2PNGA

Type i rat fatty acid synthase acyl carrier protein (acp) domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
89
structure length
89
Chain Sequence
b'GDGEAQRDLVKAVAHILGIRDLAGINLDSSLADLGLDSLMGVEVRQILEREHDLVLPIREVRQLTLRKLQEMSSKAGSDTELAAPKSKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fatty acid synthase (EC 2.3.1.85)
publication title A Mammalian type I Fatty Acid synthase acyl carrier protein domain does not sequester acyl chains.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 17
structure length 89
sequence length 89
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2007-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2pngA01
1DNYA 3LMOA 2KORA 2JU2A 2KOQA 5KP8B 3EJDA 2KGDA 3GZMA 5HV8A 4MRTC 2L0QA 4H2YC 1KLPA 2LPKA 2EHTA 2KGAA 2L22A 2K0XA 1HY8A 2LIUA 2MR7A 4BPGA 2K2QA 2AFDA 2MY5A 5HVCA 2FQ0A 2M5RA 2FACA 2X2BA 4BPHA 1DV5A 2KOPA 2CG5B 2FQ2A 2N6ZA 2CNRA 4PWVB 4PXHB 2CGQA 2K0YA 5KP6B 2AF8A 2L4BA 2FQ1A 1F80D 4H2WC 2GDWA 4DG9A 2AVAA 3EJBA 5KP7B 2K94A 1OR5A 2DNWA 2KG6A 2EHSA 1L0HA 2K93A 2LKIA 2FVAA 2LOLA 1T8KA 4NEOA 2JGPA 2N5HA 2LIWA 2AFEA 2N5IA 3CE7A 3RG2A 4HKGA 2QNWA 5EJDA 3EJEA 2KW2A 3NY7B 1VKUA 2FHSC 2VSQA 2MR8A 2MVUA 1X3OA 2JQ4A 2MF4A 2JU1A 2KOOA 2FVFA 2GDXA 1HQBA 2MD9A 3GZLA 2KGEA 2LTEA 4H2XC 2L9FA 2LL8A 2XZ1C 2MVVA 2XZ0D 5CZDB 2FVEA 2KWLA 4CA3A 1ACPA 4IZ6A 2ROQA 2KG8A 4R0MA 2N98A 2FAEA 1L0IA 4BPFA 2KG9A 1NQ4A 2LMLA 2FADA 2KOSA 2KR5A 2GDYA 2KGCA 2PNGA 2CQ8A 2N6YA 2K92A 2N50A 1AF8A
chains in the Genus database with same CATH superfamily
5BS2A 2EG5A 1VQ8P 1Z6MA 1A43A 3G21A 3GZMA 5HV8A 1VQ6P 1EMVA 2LPKA 2EHTA 3DS5A 2LIUA 2LF4A 2AFDA 4PH1A 2GZIA 2MY5A 1N8RQ 3DS4A 4BPHA 1EIAA 1DV5A 3G0VA 2N6ZA 3GJNA 4U0AA 3G29A 4WYMA 2OTJP 2M8PA 4GR2A 5KP7B 2KG6A 4XROA 2ONTA 2FVAA 1T8KA 1IUQA 3CE7A 4COCA 3RG2A 1RO2A 3G4SP 2QNWA 4IPYA 3EJEA 1VKUA 4U0BA 1X3OA 1VQLP 2JYLA 2KODA 1HQBA 1VHNA 2PEJA 1KQSO 2LTEA 4H2XC 1VQ7P 2LL8A 2XZ1C 2MVVA 2FVEA 2PEOA 4QKOA 1M6EX 2ROQA 2KG8A 2FAEA 1GXHA 4U0EA 4BPFA 3CCLP 2KOSA 2KR5A 2GDYA 3CCUP 1M90Q 2KGCA 2PNGA 2CQ8A 1ZMBA 1KC8Q 1DNYA 2KOQA 3CCQP 3DTJA 2BHVA 2GZJA 5EW5E 1E6JP 1UJZA 2KGAA 2L22A 4BPGA 2BUOA 2K2QA 3CCEP 4XFXA 2PEMA 7CEIA 2FACA 1M1KQ 3I56P 2CGQA 2K0YA 2CWOA 5KP6B 1BAJA 2AF8A 1YJWP 4H2WC 2GDWA 2QA4P 3H47A 3EJBA 5F2NA 3CCJP 1OR5A 5F2OA 2GYKA 1L0HA 1Q82Q 4XFYA 