2L4BA

Solution structure of a putative acyl carrier protein from anaplasma phagocytophilum. seattle structural genomics center for infectious disease target anpha.01018.a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
88
Chain Sequence
PGSMVSEEIKAQVMESVIGCLKLNDEQKQILSGTTNLAKDFNLDSLDFVDLIMSLEERFSLEISDEDAQKLETVDDICRYIASKSSDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Solution structure of a putative acyl carrier protein from Anaplasma phagocytophilum. Seattle Structural Genomics Center for Infectious Disease target AnphA.01018.a
rcsb
source organism Anaplasma phagocytophilum
molecule tags Transferase
total genus 21
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2l4bA00
2M5RA 2AF8A 4R0MA 2KWLA 2KGEA 5KP7B 2XZ1C 2LPKA 2N6YA 2MVUA 2LKIA 2VSQA 4H2XC 2N98A 2FVEA 2FVFA 2EHSA 3CE7A 2N50A 2K92A 4HKGA 2KOPA 2FADA 3EJDA 4PXHB 1DNYA 2ROQA 2CG5B 2MR7A 2FQ2A 2FQ0A 5KP6B 2L4BA 2KOOA 2L0QA 2LTEA 2MY5A 2CNRA 1HY8A 2JU1A 2MVVA 4BPFA 2K0YA 4H2WC 2KGAA 5CZDB 2FHSC 4NEOA 2GDYA 5KP8B 2KOSA 3GZMA 2KOQA 4CA3A 5EJDA 2KW2A 1VKUA 2FAEA 2GDXA 2CGQA 1X3OA 1ACPA 2LL8A 2MF4A 2JQ4A 2K94A 1HQBA 2FQ1A 2KG8A 2AFDA 2N5HA 4PWVB 3GZLA 2PNGA 2DNWA 2KGCA 3EJEA 2KG9A 2FACA 2KORA 4DG9A 1NQ4A 1OR5A 2QNWA 2MD9A 2L9FA 3LMOA 1KLPA 2GDWA 4IZ6A 1T8KA 2AFEA 2MR8A 2JGPA 2EHTA 3RG2A 2JU2A 2K0XA 1L0IA 2N5IA 3NY7B 2KG6A 2L22A 1DV5A 2K2QA 4BPHA 2LMLA 4H2YC 2AVAA 5HVCA 4MRTC 5HV8A 4BPGA 2FVAA 2LIWA 2XZ0D 2K93A 2KR5A 1F80D 1L0HA 2LOLA 3EJBA 2CQ8A 2N6ZA 2X2BA 2KGDA 1AF8A 2LIUA
chains in the Genus database with same CATH superfamily
2M5RA 2PEKA 2AF8A 1KQSO 4U0AA 4R0MA 2XT1A 2N6YA 4XRQA 2LKIA 4IPYA 3CCVP 1GXHA 4H2XC 1QVGO 2FVFA 2EHSA 2XXMA 3CE7A 2JYLA 2JAZA 3EJDA 2ROQA 2L4BA 3E2DA 3G28A 2CNRA 2EFJA 1KC8Q 1HY8A 3CXCO 2CWOA 2K0YA 1VQ8P 1CEIA 2JBGA 3CCRP 2GZIA 1EMVA 1MZ8A 1VQ9P 1FR2A 2KOSA 2VLOA 1NJIQ 2PENA 1GXGA 1ACPA 1X3OA 3G1IA 3CD6P 2JQ4A 3G4SP 1HQBA 2VLNA 5F2OA 2E1MA 2Z45A 2PNGA 3DPHA 2M8NA 2KG9A 4DG9A 1OR5A 2L9FA 3LMOA 1E0HA 5EW5E 1RO2A 1A8OA 5F2KA 1AUMA 3G71P 1VQPP 2GYKA 2JU2A 2KG6A 3GJNA 4COPA 1EOQA 4MRTC 3CC4P 3HZQA 1L0HA 1VQLP 