2PNGA

Type i rat fatty acid synthase acyl carrier protein (acp) domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
89
structure length
89
Chain Sequence
GDGEAQRDLVKAVAHILGIRDLAGINLDSSLADLGLDSLMGVEVRQILEREHDLVLPIREVRQLTLRKLQEMSSKAGSDTELAAPKSKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Fatty acid synthase (EC 2.3.1.85)
publication title A Mammalian type I Fatty Acid synthase acyl carrier protein domain does not sequester acyl chains.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 17
structure length 89
sequence length 89
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2pngA01
2FQ1A 2LMLA 2LKIA 1OR5A 1DV5A 2FQ2A 2FVAA 2N5IA 1F80D 2EHSA 2LPKA 3EJBA 2ROQA 1AF8A 3RG2A 2X2BA 1DNYA 2FHSC 4IZ6A 2FAEA 2JQ4A 2FQ0A 2KOQA 3EJEA 2KR5A 2MD9A 5KP7B 4PWVB 2MR8A 2LOLA 1KLPA 2MVUA 2CGQA 2PNGA 1T8KA 3LMOA 4MRTC 5EJDA 4H2YC 4NEOA 2N6ZA 2AVAA 2N50A 2CG5B 3GZMA 1VKUA 2QNWA 5KP6B 3GZLA 2K92A 2N5HA 2KG9A 2FVFA 2JU2A 5CZDB 2N6YA 2KGAA 2KOPA 2N98A 2EHTA 1HY8A 1X3OA 4PXHB 2VSQA 5KP8B 2LTEA 2FADA 2KGEA 5HV8A 2FACA 2K93A 2KG6A 2K0XA 2MF4A 3EJDA 4HKGA 2MVVA 2CQ8A 2KW2A 2FVEA 2XZ0D 4H2XC 2CNRA 2GDXA 2L0QA 2KG8A 2KORA 2DNWA 2K0YA 2KWLA 4BPHA 4CA3A 2JGPA 3CE7A 2KOOA 4DG9A 2KOSA 4BPGA 1L0IA 1ACPA 3NY7B 2GDWA 2XZ1C 4BPFA 1HQBA 2JU1A 2L4BA 5HVCA 2L9FA 2GDYA 4H2WC 1L0HA 2KGCA 4R0MA 2MR7A 2K94A 2AFEA 2M5RA 2LIUA 2L22A 2K2QA 1NQ4A 2AFDA 2LL8A 2AF8A 2KGDA 2MY5A 2LIWA
chains in the Genus database with same CATH superfamily
1A43A 2FQ1A 5HGMA 2X2BA 3DS2A 3P05A 2ERHA 2PY8A 2FQ0A 3DS4A 1VQ4P 4PWVB 1IMPA 2LOLA 1A8OA 2VLPA 2AVAA 3CCRP 3GZMA 1VKUA 3CCLP 3HYBA 3CCVP 2GZFA 2KG9A 2FVFA 2JU2A 1K30A 2JB0A 1IUQA 2N6YA 2KGAA 3CCSP 2EHTA 1K8AQ 2OARA 2GZIA 4U0BA 2VLNA 2FADA 1YIJP 3RG6C 1KD1Q 4XFXA 2FACA 3U43A 2KG6A 2MF4A 4XROA 2MVVA 3G21A 2FVEA 1YI2P 3G0VA 1M6EX 2EIAA 1YHQP 1VQ5P 1JJ2O 1VQPP 4BPGA 4U0EA 1D1DA 2GDWA 1S72P 2VLQA 2GDYA 1Q82Q 1RO2A 3CC2P 3HZQA 3G71P 4H2WC 2WPTA 1L0HA 2K94A 2AFEA 4QNBA 2PEKA 1VHNA 1K73Q 2MY5A 4PH0A 4U0AA 4U0FA 2DGYA 2LKIA 1DV5A 2FQ2A 1NJIQ 2N5IA 2EHSA 2LPKA 5F2NA 2M8LA 1Z6MA 1VQOP 