2LOLA 1K9MQ 1W2BO 2N5HA 2LIWA 1AYIA 1GPJA 2N5IA 3WBHA 2KW2A 1VQKP 3DPHA 2FHSC 2MVUA 1VQ4P 2JQ4A 5HGNA 2FVFA 1K73Q 1A8OA 2GDXA 2VLPA 2MD9A 2L9FA 3CPWO 2Z46A 1M74A 1ACPA 2XT1A 1MZ8A 2Z44A 1FR2A 4XRQA 2K0DX 1Q7YQ 1L0IA 3B4QA 3G71P 2KG9A 1NQ4A 2JBGA 1GXGA 1VQOP 5JPAA 3LMOA 2EIAA 2L6EA 2PEKA 5KP8B 3H0DA 1YJNP 1EOQA 3EJDA 3U43A 3M1MA 4MRTC 4H2YC 1KLPA 3Q20A 2M8LA 2JO0A 2K0XA 1HY8A 5DCKA 3B5IA 1VQMP 1Q81Q 5HVCA 4COPA 2GZGA 3CMAP 3CCVP 2X2BA 3I55P 2KOPA 2CG5B 2CNRA 4M0IA 4PWVB 4PXHB 3DS1A 1RO0A 3CD6P 3HZQA 1YHQP 4QNBA 4DG9A 1VQNP 2DGYA 2XV6A 2EHSA 2K93A 2LKIA 2NO8A 3LRYA 2GZFA 3G1GA 4HKGA 3NY7B 2VSQA 2MR8A 5HGOA 1VQ9P 1UNKA 2JU1A 2XXMA 2KOOA 3RG6C 2Z45A 1AUMA 1M6NA 2OTLP 2E1MA 5CZDB 1YITP 2KWLA 3CC7P 1ZNVA 2VLNA 4GR6A 2OARA 3GKLC 2LMLA 3G6EP 1VQPP 1KD1Q 3CCSP 2K92A 2QEXP 1YIJP 1AF8A 5F2KA 3DS2A 2KORA 2JU2A 1QVGO 3HYBA 1YI2P 2KGDA 2L0QA 1JJ2O 2JYGA 4U0CA 2PY8A 2JB0A 2MR7A 1BXIA 2GZEA 1D1DA 1VQ5P 1RNIA 4F37A 2FQ0A 2ERHA 2M5RA 5I4TG 4UHPB 3CCRP 2FQ2A 2VLOA 4U0FA 2EFJA 1K30A 3DS3A 2PEQA 2L4BA 4PH0A 2FQ1A 1CEIA 1F80D 2JAZA 1QRJA 2AVAA 2WPTA 1IMPA 4U0DA 2P9XA 2K94A 3E2DA 2DNWA 5HGLA 3MGEA 4NEOA 2JGPA 2VLQA 2AFEA 1S72P 5BS1A 3DS0A 3G28A 3P05A 5EJDA 1IMQA 3H4EA 3CC2P 1E0HA 2MF4A 3CXCO 2M8NA 1K8AQ 1Q86Q 3CC4P 3G1IA 3GZLA 2K5XA 2KGEA 3OW2O 2PEIA 5HGMA 2XZ0D 4CA3A 3NTEA 4XFZA 3CMEP 4IZ6A 1QVFO 3G26A 4R0MA 2N98A 3VRLC 1YJ9P 1NJIQ 2FADA 3CCMP 2PENA 2N6YA 2N50A
chains in the Genus database with same CATH topology
1DNYA 3LMOA 2KORA 2JU2A 2KOQA 5KP8B 3EJDA 2KGDA 3GZMA 5HV8A 4MRTC 2L0QA 4H2YC 1KLPA 2LPKA 2EHTA 2KGAA 2L22A 2K0XA 1HY8A 2LIUA 2MR7A 4BPGA 2K2QA 2AFDA 2MY5A 5HVCA 2FQ0A 2M5RA 2FACA 2X2BA 4BPHA 1DV5A 2KOPA 2CG5B 2FQ2A 2N6ZA 2CNRA 4PWVB 4PXHB 2CGQA 2K0YA 5KP6B 2AF8A 2L4BA 2FQ1A 1F80D 4H2WC 2GDWA 4DG9A 2AVAA 3EJBA 5KP7B 2K94A 1OR5A 2DNWA 2KG6A 2EHSA 1L0HA 2K93A 2LKIA 2FVAA 2LOLA 1T8KA 4NEOA 2JGPA 2N5HA 2LIWA 2AFEA 2N5IA 3CE7A 3RG2A 4HKGA 2QNWA 5EJDA 3EJEA 2KW2A 3NY7B 1VKUA 2FHSC 2VSQA 2MR8A 2MVUA 1X3OA 2JQ4A 2MF4A 2JU1A 2KOOA 2FVFA 2GDXA 1HQBA 2MD9A 3GZLA 2KGEA 2LTEA 4H2XC 2L9FA 2LL8A 2XZ1C 2MVVA 2XZ0D 5CZDB 2FVEA 2KWLA 4CA3A 1ACPA 4IZ6A 2ROQA 2KG8A 4R0MA 2N98A 2FAEA 1L0IA 4BPFA 2KG9A 1NQ4A 2LMLA 2FADA 2KOSA 2KR5A 2GDYA 2KGCA 2PNGA 2CQ8A 2N6YA 2K92A 2N50A 1AF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DNY A;  3LMO A;  2KOR