2L4BA

Solution structure of a putative acyl carrier protein from anaplasma phagocytophilum. seattle structural genomics center for infectious disease target anpha.01018.a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
88
Chain Sequence
PGSMVSEEIKAQVMESVIGCLKLNDEQKQILSGTTNLAKDFNLDSLDFVDLIMSLEERFSLEISDEDAQKLETVDDICRYIASKSSDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acyl carrier protein
publication title Solution structure of a putative acyl carrier protein from Anaplasma phagocytophilum. Seattle Structural Genomics Center for Infectious Disease target AnphA.01018.a
rcsb
source organism Anaplasma phagocytophilum
total genus 21
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2l4bA00
2FACA 2KOPA 2LKIA 2KGDA 2GDWA 2FQ2A 1HY8A 2X2BA 2XZ0D 2FVFA 2KOOA 2GDXA 2LMLA 4MRTC 2KG9A 2N50A 2KGCA 2KGEA 2PNGA 2MD9A 4BPFA 4IZ6A 2L22A 1DV5A 2EHTA 2AVAA 2ROQA 3GZLA 3LMOA 2LOLA 2N6YA 2L4BA 5CZDB 2KGAA 4BPHA 5KP8B 4PXHB 2KG8A 2JU1A 2K0YA 1ACPA 1KLPA 2AFEA 2KW2A 2K2QA 2FQ0A 2CG5B 2AF8A 4H2YC 1VKUA 2XZ1C 4NEOA 3EJBA 1HQBA 5KP7B 2MR8A 2FQ1A 3EJEA 1OR5A 2KORA 2FVAA 2LTEA 3CE7A 2MVUA 1X3OA 3NY7B 1T8KA 5EJDA 3GZMA 4PWVB 2LL8A 2FADA 2CNRA 2KR5A 4R0MA 1DNYA 2EHSA 2GDYA 2M5RA 2N5IA 2CQ8A 3RG2A 2KWLA 2K93A 2K94A 4DG9A 2MF4A 1NQ4A 2KOQA 2L0QA 2FVEA 2AFDA 2FHSC 2K0XA 2JU2A 2QNWA 2MY5A 1AF8A 2FAEA 4H2XC 5HV8A 2VSQA 5HVCA 2LIUA 1F80D 2LIWA 4HKGA 4BPGA 2CGQA 2KG6A 3EJDA 2LPKA 2DNWA 4CA3A 2L9FA 2N98A 5KP6B 1L0HA 1L0IA 2JGPA 2KOSA 2N5HA 2K92A 2JQ4A 4H2WC 2N6ZA 2MVVA 2MR7A
chains in the Genus database with same CATH superfamily
2ONTA 2FQ2A 5F2NA 2FVFA 4U0CA 2JYGA 2Z45A 4M0IA 3CCUP 4WYMA 3RG6C 2Z44A 2JB0A 1S72P 1W2BO 4PH0A 1VQ4P 2GZGA 4PXHB 4PH1A 5DCKA 2FQ0A 3I55P 4U0EA 2AF8A 2NO8A 3DTJA 1GPJA 2FVAA 3DS1A 1RO2A 1E0HA 2MVUA 3CCMP 2WPTA 1YHQP 2VLOA 1M90Q 3G1IA 1CEIA 1YJWP 3CC2P 3GZMA 2XV6A 2JYLA 5HGMA 2GZJA 3G0VA 2CNRA 2JO0A 3Q20A 2K94A 4DG9A 3I56P 3GKLC 1IMPA 1EOQA 4COCA 1NQ4A 2K0XA 3CC7P 2QNWA 1BXIA 1VHNA 4U0DA 3OW2O 3CMEP 1F80D 2LIWA 4BPGA 1QRJA 2OTLP 1K8AQ 1L0HA 4XFXA 2JGPA 5HGOA 3CMAP 4H2WC 2N6ZA 2MR7A 1RO0A 1Z6MA 