2L4BA

Solution structure of a putative acyl carrier protein from anaplasma phagocytophilum. seattle structural genomics center for infectious disease target anpha.01018.a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
88
Chain Sequence
PGSMVSEEIKAQVMESVIGCLKLNDEQKQILSGTTNLAKDFNLDSLDFVDLIMSLEERFSLEISDEDAQKLETVDDICRYIASKSSDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a putative acyl carrier protein from Anaplasma phagocytophilum. Seattle Structural Genomics Center for Infectious Disease target AnphA.01018.a
rcsb
source organism Anaplasma phagocytophilum
molecule tags Transferase
molecule keywords Acyl carrier protein
total genus 21
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2l4bA00
2KGEA 1HQBA 4BPGA 2KG8A 1DV5A 2MY5A 1T8KA 2FHSC 2XZ0D 2FADA 2K0XA 3CE7A 3GZLA 2KG9A 2FQ2A 2LIUA 2MD9A 1HY8A 2L22A 2XZ1C 1OR5A 4MRTC 2X2BA 4BPFA 4HKGA 2KOQA 5KP8B 1L0IA 2DNWA 2FAEA 2K92A 4DG9A 3GZMA 2K0YA 2K94A 1VKUA 2LTEA 2N5IA 4PXHB 2MF4A 3NY7B 5EJDA 2AVAA 5HV8A 2CNRA 3RG2A 2EHSA 5KP7B 2N6ZA 1X3OA 2LIWA 4H2WC 2M5RA 2KOOA 2KR5A 2LMLA 2QNWA 2KOSA 2MVUA 5KP6B 1NQ4A 3EJBA 1DNYA 5HVCA 4H2YC 1L0HA 2KW2A 2GDYA 3LMOA 2K93A 2EHTA 4PWVB 2K2QA 4IZ6A 4BPHA 5CZDB 2AFDA 2CQ8A 4CA3A 2KGCA 2VSQA 2KOPA 3EJDA 2PNGA 2FQ0A 2ROQA 2JU2A 2JQ4A 2LL8A 2LOLA 2N6YA 2L9FA 1F80D 2CG5B 2N50A 2L4BA 2FVEA 2CGQA 2KORA 2N5HA 2KGDA 1KLPA 2LKIA 2AF8A 2GDWA 2N98A 2FQ1A 2MR7A 2JU1A 2FVFA 1ACPA 2KGAA 2AFEA 2KG6A 2FVAA 4H2XC 2KWLA 2MR8A 4NEOA 2GDXA 3EJEA 2FACA 2MVVA 2L0QA 2LPKA 4R0MA 1AF8A 2JGPA
chains in the Genus database with same CATH superfamily
2KGEA 2K5XA 2XT1A 1DV5A 2BHVA 3GZLA 1AUMA 4XRQA 2XV6A 1KC8Q 1VQMP 2L22A 2XZ1C 2X2BA 2M8LA 1UNKA 1Q81Q 3H4EA 2FAEA 2JYGA 1M90Q 1K30A 2GZEA 4IPYA 2MF4A 3CCUP 2CNRA 2EHSA 2OARA 1VQPP 2N6ZA 1X3OA 4XFYA 2M5RA 2EG5A 1FR2A 2QNWA 3Q20A 3DS1A 5KP6B 4M0IA 1NQ4A 3E2DA 1A8OA 2KW2A 1EMVA 3LMOA 4U0EA 2PEMA 4IZ6A 4BPHA 2AFDA 1YIJP 4WYMA 2VSQA 1M6NA 1IMPA 2JQ4A 3CXCO 2LOLA 2L9FA 1F80D 1QVGO 2M8NA 2L4BA 2GZGA 2Z44A 2K0DX 3CC2P 1AYIA 1BXIA 1W2BO 2AF8A 2GDWA 3CCRP 2N98A 2FQ1A 3LRYA 4XROA 3CD6P 2FVAA 5F2KA 3EJEA 