2FAEA 2JYLA 5KP7B 5DCKA 2Z45A 2CGQA 3LMOA 4GR6A 5I4TG 4H2YC 1CEIA 2N50A 4XFYA 3CC7P 3G1GA 1E0HA 1VQKP 1M90Q 2GZJA 2K92A 1UNKA 4M0IA 3CCMP 3E2DA 4U0CA 1K9MQ 1M74A 2KOPA 2LF4A 3H47A 2LTEA 2E1MA 2QEXP 2KGEA 2PEJA 4PH1A 3G29A 5HV8A 2K93A 1GXHA 2XZ0D 3DS3A 3CCQP 2DNWA 3H0DA 4UHPB 2KWLA 2PEQA 3CE7A 4DG9A 3CMEP 2KOSA 3MGEA 1ACPA 2VLOA 2JBGA 1KC8Q 2JU1A 2L4BA 1Q7YQ 2K0DX 1VQ9P 2K5XA 1MZ8A 2KGCA 3DS1A 1EMVA 3DS5A 1VQMP 1EIAA 2AF8A 2KGDA 2KOQA 3B4QA 1OR5A 1VQ7P 3EJBA 4IPYA 1AF8A 2PEOA 3CCEP 4IZ6A 2KR5A 2MR8A 1T8KA 2GYKA 4MRTC 3Q20A 5EJDA 3LRYA 1W2BO 2N6ZA 1QRJA 2CG5B 2L6EA 5KP6B 3M1MA 5HGLA 5JPAA 2N98A 2Z44A 2BHVA 2VSQA 1GPJA 2JYGA 2PEMA 1VQLP 2M8NA 3CD6P 3DPHA 5F2OA 2K0XA 4HKGA 4GR2A 2XXMA 1ZMBA 1M6NA 3G26A 4H2XC 2BUOA 2GDXA 3I56P 1Q81Q 1E6JP 4CA3A 3CC4P 2JGPA 2QA4P 2KOOA 3G1IA 5BS1A 2JO0A 3VRLC 2NO8A 1M1KQ 3OW2O 1HQBA 1QVGO 5HVCA 1BXIA 1RO0A 1IMQA 1YJNP 2LIUA 2L22A 4COCA 2EG5A 3G4SP 2K2QA 1NQ4A 1ZNVA 2XV6A 4XFZA 3DTJA 3H4EA 3CPWO 2LMLA 2FVAA 1F80D 3G6EP 2ROQA 5HGNA 3RG2A 3GJNA 1DNYA 2FHSC 2JAZA 2JQ4A 2GZGA 3EJEA 2OTLP 3CMAP 2MD9A 1KLPA 2MVUA 4WYMA 2PNGA 1YITP 5EW5E 1Q86Q 3I55P 3WBHA 4NEOA 3CCUP 5HGOA 4XRQA 3CCJP 1BAJA 2QNWA 3GZLA 2N5HA 3GKLC 4U0DA 5CZDB 1AUMA 7CEIA 1HY8A 1X3OA 4PXHB 5KP8B 2CWOA 2OTJP 3NTEA 3CXCO 3EJDA 3DS0A 1RNIA 2PENA 2CQ8A 2KW2A 4QKOA 4COPA 1AYIA 2CNRA 2ONTA 2L0QA 2KG8A 2KODA 2KORA 3B5IA 2K0YA 4BPHA 2PEIA 2XT1A 1YJ9P 1L0IA 3NY7B 1KQSO 2XZ1C 5BS2A 4BPFA 5F2KA 2Z46A 3G28A 2L9FA 1QVFO 1VQNP 1N8RQ 2P9XA 4R0MA 2MR7A 4F37A 1VQ8P 2M5RA 1GXGA 1FR2A 2EFJA 2GZEA 2AFDA 2LL8A 2M8PA 1YJWP 1EOQA 1UJZA 1VQ6P 2LIWA
chains in the Genus database with same CATH topology
2FQ1A 2LMLA 2LKIA 1OR5A 1DV5A 2FQ2A 2FVAA 2N5IA 1F80D 2EHSA 2LPKA 3EJBA 2ROQA 1AF8A 3RG2A 2X2BA 1DNYA 2FHSC 4IZ6A 2FAEA 2JQ4A 2FQ0A 2KOQA 3EJEA 2KR5A 2MD9A 5KP7B 4PWVB 2MR8A 2LOLA 1KLPA 2MVUA 2CGQA 2PNGA 1T8KA 3LMOA 4MRTC 5EJDA 4H2YC 4NEOA 2N6ZA 2AVAA 2N50A 2CG5B 3GZMA 1VKUA 2QNWA 5KP6B 3GZLA 2K92A 2N5HA 2KG9A 2FVFA 2JU2A 5CZDB 2N6YA 2KGAA 2KOPA 2N98A 2EHTA 1HY8A 1X3OA 4PXHB 2VSQA 5KP8B 2LTEA 2FADA 2KGEA 5HV8A 2FACA 