1VQOP 2KOPA 2PY8A 1HY8A 1VQNP 2X2BA 1D1DA 2XZ0D 2Z46A 2GDXA 1VQKP 2PEMA 2N50A 1ZMBA 3CCEP 1BAJA 2PEIA 3G21A 2PENA 4QNBA 2L22A 1DV5A 1YIJP 2EHTA 2AVAA 2ROQA 1GXHA 5F2OA 3LMOA 2GZIA 1VQ7P 3GJNA 1M1KQ 2L6EA 2AFEA 2KW2A 2K2QA 4GR2A 3CCJP 2CG5B 1N8RQ 1UJZA 4H2YC 1VKUA 3LRYA 5KP7B 1OR5A 3HYBA 2K5XA 1KD1Q 1UNKA 3NTEA 2PEOA 1JJ2O 1T8KA 2DGYA 5EJDA 2FADA 1YJ9P 2LF4A 2KR5A 2PEJA 4R0MA 2JAZA 3H47A 1DNYA 2GDYA 3P05A 2CQ8A 3RG2A 1RNIA 2K93A 3CCRP 4UHPB 5JPAA 3DPHA 4U0FA 4COPA 1AF8A 3DS3A 2E1MA 4H2XC 5HVCA 3CXCO 1FR2A 3B4QA 4CA3A 7CEIA 2L9FA 1QVFO 1L0IA 2KOSA 2N5HA 4QKOA 2JQ4A 2M8PA 3H0DA 3CD6P 1Q7YQ 3CCVP 1YJNP 3G28A 4GR6A 4XFZA 5HGNA 2FACA 1YITP 1Q81Q 1K30A 2KOOA 2BUOA 3H4EA 4XROA 2LMLA 2KG9A 2KGEA 2QEXP 2PNGA 3CCQP 4BPFA 2VLQA 3M1MA 2LOLA 3CCSP 5BS2A 2L4BA 2P9XA 3VRLC 2XT1A 5CZDB 4BPHA 5KP8B 4F37A 1M74A 2KG8A 2K0YA 1ACPA 2QA4P 4U0AA 1KC8Q 2XZ1C 3EJBA 1HQBA 2MR8A 1AYIA 1IUQA 2KORA 1M6EX 3NY7B 2GZFA 3G4SP 1NJIQ 2LL8A 4IPYA 3DS5A 2OTJP 3B5IA 2EHSA 4U0BA 2N5IA 2MF4A 2KOQA 2GZEA 1KQSO 2FVEA 2EG5A 2K0DX 3G71P 2FHSC 2JU2A 3CPWO 2MY5A 2FAEA 5HV8A 3WBHA 2VSQA 2CWOA 2LIUA 2CGQA 2PEKA 1A8OA 2M8LA 1E6JP 3DS2A 1VQMP 2MVVA 3DS4A 2LKIA 2KGDA 2GDWA 2ERHA 4MRTC 1IMQA 3G1GA 2KGCA 5EW5E 5BS1A 2MD9A 5HGLA 1VQPP 3U43A 2BHVA 3DS0A 4IZ6A 2VLNA 1AUMA 3GZLA 2N6YA 2VLPA 1K9MQ 2KGAA 2EIAA 5I4TG 2JU1A 1KLPA 3G26A 4NEOA 2PEQA 1EIAA 2FQ1A 3EJEA 2LTEA 3CE7A 1X3OA 1VQ6P 2XXMA 4XRQA 4PWVB 1VQ9P 1VQLP 2KODA 1MZ8A 1Q82Q 2M5RA 2JBGA 2KWLA 3CCLP 1A43A 2L0QA 1VQ8P 2AFDA 1M6NA 3HZQA 5F2KA 1GXGA 3CC4P 3G6EP 1EMVA 3E2DA 4HKGA 1VQ5P 2OARA 2GYKA 2KG6A 2LPKA 3EJDA 3MGEA 2M8NA 2DNWA 2N98A 5KP6B 2K92A 1K73Q 1YI2P 2EFJA 4XFYA 1Q86Q 1QVGO 3G29A 1ZNVA
chains in the Genus database with same CATH topology
2FACA 2KOPA 2LKIA 2KGDA 2GDWA 2FQ2A 1HY8A 2X2BA 2XZ0D 2FVFA 2KOOA 2GDXA 2LMLA 4MRTC 2KG9A 2N50A 2KGCA 2KGEA 2PNGA 2MD9A 4BPFA 4IZ6A 2L22A 1DV5A 2EHTA 2AVAA 2ROQA 3GZLA 3LMOA 2LOLA 2N6YA 2L4BA 5CZDB 2KGAA 4BPHA 5KP8B 4PXHB 2KG8A 2JU1A 2K0YA 1ACPA 1KLPA 2AFEA 2KW2A 2K2QA 2FQ0A 2CG5B 2AF8A 4H2YC 1VKUA 2XZ1C 4NEOA 3EJBA 1HQBA 5KP7B 2MR8A 2FQ1A 3EJEA 1OR5A 2KORA 