Q5R A;  3AE1 C;  1QL2 A;  5DJU B;  1GK4 A;  4C7N B;  3HTK B;  2K2Q A;  3NY7 B;  1K8A Q;  1G2C A;  2B89 A;  1QX8 A;  1CZQ A;  1NHL A;  2AEJ A;  1L0L G;  1IFI A;  1VF5 C;  2E75 B;  4HB1 A;  2XV6 A;  3AEC C;  3HD7 D;  2VLP A;  3I55 P;  4R0M A;  3KZI H;  1M90 Q;  2KIK A;  5HV8 A;  3H32 A;  1RNI A;  4I7Z B;  3RK2 B;  2WT7 B;  2K0Y A;  2R3C A;  2ZVN B;  1JY2 O;  5AW7 B;  3VMY A;  3VN0 A;  5L8R J;  2B9B A;  2B88 A;  2WPR A;  1FJK A;  3H1K J;  4MN4 C;  2DW3 A;  2BUO A;  1MZ8 A;  4L74 A;  2RMZ A;  3CWB G;  2IPP A;  2QJP B;  4U0E A;  2WIT A;  3BCC E;  1RHZ B;  2M5A B;  3VMX A;  2ZAE B;  3EJE A;  4M3L A;  2KWL A;  3LW5 H;  3G29 A;  5KP6 B;  2JP3 A;  2FAE A;  4ZNC A;  1LTB C;  3R4Y A;  3MHV A;  1CW5 A;  3NTE A;  1J1D B;  2PEJ A;  3UIA A;  3SFE C;  2XV5 A;  2XDJ A;  3L74 E;  4Z1M H;  4C7R A;  2E1M A;  5KKZ C;  1L0N E;  3WMM 0;  2A45 G;  2KZJ A;  2M8N A;  1NKN A;  2ZYA A;  1Q86 Q;  1N86 A;  2K37 A;  3H1I J;  5KAF H;  3FXE A;  1L4A C;  2VSQ A;  1E79 H;  3H1K D;  3T97 A;  1H88 A;  2KS1 B;  2WMM A;  5KP8 B;  4PH0 A;  2N1T B;  4GR6 A;  2WQY C;  3N7N A;  2LR2 A;  1K04 A;  1M1J B;  2FYN B;  3I56 P;  2FY8 A;  5APW A;  1FS0 E;  1BGY D;  1GD2 E;  3GZL A;  3CXC O;  1N8R Q;  1G2C B;  5TIS E;  2YNY A;  2AEF A;  2AFE A;  1YI2 P;  2H88 C;  1URQ A;  2NO8 A;  1JJ2 O;  1M74 A;  2CPB A;  2AVA A;  2QIW A;  3H1I D;  2YO3 A;  3H32 B;  2HLO A;  1SQX E;  2FQ1 A;  1L4A D;  2AFD A;  1RY3 A;  2OYH A;  4IPY A;  1CEI A;  2XZ0 D;  1CSB A;  1KQG B;  2BCC J;  3FWN A;  1LNQ A;  2M0B A;  1PEO A;  4YPC A;  3RL0 B;  3AE4 C;  3FXD A;  2XKM A;  3GW6 A;  1F80 D;  5HGO A;  1M57 D;  1KC8 Q;  3LMO A;  1NWQ A;  4IOI H;  2QJY C;  1NAF A;  2Y0D A;  1PP9 D;  2O01 J;  5AW3 B;  5DCK A;  1LP1 A;  2JR8 A;  2JDI H;  1NGM B;  2YIU B;  1VQK P;  2NZ2 A;  1BSH A;  4N6J A;  1FDM A;  3T97 B;  2BCC D;  1SQP K;  3DS1 A;  1RE3 C;  1X22 A;  1E6J P;  3W67 A;  1ZV8 A;  4ZKP A;  1JB0 J;  2FXO A;  1VKU A;  1MZ9 A;  3BCC J;  3O6Q A;  3JSV C;  3RG2 A;  1AQT A;  2C9N Y;  4U3F G;  1N73 C;  4W80 A;  2ZFC A;  5B5E H;  1JM0 A;  1URQ B;  1LJ2 A;  3L74 J;  1L0N J;  3A7O A;  1LGH B;  2G3A A;  2E76 B;  3CXH H;  1GL2 A;  2WSE H;  3CL3 D;  3P8C E;  1S4X A;  5CJ4 A;  1HJ0 A;  3E1R A;  5AVV B;  2I1J A;  1NTM K;  1DEB A;  2YKO A;  2L5G B;  3L73 G;  1T8K A;  2QE7 H;  1KIL B;  3L75 E;  3BCC D;  