5HGNA 2CQ8A 3CCSP 1YJNP 2QA4P 5BS2A 2QEXP 1M74A 2LF4A 1IMQA 2Z46A 5KP7B 2XZ1C 2K5XA 2MVUA 4XFXA 1EIAA 5BS1A 2N98A 2K92A 2P9XA 2L6EA 2FADA 2FQ2A 2FQ0A 4U0CA 5KP6B 3CCEP 1VQNP 2MY5A 3CCLP 2JU1A 1YHQP 3B4QA 4BPFA 1Q7YQ 3P05A 5CZDB 2FHSC 3DS2A 1S72P 4NEOA 1RO0A 2KOQA 1JJ2O 3DS3A 2PEJA 1RNIA 2CGQA 3CMAP 1VQ6P 1K30A 3H4EA 3I56P 1ZMBA 4PWVB 3GZLA 2VLQA 2DNWA 2KGCA 3CC2P 2K0DX 3WBHA 1QRJA 1KLPA 2GDWA 3H0DA 2MR8A 1KD1Q 2EHTA 3DS0A 3I55P 2PEIA 2K0XA 3G21A 1L0IA 4PH0A 4QKOA 1K9MQ 2K2QA 2JYGA 3G0VA 1YI2P 4GR6A 2BHVA 2GZGA 4WYMA 1M1KQ 2AVAA 4BPGA 2BUOA 3EJBA 4PH1A 1YITP 1BAJA 2X2BA 4GR2A 1W2BO 1GPJA 5HGOA 1ZNVA 2KWLA 2GZJA 2KGEA 5F2NA 3CCUP 4XROA 4M0IA 2KODA 4U0EA 2OARA 4HKGA 2DGYA 4XFYA 1AYIA 2EIAA 1DNYA 2CG5B 4QNBA 3G1GA 2MVVA 1D1DA 5HGLA 1YIJP 3H47A 3GKLC 1BXIA 2KGAA 2OTJP 2Z44A 1K8AQ 1UJZA 2PEMA 1YJ9P 3RG6C 5DCKA 2PEQA 2KW2A 1VKUA 2GDXA 2PY8A 4F37A 3Q20A 2MF4A 2K94A 2KG8A 1IUQA 2AFDA 3CPWO 2ERHA 4COCA 2N5HA 3U43A 1UNKA 1A43A 4UHPB 1VQ7P 3EJEA 2ONTA 5JPAA 2FACA 5I4TG 2MD9A 2M8PA 1VQ5P 3CCMP 1YJWP 1T8KA 2PEOA 3DTJA 3DS5A 3RG2A 7CEIA 3LRYA 4U0BA 4BPHA 2EG5A 4H2YC 5HVCA 4U0FA 5HV8A 3CC7P 2FVAA 2LIWA 3G26A 2K93A 1F80D 2N6ZA 3G29A 1AF8A 2VLPA 2LPKA 1QVFO 2VSQA 3M1MA 2FVEA 2N50A 1Z6MA 2KOPA 4PXHB 2MR7A 2KOOA 2L0QA 2LTEA 1Q86Q 2NO8A 4H2WC 1M6EX 2OTLP 1VQKP 2GDYA 5KP8B 3VRLC 3HYBA 1IMPA 1VHNA 3GZMA 2JB0A 4XFZA 2WPTA 4CA3A 5EJDA 2FAEA 1M90Q 2LL8A 2JO0A 2GZEA 2FQ1A 3DS1A 1E6JP 3CCQP 3CCJP 2KORA 1NQ4A 2QNWA 3OW2O 2GZFA 3G6EP 2M8LA 1K73Q 3MGEA 4IZ6A 2AFEA 2JGPA 1Q82Q 1M6NA 1VQMP 1N8RQ 2N5IA 3NY7B 5HGMA 1Q81Q 2L22A 1VQOP 3B5IA 1DV5A 3DS4A 2LMLA 2XV6A 3NTEA 3CMEP 2XZ0D 2KR5A 2LOLA 2KGDA 2LIUA 4U0DA 1VQ4P
chains in the Genus database with same CATH topology
2M5RA 2AF8A 4R0MA 2KWLA 2KGEA 5KP7B 2XZ1C 2LPKA 2N6YA 2MVUA 2LKIA 2VSQA 4H2XC 2N98A 2FVEA 2FVFA 2EHSA 3CE7A 2N50A 2K92A 4HKGA 2KOPA 2FADA 3EJDA 4PXHB 1DNYA 2ROQA 2CG5B 2MR7A 2FQ2A 2FQ0A 5KP6B 2L4BA 2KOOA 2L0QA 2LTEA 2MY5A 2CNRA 1HY8A 2JU1A 2MVVA 4BPFA 2K0YA 4H2WC 2KGAA 5CZDB 2FHSC 4NEOA 2GDYA 5KP8B 2KOSA 3GZMA 2KOQA 4CA3A 5EJDA 2KW2A 1VKUA 2FAEA 2GDXA 2CGQA 1X3OA 