2FVAA 2LTEA 3CE7A 2MVUA 1X3OA 3NY7B 1T8KA 5EJDA 3GZMA 4PWVB 2LL8A 2FADA 2CNRA 2KR5A 4R0MA 1DNYA 2EHSA 2GDYA 2M5RA 2N5IA 2CQ8A 3RG2A 2KWLA 2K93A 2K94A 4DG9A 2MF4A 1NQ4A 2KOQA 2L0QA 2FVEA 2AFDA 2FHSC 2K0XA 2JU2A 2QNWA 2MY5A 1AF8A 2FAEA 4H2XC 5HV8A 2VSQA 5HVCA 2LIUA 1F80D 2LIWA 4HKGA 4BPGA 2CGQA 2KG6A 3EJDA 2LPKA 2DNWA 4CA3A 2L9FA 2N98A 5KP6B 1L0HA 1L0IA 2JGPA 2KOSA 2N5HA 2K92A 2JQ4A 4H2WC 2N6ZA 2MVVA 2MR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAC A;  2KOP A;  2LKI A;  2KGD A;  2GDW A;  2FQ2 A;  1HY8 A;  2X2B A;  2XZ0 D;  2FVF A;  2KOO A;  2GDX A;  2LML A;  4MRT C;  2KG9 A;  2N50 A;  2KGC A;  2KGE A;  2PNG A;  2MD9 A;  4BPF A;  4IZ6 A;  2L22 A;  1DV5 A;  2EHT A;  2AVA A;  2ROQ A;  3GZL A;  3LMO A;  2LOL A;  2N6Y A;  2L4B A;  5CZD B;  2KGA A;  4BPH A;  5KP8 B;  4PXH B;  2KG8 A;  2JU1 A;  2K0Y A;  1ACP A;  1KLP A;  2AFE A;  2KW2 A;  2K2Q A;  2FQ0 A;  2CG5 B;  2AF8 A;  4H2Y C;  1VKU A;  2XZ1 C;  4NEO A;  3EJB A;  1HQB A;  5KP7 B;  2MR8 A;  2FQ1 A;  3EJE A;  1OR5 A;  2KOR A;  2FVA A;  2LTE A;  3CE7 A;  2MVU A;  1X3O A;  3NY7 B;  1T8K A;  5EJD A;  3GZM A;  4PWV B;  2LL8 A;  2FAD A;  2CNR A;  2KR5 A;  4R0M A;  1DNY A;  2EHS A;  2GDY A;  2M5R A;  2N5I A;  2CQ8 A;  3RG2 A;  2KWL A;  2K93 A;  2K94 A;  4DG9 A;  2MF4 A;  1NQ4 A;  2KOQ A;  2L0Q A;  2FVE A;  2AFD A;  2FHS C;  2K0X A;  2JU2 A;  2QNW A;  2MY5 A;  1AF8 A;  2FAE A;  4H2X C;  5HV8 A;  2VSQ A;  5HVC A;  2LIU A;  1F80 D;  2LIW A;  4HKG A;  4BPG A;  2CGQ A;  2KG6 A;  3EJD A;  2LPK A;  2DNW A;  4CA3 A;  2L9F A;  2N98 A;  5KP6 B;  1L0H A;  1L0I A;  2JGP A;  2KOS A;  2N5H A;  2K92 A;  2JQ4 A;  4H2W C;  2N6Z A;  2MVV A;  2MR7 A; 
#chains in the Genus database with same CATH topology
 2ONT A;  2FQ2 A;  5F2N A;  2FVF A;  4U0C A;  2JYG A;  2Z45 A;  4M0I A;  3CCU P;  4WYM A;  3RG6 C;  2Z44 A;  2JB0 A;  1S72 P;  1W2B O;  4PH0 A;  1VQ4 P;  2GZG A;  4PXH B;  4PH1 A;  5DCK A;  2FQ0 A;  3I55 P;  4U0E A;  2AF8 A;  2NO8 A;  3DTJ A;  1GPJ A;  2FVA A;  3DS1 A;  1RO2 A;  1E0H A;  2MVU A;  3CCM P;  2WPT A;  1YHQ P;  2VLO A;  1M90 Q;  3G1I A;  1CEI A;  1YJW P;  