2K93A 2KG6A 2K0XA 2MF4A 3EJDA 4HKGA 2MVVA 2CQ8A 2KW2A 2FVEA 2XZ0D 4H2XC 2CNRA 2GDXA 2L0QA 2KG8A 2KORA 2DNWA 2K0YA 2KWLA 4BPHA 4CA3A 2JGPA 3CE7A 2KOOA 4DG9A 2KOSA 4BPGA 1L0IA 1ACPA 3NY7B 2GDWA 2XZ1C 4BPFA 1HQBA 2JU1A 2L4BA 5HVCA 2L9FA 2GDYA 4H2WC 1L0HA 2KGCA 4R0MA 2MR7A 2K94A 2AFEA 2M5RA 2LIUA 2L22A 2K2QA 1NQ4A 2AFDA 2LL8A 2AF8A 2KGDA 2MY5A 2LIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FQ1 A;  2LML A;  2LKI A;  1OR5 A;  1DV5 A;  2FQ2 A;  2FVA A;  2N5I A;  1F80 D;  2EHS A;  2LPK A;  3EJB A;  2ROQ A;  1AF8 A;  3RG2 A;  2X2B A;  1DNY A;  2FHS C;  4IZ6 A;  2FAE A;  2JQ4 A;  2FQ0 A;  2KOQ A;  3EJE A;  2KR5 A;  2MD9 A;  5KP7 B;  4PWV B;  2MR8 A;  2LOL A;  1KLP A;  2MVU A;  2CGQ A;  2PNG A;  1T8K A;  3LMO A;  4MRT C;  5EJD A;  4H2Y C;  4NEO A;  2N6Z A;  2AVA A;  2N50 A;  2CG5 B;  3GZM A;  1VKU A;  2QNW A;  5KP6 B;  3GZL A;  2K92 A;  2N5H A;  2KG9 A;  2FVF A;  2JU2 A;  5CZD B;  2N6Y A;  2KGA A;  2KOP A;  2N98 A;  2EHT A;  1HY8 A;  1X3O A;  4PXH B;  2VSQ A;  5KP8 B;  2LTE A;  2FAD A;  2KGE A;  5HV8 A;  2FAC A;  2K93 A;  2KG6 A;  2K0X A;  2MF4 A;  3EJD A;  4HKG A;  2MVV A;  2CQ8 A;  2KW2 A;  2FVE A;  2XZ0 D;  4H2X C;  2CNR A;  2GDX A;  2L0Q A;  2KG8 A;  2KOR A;  2DNW A;  2K0Y A;  2KWL A;  4BPH A;  4CA3 A;  2JGP A;  3CE7 A;  2KOO A;  4DG9 A;  2KOS A;  4BPG A;  1L0I A;  1ACP A;  3NY7 B;  2GDW A;  2XZ1 C;  4BPF A;  1HQB A;  2JU1 A;  2L4B A;  5HVC A;  2L9F A;  2GDY A;  4H2W C;  1L0H A;  2KGC A;  4R0M A;  2MR7 A;  2K94 A;  2AFE A;  2M5R A;  2LIU A;  2L22 A;  2K2Q A;  1NQ4 A;  2AFD A;  2LL8 A;  2AF8 A;  2KGD A;  2MY5 A;  2LIW A; 
#chains in the Genus database with same CATH topology
 1A43 A;  2FQ1 A;  5HGM A;  2X2B A;  3DS2 A;  3P05 A;  2ERH A;  2PY8 A;  2FQ0 A;  3DS4 A;  1VQ4 P;  4PWV B;  1IMP A;  2LOL A;  1A8O A;  2VLP A;  2AVA A;  3CCR P;  3GZM A;  1VKU A;  3CCL P;  3HYB A;  3CCV P;  2GZF A;  2KG9 A;  2FVF A;  2JU2 A;  1K30 A;  2JB0 A;  1IUQ A;  2N6Y A;  2KGA A;  3CCS P;  2EHT A;  1K8A Q;  2OAR A;  2GZI A;  4U0B A;  2VLN A;  2FAD A;  1YIJ P;  3RG6 C;  1KD1 Q;  4XFX A;  2FAC A;  3U43 