1ACPA 2LL8A 2MF4A 2JQ4A 2K94A 1HQBA 2FQ1A 2KG8A 2AFDA 2N5HA 4PWVB 3GZLA 2PNGA 2DNWA 2KGCA 3EJEA 2KG9A 2FACA 2KORA 4DG9A 1NQ4A 1OR5A 2QNWA 2MD9A 2L9FA 3LMOA 1KLPA 2GDWA 4IZ6A 1T8KA 2AFEA 2MR8A 2JGPA 2EHTA 3RG2A 2JU2A 2K0XA 1L0IA 2N5IA 3NY7B 2KG6A 2L22A 1DV5A 2K2QA 4BPHA 2LMLA 4H2YC 2AVAA 5HVCA 4MRTC 5HV8A 4BPGA 2FVAA 2LIWA 2XZ0D 2K93A 2KR5A 1F80D 1L0HA 2LOLA 3EJBA 2CQ8A 2N6ZA 2X2BA 2KGDA 1AF8A 2LIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5R A;  2AF8 A;  4R0M A;  2KWL A;  2KGE A;  5KP7 B;  2XZ1 C;  2LPK A;  2N6Y A;  2MVU A;  2LKI A;  2VSQ A;  4H2X C;  2N98 A;  2FVE A;  2FVF A;  2EHS A;  3CE7 A;  2N50 A;  2K92 A;  4HKG A;  2KOP A;  2FAD A;  3EJD A;  4PXH B;  1DNY A;  2ROQ A;  2CG5 B;  2MR7 A;  2FQ2 A;  2FQ0 A;  5KP6 B;  2L4B A;  2KOO A;  2L0Q A;  2LTE A;  2MY5 A;  2CNR A;  1HY8 A;  2JU1 A;  2MVV A;  4BPF A;  2K0Y A;  4H2W C;  2KGA A;  5CZD B;  2FHS C;  4NEO A;  2GDY A;  5KP8 B;  2KOS A;  3GZM A;  2KOQ A;  4CA3 A;  5EJD A;  2KW2 A;  1VKU A;  2FAE A;  2GDX A;  2CGQ A;  1X3O A;  1ACP A;  2LL8 A;  2MF4 A;  2JQ4 A;  2K94 A;  1HQB A;  2FQ1 A;  2KG8 A;  2AFD A;  2N5H A;  4PWV B;  3GZL A;  2PNG A;  2DNW A;  2KGC A;  3EJE A;  2KG9 A;  2FAC A;  2KOR A;  4DG9 A;  1NQ4 A;  1OR5 A;  2QNW A;  2MD9 A;  2L9F A;  3LMO A;  1KLP A;  2GDW A;  4IZ6 A;  1T8K A;  2AFE A;  2MR8 A;  2JGP A;  2EHT A;  3RG2 A;  2JU2 A;  2K0X A;  1L0I A;  2N5I A;  3NY7 B;  2KG6 A;  2L22 A;  1DV5 A;  2K2Q A;  4BPH A;  2LML A;  4H2Y C;  2AVA A;  5HVC A;  4MRT C;  5HV8 A;  4BPG A;  2FVA A;  2LIW A;  2XZ0 D;  2K93 A;  2KR5 A;  1F80 D;  1L0H A;  2LOL A;  3EJB A;  2CQ8 A;  2N6Z A;  2X2B A;  2KGD A;  1AF8 A;  2LIU A; 
#chains in the Genus database with same CATH topology
 2M5R A;  2PEK A;  2AF8 A;  1KQS O;  4U0A A;  4R0M A;  2XT1 A;  2N6Y A;  4XRQ A;  2LKI A;  4IPY A;  3CCV P;  1GXH A;  4H2X C;  1QVG O;  2FVF A;  2EHS A;  2XXM A;  3CE7 A;  2JYL A;  2JAZ A;  3EJD A;  2ROQ A;  2L4B A;  3E2D A;  3G28 A;  2CNR A;  2EFJ A;  1KC8 Q;  1HY8 A;  3CXC O;  2CWO A;  2K0Y A;  1VQ8 P;  1CEI A;  2JBG A;  3CCR P;  2GZI A;  1EMV A;  1MZ8 A;  1VQ9 P;  1FR2 