2MVVA 4R0MA 1AF8A 3CCEP 5BS2A 1BAJA 2L6EA 2GZIA 1CEIA 4BPGA 3DS5A 3CCVP 1T8KA 1YJWP 1M6EX 2XZ0D 3G4SP 3CE7A 3H47A 2ERHA 2FQ2A 1K9MQ 1N8RQ 1OR5A 4BPFA 2K92A 4GR6A 1VKUA 2PEJA 3CC7P 2LTEA 1VQ7P 2AVAA 3RG2A 2GYKA 5KP7B 1M74A 4QKOA 3CCMP 3I56P 2QA4P 3WBHA 5HGMA 2WPTA 2KODA 3G1IA 2GZJA 2MVUA 5I4TG 2NO8A 5HVCA 1GXGA 2K93A 3VRLC 2K2QA 1VQ4P 2DGYA 4U0CA 3H0DA 4CA3A 2KOPA 3G21A 2FQ0A 4U0BA 4U0FA 2CGQA 2P9XA 2KORA 2N5HA 4COCA 3CCLP 2MR7A 2JU1A 2FVFA 1ACPA 1JJ2O 2KG6A 2PEKA 4NEOA 1GPJA 5DCKA 1Q86Q 1D1DA 1QVFO 3B4QA 4COPA 3DS4A 1HQBA 2JO0A 3U43A 1VHNA 3DS3A 2KG8A 1E6JP 1YJ9P 1K8AQ 3GKLC 2FHSC 2VLNA 5F2OA 2K0XA 3HYBA 2PENA 5F2NA 2LIUA 2PEOA 1RNIA 1Q82Q 1ZMBA 5HGLA 1MZ8A 1VQNP 4HKGA 2VLQA 5KP8B 2DNWA 2GZFA 2K94A 2JBGA 3G0VA 4PXHB 3NY7B 2EIAA 5HV8A 3CMEP 1VQKP 1VQ9P 1YITP 3DTJA 1VQLP 4H2WC 2JB0A 2ONTA 2LMLA 2CWOA 1DNYA 4H2YC 1L0HA 2EFJA 3NTEA 2PNGA 2JU2A 1Q7YQ 2LL8A 5HGNA 2OTLP 1NJIQ 2QEXP 3G71P 2CG5B 1QRJA 1IMQA 3GJNA 2FVEA 2PY8A 4U0AA 3CCQP 1Z6MA 1KLPA 2PEIA 1M1KQ 2E1MA 1VQ6P 4H2XC 2KWLA 3B5IA 5BS1A 3G28A 2MR8A 2GDXA 1VQOP 2FACA 2LF4A 3G1GA 2JYLA 2JGPA 4PH1A 1GXHA 2M8PA 2MY5A 1YHQP 2FADA 1KD1Q 1KQSO 2KG9A 2OTJP 2MD9A 3OW2O 1YI2P 3CC4P 1HY8A 4MRTC 2BUOA 1EOQA 2PEQA 2KOQA 1L0IA 4XFXA 4DG9A 3GZMA 2K0YA 1EIAA 3MGEA 2JAZA 3G29A 3CMAP 1S72P 1VQ5P 2N5IA 1YJNP 1ZNVA 4GR2A 5EJDA 1RO2A 4UHPB 3G6EP 1UJZA 1E0HA 2LIWA 4XFZA 4PH0A 3HZQA 2VLOA 2KOOA 2KR5A 1A43A 2KOSA 4F37A 1K73Q 3EJBA 2GDYA 2EHTA 3CCJP 3P05A 2Z45A 4U0DA 4PWVB 1VQ8P 1RO0A 5CZDB 3DS2A 2CQ8A 5HGOA 5EW5E 3DPHA 7CEIA 2KGCA 3EJDA 2ROQA 2N6YA 2N50A 3I55P 2VLPA 2KGDA 3M1MA 1IUQA 4QNBA 3CCSP 2LKIA 5JPAA 2Z46A 2KGAA 3G26A 3CPWO 2AFEA 3RG6C 3DS0A 2L0QA 2LPKA 2XXMA
chains in the Genus database with same CATH topology
2KGEA 1HQBA 4BPGA 2KG8A 1DV5A 2MY5A 1T8KA 2FHSC 2XZ0D 2FADA 2K0XA 3CE7A 3GZLA 2KG9A 2FQ2A 2LIUA 2MD9A 1HY8A 2L22A 2XZ1C 1OR5A 4MRTC 2X2BA 4BPFA 4HKGA 2KOQA 5KP8B 1L0IA 2DNWA 2FAEA 2K92A 4DG9A 3GZMA 2K0YA 2K94A 1VKUA 2LTEA 2N5IA 4PXHB 2MF4A 3NY7B 5EJDA 2AVAA 5HV8A 2CNRA 3RG2A 2EHSA 5KP7B 2N6ZA 1X3OA 2LIWA 4H2WC 2M5RA 2KOOA 2KR5A 2LMLA 2QNWA 2KOSA 2MVUA 5KP6B 