1T6A A;  2B87 A;  1L0L E;  3GF7 A;  4JYC A;  3H1H G;  2KGE A;  4JF7 A;  5BU5 A;  4UB8 H;  3L74 D;  1VQN P;  1P84 E;  2NPS A;  2JWD A;  4YXW H;  2WPS A;  3AE6 C;  1L0N D;  1BCC E;  2PEK A;  2FBW C;  3AED C;  2JO0 A;  3CWB E;  3GMA A;  1AF8 A;  2YMY A;  2GYK A;  3V2R A;  1SQX J;  1AJY A;  1SQQ J;  1LTJ A;  3RK2 C;  3DTJ A;  1HUC A;  2HPC A;  1DX7 A;  1M8O B;  3V2N A;  2KGD A;  2KXP B;  1D1D A;  1J2J B;  1IO4 A;  1ZP0 C;  4WY4 A;  1EZV E;  1K30 A;  5KJ7 C;  4GDO A;  2QJP C;  2FVA A;  5APY A;  2Z45 A;  3O6Q B;  2A06 G;  1Z6M A;  2CNR A;  2QNW A;  3HYB A;  3L4F A;  1IJD B;  4H44 B;  4H0L B;  1SQP G;  1J1D C;  3RK3 B;  2E75 D;  2PEQ A;  5AVZ B;  2KOQ A;  1SQX D;  5KP7 B;  5AW4 B;  2GUV A;  1FZC C;  2XZR A;  4PD4 H;  1GL2 B;  4CPG A;  3RK2 D;  1LT9 C;  2AXT H;  1FZF A;  2GDY A;  2LXC B;  2E43 A;  2QG4 A;  4H13 C;  2K92 A;  5BS2 A;  1H8A A;  5AVU B;  2QA4 P;  5EFW B;  5KJ7 D;  3MUD A;  4COC A;  2GUS A;  1AUM A;  5BU8 B;  1GW4 A;  3M0D C;  1SQV K;  1PPJ G;  2K3R A;  1NVO A;  3D6Z A;  1FAV A;  2NPS B;  3L71 G;  2WSC J;  1LTT C;  5AVY B;  2MR7 A;  5CJ0 A;  1IK9 A;  3TGU G;  4H2X C;  2LPK A;  5H2F E;  4GOF A;  2IYP A;  4EOT A;  2MVV A;  1ZLL A;  2FVF A;  3MP7 B;  1UJZ A;  5GTH E;  4XFX A;  2R5D A;  3B5N A;  1SVF A;  4H13 D;  4B86 A;  1DD4 A;  2MKV A;  2LOL A;  1IMQ A;  3KDP B;  4D6T G;  5AW6 B;  3L72 E;  3L75 J;  4Y28 J;  2O3J A;  3TDK A;  2MVU A;  3WU2 E;  3RL0 C;  2Z44 A;  1PGO A;  3CX5 E;  3H1J E;  2M3B A;  2XXM A;  1U7J A;  2WTY A;  1P84 I;  2GZJ A;  3VP8 A;  1W5C E;  2FHS C;  1BCC J;  1QLE D;  3P8C D;  1M6N A;  2PEI A;  3CWB J;  2KG9 A;  4N3Y B;  1BXI A;  1RH5 B;  3VRL C;  1L0L K;  3KZI E;  5APT A;  3HUS B;  2FFD B;  4GIF A;  3L75 D;  1L0L D;  4U3F E;  5AW8 B;  2KOR A;  2W8Z A;  1EIA A;  4C7N A;  3BRV B;  3HTK A;  1J1E C;  1YYC A;  4U0D A;  2QEX P;  5CCG A;  2R32 A;  3Q2Y A;  1JOC A;  3RL0 D;  2R3S A;  2A45 I;  1X0T A;  1HF9 A;  1FJP A;  1P84 D;  3ABV C;  3ITK A;  4QKO A;  1MV8 A;  4L73 A;  5CCH A;  1BCC D;  2JB0 A;  5GTI H;  3V4Q A;  2JAZ A;  1URQ C;  3CWB D;  3L73 E;  2WT7 A;  2I8D A;  1RO2 A;  1BE3 G;  4BWN A;  4PJ0 E;  1SQV G;  2HR3 A;  3L70 G;  2E76 C;  2OAR A;  3C1L A;  2M3E A;  3EFG A;  3H1H E;  2ZT9 C;  3GZM A;  1UNK A;  1EXI A;  1NYH A;  3AEA C;  3RBX A;  2OYH C;  1X79 B;  2CWO A;  3P8M C;  1IFJ A;  