A;  2KOS A;  2VLO A;  1NJI Q;  2PEN A;  1GXG A;  1ACP A;  1X3O A;  3G1I A;  3CD6 P;  2JQ4 A;  3G4S P;  1HQB A;  2VLN A;  5F2O A;  2E1M A;  2Z45 A;  2PNG A;  3DPH A;  2M8N A;  2KG9 A;  4DG9 A;  1OR5 A;  2L9F A;  3LMO A;  1E0H A;  5EW5 E;  1RO2 A;  1A8O A;  5F2K A;  1AUM A;  3G71 P;  1VQP P;  2GYK A;  2JU2 A;  2KG6 A;  3GJN A;  4COP A;  1EOQ A;  4MRT C;  3CC4 P;  3HZQ A;  1L0H A;  1VQL P;  5HGN A;  2CQ8 A;  3CCS P;  1YJN P;  2QA4 P;  5BS2 A;  2QEX P;  1M74 A;  2LF4 A;  1IMQ A;  2Z46 A;  5KP7 B;  2XZ1 C;  2K5X A;  2MVU A;  4XFX A;  1EIA A;  5BS1 A;  2N98 A;  2K92 A;  2P9X A;  2L6E A;  2FAD A;  2FQ2 A;  2FQ0 A;  4U0C A;  5KP6 B;  3CCE P;  1VQN P;  2MY5 A;  3CCL P;  2JU1 A;  1YHQ P;  3B4Q A;  4BPF A;  1Q7Y Q;  3P05 A;  5CZD B;  2FHS C;  3DS2 A;  1S72 P;  4NEO A;  1RO0 A;  2KOQ A;  1JJ2 O;  3DS3 A;  2PEJ A;  1RNI A;  2CGQ A;  3CMA P;  1VQ6 P;  1K30 A;  3H4E A;  3I56 P;  1ZMB A;  4PWV B;  3GZL A;  2VLQ A;  2DNW A;  2KGC A;  3CC2 P;  2K0D X;  3WBH A;  1QRJ A;  1KLP A;  2GDW A;  3H0D A;  2MR8 A;  1KD1 Q;  2EHT A;  3DS0 A;  3I55 P;  2PEI A;  2K0X A;  3G21 A;  1L0I A;  4PH0 A;  4QKO A;  1K9M Q;  2K2Q A;  2JYG A;  3G0V A;  1YI2 P;  4GR6 A;  2BHV A;  2GZG A;  4WYM A;  1M1K Q;  2AVA A;  4BPG A;  2BUO A;  3EJB A;  4PH1 A;  1YIT P;  1BAJ A;  2X2B A;  4GR2 A;  1W2B O;  1GPJ A;  5HGO A;  1ZNV A;  2KWL A;  2GZJ A;  2KGE A;  5F2N A;  3CCU P;  4XRO A;  4M0I A;  2KOD A;  4U0E A;  2OAR A;  4HKG A;  2DGY A;  4XFY A;  1AYI A;  2EIA A;  1DNY A;  2CG5 B;  4QNB A;  3G1G A;  2MVV A;  1D1D A;  5HGL A;  1YIJ P;  3H47 A;  3GKL C;  1BXI A;  2KGA A;  2OTJ P;  2Z44 A;  1K8A Q;  1UJZ A;  2PEM A;  1YJ9 P;  3RG6 C;  5DCK A;  2PEQ A;  2KW2 A;  1VKU A;  2GDX A;  2PY8 A;  4F37 A;  3Q20 A;  2MF4 A;  2K94 A;  2KG8 A;  1IUQ A;  2AFD A;  3CPW O;  2ERH A;  4COC A;  2N5H A;  3U43 A;  1UNK A;  1A43 A;  4UHP B;  1VQ7 P;  3EJE A;  2ONT A;  5JPA A;  2FAC A;  5I4T G;  2MD9 A;  2M8P A;  1VQ5 P;  3CCM P;  1YJW P;  1T8K A;  2PEO A;  3DTJ A;  3DS5 A;  3RG2 A;  7CEI A;  3LRY A;  4U0B A;  4BPH A;  2EG5 A;  4H2Y C;  5HVC A;  4U0F A;  5HV8 A;  3CC7 P;  