A;  2KG6 A;  2MF4 A;  4XRO A;  2MVV A;  3G21 A;  2FVE A;  1YI2 P;  3G0V A;  1M6E X;  2EIA A;  1YHQ P;  1VQ5 P;  1JJ2 O;  1VQP P;  4BPG A;  4U0E A;  1D1D A;  2GDW A;  1S72 P;  2VLQ A;  2GDY A;  1Q82 Q;  1RO2 A;  3CC2 P;  3HZQ A;  3G71 P;  4H2W C;  2WPT A;  1L0H A;  2K94 A;  2AFE A;  4QNB A;  2PEK A;  1VHN A;  1K73 Q;  2MY5 A;  4PH0 A;  4U0A A;  4U0F A;  2DGY A;  2LKI A;  1DV5 A;  2FQ2 A;  1NJI Q;  2N5I A;  2EHS A;  2LPK A;  5F2N A;  2M8L A;  1Z6M A;  1VQO P;  2FAE A;  2JYL A;  5KP7 B;  5DCK A;  2Z45 A;  2CGQ A;  3LMO A;  4GR6 A;  5I4T G;  4H2Y C;  1CEI A;  2N50 A;  4XFY A;  3CC7 P;  3G1G A;  1E0H A;  1VQK P;  1M90 Q;  2GZJ A;  2K92 A;  1UNK A;  4M0I A;  3CCM P;  3E2D A;  4U0C A;  1K9M Q;  1M74 A;  2KOP A;  2LF4 A;  3H47 A;  2LTE A;  2E1M A;  2QEX P;  2KGE A;  2PEJ A;  4PH1 A;  3G29 A;  5HV8 A;  2K93 A;  1GXH A;  2XZ0 D;  3DS3 A;  3CCQ P;  2DNW A;  3H0D A;  4UHP B;  2KWL A;  2PEQ A;  3CE7 A;  4DG9 A;  3CME P;  2KOS A;  3MGE A;  1ACP A;  2VLO A;  2JBG A;  1KC8 Q;  2JU1 A;  2L4B A;  1Q7Y Q;  2K0D X;  1VQ9 P;  2K5X A;  1MZ8 A;  2KGC A;  3DS1 A;  1EMV A;  3DS5 A;  1VQM P;  1EIA A;  2AF8 A;  2KGD A;  2KOQ A;  3B4Q A;  1OR5 A;  1VQ7 P;  3EJB A;  4IPY A;  1AF8 A;  2PEO A;  3CCE P;  4IZ6 A;  2KR5 A;  2MR8 A;  1T8K A;  2GYK A;  4MRT C;  3Q20 A;  5EJD A;  3LRY A;  1W2B O;  2N6Z A;  1QRJ A;  2CG5 B;  2L6E A;  5KP6 B;  3M1M A;  5HGL A;  5JPA A;  2N98 A;  2Z44 A;  2BHV A;  2VSQ A;  1GPJ A;  2JYG A;  2PEM A;  1VQL P;  2M8N A;  3CD6 P;  3DPH A;  5F2O A;  2K0X A;  4HKG A;  4GR2 A;  2XXM A;  1ZMB A;  1M6N A;  3G26 A;  4H2X C;  2BUO A;  2GDX A;  3I56 P;  1Q81 Q;  1E6J P;  4CA3 A;  3CC4 P;  2JGP A;  2QA4 P;  2KOO A;  3G1I A;  5BS1 A;  2JO0 A;  3VRL C;  2NO8 A;  1M1K Q;  3OW2 O;  1HQB A;  1QVG O;  5HVC A;  1BXI A;  1RO0 A;  1IMQ A;  1YJN P;  2LIU A;  2L22 A;  4COC A;  2EG5 A;  3G4S P;  2K2Q A;  1NQ4 A;  1ZNV A;  2XV6 A;  4XFZ A;  3DTJ A;  3H4E A;  3CPW O;  2LML A;  2FVA A;  1F80 D;  3G6E P;  2ROQ A;  5HGN A;  3RG2 A;  3GJN A;  1DNY A;  2FHS C;  2JAZ A;  2JQ4 A;  2GZG A;  3EJE A;  2OTL P;  3CMA P;  