3CC2 P;  3GZM A;  2XV6 A;  2JYL A;  5HGM A;  2GZJ A;  3G0V A;  2CNR A;  2JO0 A;  3Q20 A;  2K94 A;  4DG9 A;  3I56 P;  3GKL C;  1IMP A;  1EOQ A;  4COC A;  1NQ4 A;  2K0X A;  3CC7 P;  2QNW A;  1BXI A;  1VHN A;  4U0D A;  3OW2 O;  3CME P;  1F80 D;  2LIW A;  4BPG A;  1QRJ A;  2OTL P;  1K8A Q;  1L0H A;  4XFX A;  2JGP A;  5HGO A;  3CMA P;  4H2W C;  2N6Z A;  2MR7 A;  1RO0 A;  1Z6M A;  1VQO P;  2KOP A;  2PY8 A;  1HY8 A;  1VQN P;  2X2B A;  1D1D A;  2XZ0 D;  2Z46 A;  2GDX A;  1VQK P;  2PEM A;  2N50 A;  1ZMB A;  3CCE P;  1BAJ A;  2PEI A;  3G21 A;  2PEN A;  4QNB A;  2L22 A;  1DV5 A;  1YIJ P;  2EHT A;  2AVA A;  2ROQ A;  1GXH A;  5F2O A;  3LMO A;  2GZI A;  1VQ7 P;  3GJN A;  1M1K Q;  2L6E A;  2AFE A;  2KW2 A;  2K2Q A;  4GR2 A;  3CCJ P;  2CG5 B;  1N8R Q;  1UJZ A;  4H2Y C;  1VKU A;  3LRY A;  5KP7 B;  1OR5 A;  3HYB A;  2K5X A;  1KD1 Q;  1UNK A;  3NTE A;  2PEO A;  1JJ2 O;  1T8K A;  2DGY A;  5EJD A;  2FAD A;  1YJ9 P;  2LF4 A;  2KR5 A;  2PEJ A;  4R0M A;  2JAZ A;  3H47 A;  1DNY A;  2GDY A;  3P05 A;  2CQ8 A;  3RG2 A;  1RNI A;  2K93 A;  3CCR P;  4UHP B;  5JPA A;  3DPH A;  4U0F A;  4COP A;  1AF8 A;  3DS3 A;  2E1M A;  4H2X C;  5HVC A;  3CXC O;  1FR2 A;  3B4Q A;  4CA3 A;  7CEI A;  2L9F A;  1QVF O;  1L0I A;  2KOS A;  2N5H A;  4QKO A;  2JQ4 A;  2M8P A;  3H0D A;  3CD6 P;  1Q7Y Q;  3CCV P;  1YJN P;  3G28 A;  4GR6 A;  4XFZ A;  5HGN A;  2FAC A;  1YIT P;  1Q81 Q;  1K30 A;  2KOO A;  2BUO A;  3H4E A;  4XRO A;  2LML A;  2KG9 A;  2KGE A;  2QEX P;  2PNG A;  3CCQ P;  4BPF A;  2VLQ A;  3M1M A;  2LOL A;  3CCS P;  5BS2 A;  2L4B A;  2P9X A;  3VRL C;  2XT1 A;  5CZD B;  4BPH A;  5KP8 B;  4F37 A;  1M74 A;  2KG8 A;  2K0Y A;  1ACP A;  2QA4 P;  4U0A A;  1KC8 Q;  2XZ1 C;  3EJB A;  1HQB A;  2MR8 A;  1AYI A;  1IUQ A;  2KOR A;  1M6E X;  3NY7 B;  2GZF A;  3G4S P;  1NJI Q;  2LL8 A;  4IPY A;  3DS5 A;  2OTJ P;  3B5I A;  2EHS A;  4U0B A;  2N5I A;  2MF4 A;  2KOQ A;  2GZE A;  1KQS O;  2FVE A;  2EG5 A;  2K0D X;  3G71 P;  2FHS C;  2JU2 A;  3CPW O;  2MY5 A;  2FAE A;  5HV8 A;  3WBH A;  2VSQ A;  2CWO A;  2LIU A;  2CGQ A;  2PEK A;  1A8O A;  2M8L A;  1E6J P;  3DS2 A;  