1EZV D;  2M5A A;  3KXD A;  2ZJS E;  3I5C A;  5KAF E;  4WB4 A;  2ZXE B;  4Y99 B;  3DPH A;  1RF0 C;  1E0H A;  2BEZ F;  4H2Y C;  3FGA D;  1QRJ A;  1X3O A;  2MD9 A;  1HGZ A;  3WBH A;  1NQ4 A;  5BS1 A;  1KLP A;  3M06 A;  1GU4 A;  2HOD B;  1ZR4 A;  4QMA A;  3IR9 A;  1URQ D;  4ASW A;  2HYN A;  2OTK E;  1T8Z A;  1RQV A;  3U1C A;  3S1K A;  2OYI A;  2E76 D;  1X8Y A;  1GDT A;  4RKU J;  2ZT9 D;  2LTE A;  2FYU K;  3S4R A;  4L75 A;  1HTL C;  2KS1 A;  2N1T A;  2GZG A;  2A06 E;  1LWU C;  2P58 A;  5CHX A;  2M8R A;  3GHG B;  5AVQ B;  2WVR A;  4DOJ A;  1GW3 A;  3FX0 A;  2Q5U A;  1M1J A;  1SQP E;  1PGP A;  1KFN A;  3L72 J;  3A3Y B;  1ZRT E;  2P67 A;  2K0D X;  2XT1 A;  3H1L G;  1S3J A;  2K5X A;  2Y0E A;  3CX5 I;  3H1J J;  3AE5 C;  2KK7 A;  4H0L C;  2AEM A;  1DH3 A;  1KB9 H;  1GTW A;  2QRX A;  1H0T A;  3A0H H;  3AE9 C;  1EDI A;  2RKL A;  4ZKU A;  1YQ4 C;  1PGQ A;  5APU A;  2KW2 A;  5HGM A;  3CCV P;  2H43 A;  1WT6 A;  1PPJ E;  4PV1 B;  1SLQ A;  3H6P A;  1JMB A;  2M5R A;  1JY3 N;  3L72 D;  2M8L A;  1NTM E;  1H89 A;  3L71 E;  1SFC B;  3TNU B;  4XE5 B;  3TGU E;  1JCC A;  1N7S A;  4YTP C;  5F2K A;  3CX5 D;  3H1J D;  2YMK A;  2W6J H;  1KQL A;  1BGY J;  3M1M A;  2WWW A;  4HH2 A;  4H0L D;  2LIW A;  3AE8 C;  3B5I A;  2NPS C;  3QWO C;  2QJK B;  5M1B A;  2IZ1 A;  2W27 A;  1ZN5 A;  2P2U A;  2K94 A;  2OYI B;  1AYI A;  5B5E E;  1GL2 D;  4BPF A;  3L35 A;  1LTJ C;  4U3F D;  3CXH E;  2RN0 A;  2WSF H;  1OVU A;  4U0B A;  4A7P A;  1SQB K;  2GZE A;  1K73 Q;  3KQG A;  2IBZ G;  4WY4 C;  2DGY A;  2FYU G;  2BAS A;  3NMD A;  4BRY B;  1PIX A;  2KUB A;  3CCM P;  5HVC A;  3AE3 C;  2OQQ A;  2NPS D;  4OH8 B;  3L73 D;  3DS4 A;  4UB8 E;  3CMA P;  2QM8 A;  1H0T B;  5APS A;  1BSN A;  3DS3 A;  2W6B A;  1PP9 J;  3H1H D;  1AVO A;  2E74 C;  3H25 A;  3LRY A;  3Q3D A;  1MKM A;  1KIL A;  3V2Q A;  5KLV G;  2P7J A;  1FDO A;  1MUU A;  4KT0 J;  1AQ5 A;  2XND H;  1SQP J;  4WY4 D;  2Z5I A;  3HRN A;  1N7S B;  2IZ0 A;  3MUD C;  4OWF A;  2N98 A;  3V4W A;  1BE3 E;  4TLF A;  4XFJ A;  4K35 A;  2LF4 A;  1OR5 A;  1SQV E;  1G1J A;  3MTU E;  2EHS A;  2CGQ A;  1IK7 A;  2Q1K A;  1NTK K;  2AF8 A;  5KTB A;  3R2P A;  2O01 H;  4LC1 A;  3TYY A;  1EDK A;  1X9V A;  4LLH A;  1S5L H;  1ZOY C;  4DZO A;  3NXS A;  2PNG A;  5TJH A;  2E74 D;  1IUQ A;  1AA0 A;  1KMI Z;  3HD7 A;  3SWY A;  2A06 D;  