1NQ4A 3EJBA 1DNYA 5HVCA 4H2YC 1L0HA 2KW2A 2GDYA 3LMOA 2K93A 2EHTA 4PWVB 2K2QA 4IZ6A 4BPHA 5CZDB 2AFDA 2CQ8A 4CA3A 2KGCA 2VSQA 2KOPA 3EJDA 2PNGA 2FQ0A 2ROQA 2JU2A 2JQ4A 2LL8A 2LOLA 2N6YA 2L9FA 1F80D 2CG5B 2N50A 2L4BA 2FVEA 2CGQA 2KORA 2N5HA 2KGDA 1KLPA 2LKIA 2AF8A 2GDWA 2N98A 2FQ1A 2MR7A 2JU1A 2FVFA 1ACPA 2KGAA 2AFEA 2KG6A 2FVAA 4H2XC 2KWLA 2MR8A 4NEOA 2GDXA 3EJEA 2FACA 2MVVA 2L0QA 2LPKA 4R0MA 1AF8A 2JGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGE A;  1HQB A;  4BPG A;  2KG8 A;  1DV5 A;  2MY5 A;  1T8K A;  2FHS C;  2XZ0 D;  2FAD A;  2K0X A;  3CE7 A;  3GZL A;  2KG9 A;  2FQ2 A;  2LIU A;  2MD9 A;  1HY8 A;  2L22 A;  2XZ1 C;  1OR5 A;  4MRT C;  2X2B A;  4BPF A;  4HKG A;  2KOQ A;  5KP8 B;  1L0I A;  2DNW A;  2FAE A;  2K92 A;  4DG9 A;  3GZM A;  2K0Y A;  2K94 A;  1VKU A;  2LTE A;  2N5I A;  4PXH B;  2MF4 A;  3NY7 B;  5EJD A;  2AVA A;  5HV8 A;  2CNR A;  3RG2 A;  2EHS A;  5KP7 B;  2N6Z A;  1X3O A;  2LIW A;  4H2W C;  2M5R A;  2KOO A;  2KR5 A;  2LML A;  2QNW A;  2KOS A;  2MVU A;  5KP6 B;  1NQ4 A;  3EJB A;  1DNY A;  5HVC A;  4H2Y C;  1L0H A;  2KW2 A;  2GDY A;  3LMO A;  2K93 A;  2EHT A;  4PWV B;  2K2Q A;  4IZ6 A;  4BPH A;  5CZD B;  2AFD A;  2CQ8 A;  4CA3 A;  2KGC A;  2VSQ A;  2KOP A;  3EJD A;  2PNG A;  2FQ0 A;  2ROQ A;  2JU2 A;  2JQ4 A;  2LL8 A;  2LOL A;  2N6Y A;  2L9F A;  1F80 D;  2CG5 B;  2N50 A;  2L4B A;  2FVE A;  2CGQ A;  2KOR A;  2N5H A;  2KGD A;  1KLP A;  2LKI A;  2AF8 A;  2GDW A;  2N98 A;  2FQ1 A;  2MR7 A;  2JU1 A;  2FVF A;  1ACP A;  2KGA A;  2AFE A;  2KG6 A;  2FVA A;  4H2X C;  2KWL A;  2MR8 A;  4NEO A;  2GDX A;  3EJE A;  2FAC A;  2MVV A;  2L0Q A;  2LPK A;  4R0M A;  1AF8 A;  2JGP A; 
#chains in the Genus database with same CATH topology
 2KGE A;  2K5X A;  2XT1 A;  1DV5 A;  2BHV A;  3GZL A;  1AUM A;  4XRQ A;  2XV6 A;  1KC8 Q;  1VQM P;  2L22 A;  2XZ1 C;  2X2B A;  2M8L A;  1UNK A;  1Q81 Q;  3H4E A;  2FAE A;  2JYG A;  1M90 Q;  1K30 A;  2GZE A;  4IPY A;  2MF4 A;  3CCU P;  2CNR A;  2EHS A;  2OAR A;  1VQP P;  2N6Z A;  1X3O A;  4XFY A;  2M5R A;  2EG5 A;  1FR2 A;  2QNW A;  3Q20 A;  3DS1 A;  5KP6 B;  4M0I A;  