2FVA A;  2LIW A;  3G26 A;  2K93 A;  1F80 D;  2N6Z A;  3G29 A;  1AF8 A;  2VLP A;  2LPK A;  1QVF O;  2VSQ A;  3M1M A;  2FVE A;  2N50 A;  1Z6M A;  2KOP A;  4PXH B;  2MR7 A;  2KOO A;  2L0Q A;  2LTE A;  1Q86 Q;  2NO8 A;  4H2W C;  1M6E X;  2OTL P;  1VQK P;  2GDY A;  5KP8 B;  3VRL C;  3HYB A;  1IMP A;  1VHN A;  3GZM A;  2JB0 A;  4XFZ A;  2WPT A;  4CA3 A;  5EJD A;  2FAE A;  1M90 Q;  2LL8 A;  2JO0 A;  2GZE A;  2FQ1 A;  3DS1 A;  1E6J P;  3CCQ P;  3CCJ P;  2KOR A;  1NQ4 A;  2QNW A;  3OW2 O;  2GZF A;  3G6E P;  2M8L A;  1K73 Q;  3MGE A;  4IZ6 A;  2AFE A;  2JGP A;  1Q82 Q;  1M6N A;  1VQM P;  1N8R Q;  2N5I A;  3NY7 B;  5HGM A;  1Q81 Q;  2L22 A;  1VQO P;  3B5I A;  1DV5 A;  3DS4 A;  2LML A;  2XV6 A;  3NTE A;  3CME P;  2XZ0 D;  2KR5 A;  2LOL A;  2KGD A;  2LIU A;  4U0D A;  1VQ4 P; 
#chains in the Genus database with same CATH homology
 2M5R A;  2AF8 A;  4R0M A;  2KWL A;  2KGE A;  5KP7 B;  2XZ1 C;  2LPK A;  2N6Y A;  2MVU A;  2LKI A;  2VSQ A;  4H2X C;  2N98 A;  2FVE A;  2FVF A;  2EHS A;  3CE7 A;  2N50 A;  2K92 A;  4HKG A;  2KOP A;  2FAD A;  3EJD A;  4PXH B;  1DNY A;  2ROQ A;  2CG5 B;  2MR7 A;  2FQ2 A;  2FQ0 A;  5KP6 B;  2L4B A;  2KOO A;  2L0Q A;  2LTE A;  2MY5 A;  2CNR A;  1HY8 A;  2JU1 A;  2MVV A;  4BPF A;  2K0Y A;  4H2W C;  2KGA A;  5CZD B;  2FHS C;  4NEO A;  2GDY A;  5KP8 B;  2KOS A;  3GZM A;  2KOQ A;  4CA3 A;  5EJD A;  2KW2 A;  1VKU A;  2FAE A;  2GDX A;  2CGQ A;  1X3O A;  1ACP A;  2LL8 A;  2MF4 A;  2JQ4 A;  2K94 A;  1HQB A;  2FQ1 A;  2KG8 A;  2AFD A;  2N5H A;  4PWV B;  3GZL A;  2PNG A;  2DNW A;  2KGC A;  3EJE A;  2KG9 A;  2FAC A;  2KOR A;  4DG9 A;  1NQ4 A;  1OR5 A;  2QNW A;  2MD9 A;  2L9F A;  3LMO A;  1KLP A;  2GDW A;  4IZ6 A;  1T8K A;  2AFE A;  2MR8 A;  2JGP A;  2EHT A;  3RG2 A;  2JU2 A;  2K0X A;  1L0I A;  2N5I A;  3NY7 B;  2KG6 A;  2L22 A;  1DV5 A;  2K2Q A;  4BPH A;  2LML A;  4H2Y C;  2AVA A;  5HVC A;  4MRT C;  5HV8 A;  4BPG A;  2FVA A;  2LIW A;  2XZ0 D;  2K93 A;  2KR5 A;  1F80 D;  1L0H A;  2LOL A;  3EJB A;  2CQ8 A;  2N6Z A;  2X2B A;  2KGD A;  1AF8 A;  2LIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...