1NU1 K;  1DNY A;  1FC2 C;  2XNX A;  4OGQ B;  2JWA A;  3B5N C;  1SQP D;  3CC7 P;  4PD4 E;  1SP4 A;  2GDX A;  2P1J A;  1NTM J;  2AXT E;  3L71 J;  3PTZ A;  1ZW0 A;  1ZRT D;  4EIJ A;  3TGU J;  2QM7 A;  3SWK A;  4XFY A;  3TF5 A;  4MRT C;  2E42 A;  5E79 E;  4JYB A;  5AVS B;  2KI7 B;  2KR5 A;  1YJN P;  1SQB G;  1OX3 A;  1U7M A;  2ONT A;  1PPJ D;  2BHV A;  4DCK A;  4ZMD A;  1UIX A;  3D70 A;  3B5N D;  1LT1 A;  2RH0 A;  1NTM D;  1IFM A;  3L71 D;  2FVE A;  4N78 E;  3CXH I;  3IF4 A;  3TGU D;  2WSE J;  1WMK A;  3PJS K;  1YIT P;  1HY8 A;  4GKG A;  4PWV B;  2L0Q A;  1QEX A;  1VQ9 P;  1LTI C;  2N9Y B;  4H2W C;  2YKQ A;  2E75 C;  5CCH C;  2Y0C A;  2AXC A;  2Z46 A;  1GXH A;  4I7Z C;  2WPT A;  3EFF K;  2H8P D;  1FBM A;  4IZ6 A;  3HD7 B;  1W2E A;  2HFE D;  4M0I A;  3CXH D;  2N5H A;  3E1I A;  2KB7 P;  4PV1 C;  1NTK G;  1XTC C;  2JBG A;  1NAY A;  2KSJ A;  5AW9 B;  1YTZ I;  4AQR D;  1JNM A;  5CCG D;  3N4X A;  1DIP A;  1RE4 A;  1A43 A;  1NU1 G;  2Z4E A;  1BE3 J;  1SQV J;  1JY3 P;  1K9M Q;  5CCH D;  2KYV A;  3EQ2 A;  2ITA A;  4IL6 H;  3LID A;  1VF5 B;  1FE6 A;  2I1K A;  2BCC G;  3B8E B;  2L91 A;  4OVN F;  5GTI E;  4PH1 A;  2IBZ E;  3HUS A;  2FFD A;  2PEM A;  2FYU E;  1VQ4 P;  4PV1 D;  2N1T C;  2V7Q J;  2O1J A;  4PD4 I;  1KIL E;  4O9B A;  2JEE A;  3SSU A;  2KOO A;  2MR8 A;  3CCE P;  1M1J C;  2FYN C;  1OVR A;  1BE3 D;  1SQV D;  2Z5H A;  4WBA A;  5DJT B;  1K05 A;  2WSC H;  1GPJ A;  5CMZ A;  3S9O A;  1USD A;  4JBZ A;  3A0B E;  5KLV E;  1FDI A;  2KNC A;  3IAO A;  2FKW B;  3G21 A;  2IDB A;  1Z56 A;  3BCC G;  3MGE A;  2BEQ D;  2QVA A;  2N1T D;  1QL1 A;  1M6E X;  4PD4 D;  3GF3 A;  2H7H A;  2JU1 A;  2WPQ A;  1FZB A;  1NKZ B;  1L0L J;  2Q7C A;  1IC2 A;  1GZL A;  1USE A;  1HBW A;  1CI6 A;  1U57 A;  3Q20 A;  1L0N G;  4IFF A;  1N7S C;  1VHN A;  2HOD A;  2W90 A;  3Q1M A;  3BVH A;  4GOE A;  3RK3 E;  2L9F A;  4U0C A;  1LTG C;  3A5T A;  4U0F A;  3U1A A;  5APV A;  2NRG A;  1AVY A;  1KYO H;  1VQP P;  4K3A A;  3GJN A;  3AEF C;  1TU3 F;  1W2B O;  1KB9 E;  2YIU C;  3GHG A;  3A0H E;  1JUN A;  3JCU H;  4N78 D;  1EMV A;  4HJG H;  1JEK A;  2VLO A;  1YHQ P;  1PZQ A;  1EXJ A;  3RGU A;  1KZU B;  1OIP A;  4COP A;  3G26 A;  2HG5 D;  3GLM A;  2GA1 A;  3DS2 A;  1N7S D;  1SQB E;  2PGD A;  2IFM A;  2FYZ A;  2YKP A;  3G71 P;  3G0V A;  1SQQ G;  3CCL P;  3CCR