2MD9 A;  1KLP A;  2MVU A;  4WYM A;  2PNG A;  1YIT P;  5EW5 E;  1Q86 Q;  3I55 P;  3WBH A;  4NEO A;  3CCU P;  5HGO A;  4XRQ A;  3CCJ P;  1BAJ A;  2QNW A;  3GZL A;  2N5H A;  3GKL C;  4U0D A;  5CZD B;  1AUM A;  7CEI A;  1HY8 A;  1X3O A;  4PXH B;  5KP8 B;  2CWO A;  2OTJ P;  3NTE A;  3CXC O;  3EJD A;  3DS0 A;  1RNI A;  2PEN A;  2CQ8 A;  2KW2 A;  4QKO A;  4COP A;  1AYI A;  2CNR A;  2ONT A;  2L0Q A;  2KG8 A;  2KOD A;  2KOR A;  3B5I A;  2K0Y A;  4BPH A;  2PEI A;  2XT1 A;  1YJ9 P;  1L0I A;  3NY7 B;  1KQS O;  2XZ1 C;  5BS2 A;  4BPF A;  5F2K A;  2Z46 A;  3G28 A;  2L9F A;  1QVF O;  1VQN P;  1N8R Q;  2P9X A;  4R0M A;  2MR7 A;  4F37 A;  1VQ8 P;  2M5R A;  1GXG A;  1FR2 A;  2EFJ A;  2GZE A;  2AFD A;  2LL8 A;  2M8P A;  1YJW P;  1EOQ A;  1UJZ A;  1VQ6 P;  2LIW A; 
#chains in the Genus database with same CATH homology
 2FQ1 A;  2LML A;  2LKI A;  1OR5 A;  1DV5 A;  2FQ2 A;  2FVA A;  2N5I A;  1F80 D;  2EHS A;  2LPK A;  3EJB A;  2ROQ A;  1AF8 A;  3RG2 A;  2X2B A;  1DNY A;  2FHS C;  4IZ6 A;  2FAE A;  2JQ4 A;  2FQ0 A;  2KOQ A;  3EJE A;  2KR5 A;  2MD9 A;  5KP7 B;  4PWV B;  2MR8 A;  2LOL A;  1KLP A;  2MVU A;  2CGQ A;  2PNG A;  1T8K A;  3LMO A;  4MRT C;  5EJD A;  4H2Y C;  4NEO A;  2N6Z A;  2AVA A;  2N50 A;  2CG5 B;  3GZM A;  1VKU A;  2QNW A;  5KP6 B;  3GZL A;  2K92 A;  2N5H A;  2KG9 A;  2FVF A;  2JU2 A;  5CZD B;  2N6Y A;  2KGA A;  2KOP A;  2N98 A;  2EHT A;  1HY8 A;  1X3O A;  4PXH B;  2VSQ A;  5KP8 B;  2LTE A;  2FAD A;  2KGE A;  5HV8 A;  2FAC A;  2K93 A;  2KG6 A;  2K0X A;  2MF4 A;  3EJD A;  4HKG A;  2MVV A;  2CQ8 A;  2KW2 A;  2FVE A;  2XZ0 D;  4H2X C;  2CNR A;  2GDX A;  2L0Q A;  2KG8 A;  2KOR A;  2DNW A;  2K0Y A;  2KWL A;  4BPH A;  4CA3 A;  2JGP A;  3CE7 A;  2KOO A;  4DG9 A;  2KOS A;  4BPG A;  1L0I A;  1ACP A;  3NY7 B;  2GDW A;  2XZ1 C;  4BPF A;  1HQB A;  2JU1 A;  2L4B A;  5HVC A;  2L9F A;  2GDY A;  4H2W C;  1L0H A;  2KGC A;  4R0M A;  2MR7 A;  2K94 A;  2AFE A;  2M5R A;  2LIU A;  2L22 A;  2K2Q A;  1NQ4 A;  2AFD A;  2LL8 A;  2AF8 A;  2KGD A;  2MY5 A;  2LIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...