1NQ4 A;  3E2D A;  1A8O A;  2KW2 A;  1EMV A;  3LMO A;  4U0E A;  2PEM A;  4IZ6 A;  4BPH A;  2AFD A;  1YIJ P;  4WYM A;  2VSQ A;  1M6N A;  1IMP A;  2JQ4 A;  3CXC O;  2LOL A;  2L9F A;  1F80 D;  1QVG O;  2M8N A;  2L4B A;  2GZG A;  2Z44 A;  2K0D X;  3CC2 P;  1AYI A;  1BXI A;  1W2B O;  2AF8 A;  2GDW A;  3CCR P;  2N98 A;  2FQ1 A;  3LRY A;  4XRO A;  3CD6 P;  2FVA A;  5F2K A;  3EJE A;  2MVV A;  4R0M A;  1AF8 A;  3CCE P;  5BS2 A;  1BAJ A;  2L6E A;  2GZI A;  1CEI A;  4BPG A;  3DS5 A;  3CCV P;  1T8K A;  1YJW P;  1M6E X;  2XZ0 D;  3G4S P;  3CE7 A;  3H47 A;  2ERH A;  2FQ2 A;  1K9M Q;  1N8R Q;  1OR5 A;  4BPF A;  2K92 A;  4GR6 A;  1VKU A;  2PEJ A;  3CC7 P;  2LTE A;  1VQ7 P;  2AVA A;  3RG2 A;  2GYK A;  5KP7 B;  1M74 A;  4QKO A;  3CCM P;  3I56 P;  2QA4 P;  3WBH A;  5HGM A;  2WPT A;  2KOD A;  3G1I A;  2GZJ A;  2MVU A;  5I4T G;  2NO8 A;  5HVC A;  1GXG A;  2K93 A;  3VRL C;  2K2Q A;  1VQ4 P;  2DGY A;  4U0C A;  3H0D A;  4CA3 A;  2KOP A;  3G21 A;  2FQ0 A;  4U0B A;  4U0F A;  2CGQ A;  2P9X A;  2KOR A;  2N5H A;  4COC A;  3CCL P;  2MR7 A;  2JU1 A;  2FVF A;  1ACP A;  1JJ2 O;  2KG6 A;  2PEK A;  4NEO A;  1GPJ A;  5DCK A;  1Q86 Q;  1D1D A;  1QVF O;  3B4Q A;  4COP A;  3DS4 A;  1HQB A;  2JO0 A;  3U43 A;  1VHN A;  3DS3 A;  2KG8 A;  1E6J P;  1YJ9 P;  1K8A Q;  3GKL C;  2FHS C;  2VLN A;  5F2O A;  2K0X A;  3HYB A;  2PEN A;  5F2N A;  2LIU A;  2PEO A;  1RNI A;  1Q82 Q;  1ZMB A;  5HGL A;  1MZ8 A;  1VQN P;  4HKG A;  2VLQ A;  5KP8 B;  2DNW A;  2GZF A;  2K94 A;  2JBG A;  3G0V A;  4PXH B;  3NY7 B;  2EIA A;  5HV8 A;  3CME P;  1VQK P;  1VQ9 P;  1YIT P;  3DTJ A;  1VQL P;  4H2W C;  2JB0 A;  2ONT A;  2LML A;  2CWO A;  1DNY A;  4H2Y C;  1L0H A;  2EFJ A;  3NTE A;  2PNG A;  2JU2 A;  1Q7Y Q;  2LL8 A;  5HGN A;  2OTL P;  1NJI Q;  2QEX P;  3G71 P;  2CG5 B;  1QRJ A;  1IMQ A;  3GJN A;  2FVE A;  2PY8 A;  4U0A A;  3CCQ P;  1Z6M A;  1KLP A;  2PEI A;  1M1K Q;  2E1M A;  1VQ6 P;  4H2X C;  2KWL A;  3B5I A;  5BS1 A;  3G28 A;  2MR8 A;  2GDX A;  1VQO P;  2FAC A;  2LF4 A;  3G1G A;  2JYL A;  2JGP A;  4PH1 A;  1GXH A;  2M8P A;  2MY5 A;  1YHQ P;  2FAD A;  1KD1 Q;  1KQS