P;  2CK3 H;  2SPZ A;  3KYQ A;  1PV3 A;  4XFZ A;  1YBK A;  2J59 M;  4EYY Q;  2PY8 A;  5AW5 B;  3V5B A;  2Q9I A;  2OYO A;  4HYT B;  5KLI B;  2QJY B;  3VYI A;  2KNC B;  5F2O A;  3WUT A;  2Q3I A;  4PXH B;  1Y9B A;  5APQ A;  1EQ7 A;  2IBZ I;  2EHT A;  2JQ4 A;  3AEE C;  2R5B A;  2FYU J;  1ZME C;  3U43 A;  1SFC A;  3TNU A;  3CC4 P;  2EFJ A;  1JY3 O;  1KIL C;  4I6M C;  3VP9 A;  1CI6 B;  2LL8 A;  2KOS A;  2W6A A;  2VLN A;  2Q3E A;  4GR2 A;  1KV4 A;  3DS0 A;  2LIU A; 
#chains in the Genus database with same CATH homology
 2L6E A;  4XFY A;  5HGL A;  2QA4 P;  4U0C A;  1K9M Q;  3HZQ A;  4U0D A;  2QEX P;  4U0F A;  4COC A;  2XT1 A;  1AUM A;  3CCM P;  3OW2 O;  3H47 A;  2OTL P;  1M1K Q;  2BUO A;  2OTJ P;  1VQP P;  2M8P A;  3CD6 P;  3G6E P;  1Q7Y Q;  1PEO A;  1YJN P;  5I4T G;  4U0E A;  3DS4 A;  3CMA P;  1W2B O;  3RG6 C;  2P9X A;  5HGO A;  4PH1 A;  1KC8 Q;  1VQN P;  3DS3 A;  2ONT A;  2PEM A;  3G29 A;  1VQ4 P;  2BHV A;  3CCU P;  1YJW P;  3CC2 P;  1YHQ P;  3NTE A;  1RO2 A;  2PEJ A;  5HGM A;  3CCQ P;  3LRY A;  2PEK A;  1S72 P;  1VQ5 P;  1PEU A;  2PEO A;  4COP A;  3G26 A;  3CCV P;  1KD1 Q;  1EOQ A;  2OAR A;  3CCS P;  2E1M A;  4XRQ A;  2JO0 A;  1VQ8 P;  3DS2 A;  1VQO P;  3CCE P;  1BAJ A;  1QVG O;  2M8N A;  4XFX A;  5DCK A;  1YIT P;  2M8L A;  2EIA A;  3G71 P;  3G0V A;  3CPW O;  3DTJ A;  3CCL P;  2CWO A;  3CCR P;  1Q86 Q;  1VQK P;  4XFZ A;  1VQ9 P;  3G1G A;  4U0A A;  5F2K A;  3DPH A;  2BQ1 E;  2PY8 A;  1D1D A;  2LF4 A;  3DS1 A;  5HGN A;  1QRJ A;  4PH0 A;  3M1M A;  1K30 A;  5F2O A;  1RO0 A;  4GR6 A;  3WBH A;  1E6J P;  5BS1 A;  3H4E A;  2PEN A;  2Z44 A;  2EG5 A;  3B5I A;  1VQL P;  2Z45 A;  3G21 A;  2XXM A;  1PEQ A;  3HYB A;  1VQM P;  3G1I A;  2Z46 A;  5F2N A;  3CCJ P;  1A8O A;  3I56 P;  1VQ6 P;  3MGE A;  1NJI Q;  1IUQ A;  3CXC O;  1YIJ P;  1N8R Q;  1KQS O;  3CC4 P;  3P05 A;  1M6E X;  2JYL A;  4M0I A;  1YJ9 P;  2EFJ A;  1K8A Q;  2PEQ A;  1YI2 P;  3E2D A;  3G28 A;  4WYM A;  3H0D A;  1M6N A;  1Q81 Q;  2PEI A;  1JJ2 O;  1M74 A;  3G4S P;  3CME P;  3CC7 P;  1QVF O;  2XV6 A;  3Q20 A;  3VRL C;  3I55 P;  1PEM A;  1M90 Q;  1VQ7 P;  4U0B A;  5JPA A;  1RNI A;  4GR2 A;  1K73 Q;  4XRO A;  2JYG A;  1ZMB A;  1A43 A;  3DS0 A;  3DS5 A;  5BS2 A;  1Q82 Q;  4QNB A;  2KOD A;  4IPY A;  2DGY A;  1EIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...