1VQM P;  2MVV A;  3DS4 A;  2LKI A;  2KGD A;  2GDW A;  2ERH A;  4MRT C;  1IMQ A;  3G1G A;  2KGC A;  5EW5 E;  5BS1 A;  2MD9 A;  5HGL A;  1VQP P;  3U43 A;  2BHV A;  3DS0 A;  4IZ6 A;  2VLN A;  1AUM A;  3GZL A;  2N6Y A;  2VLP A;  1K9M Q;  2KGA A;  2EIA A;  5I4T G;  2JU1 A;  1KLP A;  3G26 A;  4NEO A;  2PEQ A;  1EIA A;  2FQ1 A;  3EJE A;  2LTE A;  3CE7 A;  1X3O A;  1VQ6 P;  2XXM A;  4XRQ A;  4PWV B;  1VQ9 P;  1VQL P;  2KOD A;  1MZ8 A;  1Q82 Q;  2M5R A;  2JBG A;  2KWL A;  3CCL P;  1A43 A;  2L0Q A;  1VQ8 P;  2AFD A;  1M6N A;  3HZQ A;  5F2K A;  1GXG A;  3CC4 P;  3G6E P;  1EMV A;  3E2D A;  4HKG A;  1VQ5 P;  2OAR A;  2GYK A;  2KG6 A;  2LPK A;  3EJD A;  3MGE A;  2M8N A;  2DNW A;  2N98 A;  5KP6 B;  2K92 A;  1K73 Q;  1YI2 P;  2EFJ A;  4XFY A;  1Q86 Q;  1QVG O;  3G29 A;  1ZNV A; 
#chains in the Genus database with same CATH homology
 2FAC A;  2KOP A;  2LKI A;  2KGD A;  2GDW A;  2FQ2 A;  1HY8 A;  2X2B A;  2XZ0 D;  2FVF A;  2KOO A;  2GDX A;  2LML A;  4MRT C;  2KG9 A;  2N50 A;  2KGC A;  2KGE A;  2PNG A;  2MD9 A;  4BPF A;  4IZ6 A;  2L22 A;  1DV5 A;  2EHT A;  2AVA A;  2ROQ A;  3GZL A;  3LMO A;  2LOL A;  2N6Y A;  2L4B A;  5CZD B;  2KGA A;  4BPH A;  5KP8 B;  4PXH B;  2KG8 A;  2JU1 A;  2K0Y A;  1ACP A;  1KLP A;  2AFE A;  2KW2 A;  2K2Q A;  2FQ0 A;  2CG5 B;  2AF8 A;  4H2Y C;  1VKU A;  2XZ1 C;  4NEO A;  3EJB A;  1HQB A;  5KP7 B;  2MR8 A;  2FQ1 A;  3EJE A;  1OR5 A;  2KOR A;  2FVA A;  2LTE A;  3CE7 A;  2MVU A;  1X3O A;  3NY7 B;  1T8K A;  5EJD A;  3GZM A;  4PWV B;  2LL8 A;  2FAD A;  2CNR A;  2KR5 A;  4R0M A;  1DNY A;  2EHS A;  2GDY A;  2M5R A;  2N5I A;  2CQ8 A;  3RG2 A;  2KWL A;  2K93 A;  2K94 A;  4DG9 A;  2MF4 A;  1NQ4 A;  2KOQ A;  2L0Q A;  2FVE A;  2AFD A;  2FHS C;  2K0X A;  2JU2 A;  2QNW A;  2MY5 A;  1AF8 A;  2FAE A;  4H2X C;  5HV8 A;  2VSQ A;  5HVC A;  2LIU A;  1F80 D;  2LIW A;  4HKG A;  4BPG A;  2CGQ A;  2KG6 A;  3EJD A;  2LPK A;  2DNW A;  4CA3 A;  2L9F A;  2N98 A;  5KP6 B;  1L0H A;  1L0I A;  2JGP A;  2KOS A;  2N5H A;  2K92 A;  2JQ4 A;  4H2W C;  2N6Z A;  2MVV A;  2MR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...