O;  2KG9 A;  2OTJ P;  2MD9 A;  3OW2 O;  1YI2 P;  3CC4 P;  1HY8 A;  4MRT C;  2BUO A;  1EOQ A;  2PEQ A;  2KOQ A;  1L0I A;  4XFX A;  4DG9 A;  3GZM A;  2K0Y A;  1EIA A;  3MGE A;  2JAZ A;  3G29 A;  3CMA P;  1S72 P;  1VQ5 P;  2N5I A;  1YJN P;  1ZNV A;  4GR2 A;  5EJD A;  1RO2 A;  4UHP B;  3G6E P;  1UJZ A;  1E0H A;  2LIW A;  4XFZ A;  4PH0 A;  3HZQ A;  2VLO A;  2KOO A;  2KR5 A;  1A43 A;  2KOS A;  4F37 A;  1K73 Q;  3EJB A;  2GDY A;  2EHT A;  3CCJ P;  3P05 A;  2Z45 A;  4U0D A;  4PWV B;  1VQ8 P;  1RO0 A;  5CZD B;  3DS2 A;  2CQ8 A;  5HGO A;  5EW5 E;  3DPH A;  7CEI A;  2KGC A;  3EJD A;  2ROQ A;  2N6Y A;  2N50 A;  3I55 P;  2VLP A;  2KGD A;  3M1M A;  1IUQ A;  4QNB A;  3CCS P;  2LKI A;  5JPA A;  2Z46 A;  2KGA A;  3G26 A;  3CPW O;  2AFE A;  3RG6 C;  3DS0 A;  2L0Q A;  2LPK A;  2XXM A; 
#chains in the Genus database with same CATH homology
 2KGE A;  1HQB A;  4BPG A;  2KG8 A;  1DV5 A;  2MY5 A;  1T8K A;  2FHS C;  2XZ0 D;  2FAD A;  2K0X A;  3CE7 A;  3GZL A;  2KG9 A;  2FQ2 A;  2LIU A;  2MD9 A;  1HY8 A;  2L22 A;  2XZ1 C;  1OR5 A;  4MRT C;  2X2B A;  4BPF A;  4HKG A;  2KOQ A;  5KP8 B;  1L0I A;  2DNW A;  2FAE A;  2K92 A;  4DG9 A;  3GZM A;  2K0Y A;  2K94 A;  1VKU A;  2LTE A;  2N5I A;  4PXH B;  2MF4 A;  3NY7 B;  5EJD A;  2AVA A;  5HV8 A;  2CNR A;  3RG2 A;  2EHS A;  5KP7 B;  2N6Z A;  1X3O A;  2LIW A;  4H2W C;  2M5R A;  2KOO A;  2KR5 A;  2LML A;  2QNW A;  2KOS A;  2MVU A;  5KP6 B;  1NQ4 A;  3EJB A;  1DNY A;  5HVC A;  4H2Y C;  1L0H A;  2KW2 A;  2GDY A;  3LMO A;  2K93 A;  2EHT A;  4PWV B;  2K2Q A;  4IZ6 A;  4BPH A;  5CZD B;  2AFD A;  2CQ8 A;  4CA3 A;  2KGC A;  2VSQ A;  2KOP A;  3EJD A;  2PNG A;  2FQ0 A;  2ROQ A;  2JU2 A;  2JQ4 A;  2LL8 A;  2LOL A;  2N6Y A;  2L9F A;  1F80 D;  2CG5 B;  2N50 A;  2L4B A;  2FVE A;  2CGQ A;  2KOR A;  2N5H A;  2KGD A;  1KLP A;  2LKI A;  2AF8 A;  2GDW A;  2N98 A;  2FQ1 A;  2MR7 A;  2JU1 A;  2FVF A;  1ACP A;  2KGA A;  2AFE A;  2KG6 A;  2FVA A;  4H2X C;  2KWL A;  2MR8 A;  4NEO A;  2GDX A;  3EJE A;  2FAC A;  2MVV A;  2L0Q A;  2LPK A;  4R0M A;  1AF8 A;  2JGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...