A;  2JU2 A;  2KOQ A;  5KP8 B;  3EJD A;  2KGD A;  3GZM A;  5HV8 A;  4MRT C;  2L0Q A;  4H2Y C;  1KLP A;  2LPK A;  2EHT A;  2KGA A;  2L22 A;  2K0X A;  1HY8 A;  2LIU A;  2MR7 A;  4BPG A;  2K2Q A;  2AFD A;  2MY5 A;  5HVC A;  2FQ0 A;  2M5R A;  2FAC A;  2X2B A;  4BPH A;  1DV5 A;  2KOP A;  2CG5 B;  2FQ2 A;  2N6Z A;  2CNR A;  4PWV B;  4PXH B;  2CGQ A;  2K0Y A;  5KP6 B;  2AF8 A;  2L4B A;  2FQ1 A;  1F80 D;  4H2W C;  2GDW A;  4DG9 A;  2AVA A;  3EJB A;  5KP7 B;  2K94 A;  1OR5 A;  2DNW A;  2KG6 A;  2EHS A;  1L0H A;  2K93 A;  2LKI A;  2FVA A;  2LOL A;  1T8K A;  4NEO A;  2JGP A;  2N5H A;  2LIW A;  2AFE A;  2N5I A;  3CE7 A;  3RG2 A;  4HKG A;  2QNW A;  5EJD A;  3EJE A;  2KW2 A;  3NY7 B;  1VKU A;  2FHS C;  2VSQ A;  2MR8 A;  2MVU A;  1X3O A;  2JQ4 A;  2MF4 A;  2JU1 A;  2KOO A;  2FVF A;  2GDX A;  1HQB A;  2MD9 A;  3GZL A;  2KGE A;  2LTE A;  4H2X C;  2L9F A;  2LL8 A;  2XZ1 C;  2MVV A;  2XZ0 D;  5CZD B;  2FVE A;  2KWL A;  4CA3 A;  1ACP A;  4IZ6 A;  2ROQ A;  2KG8 A;  4R0M A;  2N98 A;  2FAE A;  1L0I A;  4BPF A;  2KG9 A;  1NQ4 A;  2LML A;  2FAD A;  2KOS A;  2KR5 A;  2GDY A;  2KGC A;  2PNG A;  2CQ8 A;  2N6Y A;  2K92 A;  2N50 A;  1AF8 A; 
#chains in the Genus database with same CATH topology
 5BS2 A;  2EG5 A;  1VQ8 P;  1Z6M A;  1A43 A;  3G21 A;  3GZM A;  5HV8 A;  1VQ6 P;  1EMV A;  2LPK A;  2EHT A;  3DS5 A;  2LIU A;  2LF4 A;  2AFD A;  4PH1 A;  2GZI A;  2MY5 A;  1N8R Q;  3DS4 A;  4BPH A;  1EIA A;  1DV5 A;  3G0V A;  2N6Z A;  3GJN A;  4U0A A;  3G29 A;  4WYM A;  2OTJ P;  2M8P A;  4GR2 A;  5KP7 B;  2KG6 A;  4XRO A;  2ONT A;  2FVA A;  1T8K A;  1IUQ A;  3CE7 A;  4COC A;  3RG2 A;  1RO2 A;  3G4S P;  2QNW A;  4IPY A;  3EJE A;  1VKU A;  4U0B A;  1X3O A;  1VQL P;  2JYL A;  2KOD A;  1HQB A;  1VHN A;  2PEJ A;  1KQS O;  2LTE A;  4H2X C;  1VQ7 P;  2LL8 A;  2XZ1 C;  2MVV A;  2FVE A;  2PEO A;  4QKO A;  1M6E X;  2ROQ A;  2KG8 A;  2FAE A;  1GXH A;  4U0E A;  4BPF A;  3CCL P;  2KOS A;  2KR5 A;  2GDY A;  3CCU P;  1M90 Q;  2KGC A;  2PNG A;  2CQ8 A;  1ZMB A;  1KC8 Q;  1DNY A;  2KOQ A;  3CCQ P;  3DTJ A;  2BHV A;  2GZJ A;  5EW5 E;  1E6J P;  1UJZ A;  2KGA A;  2L22 A;  4BPG A;  2BUO A;  2K2Q A;  3CCE P;  4XFX A;  2PEM A;  7CEI A;  2FAC A;  1M1K Q;  3I56 P;  2CGQ A;  2K0Y A;  2CWO A;  5KP6 B;  1BAJ A;  2AF8 A;  1YJW P;  4H2W C;  2GDW A;  2QA4 P;  3H47 A;  3EJB A;  5F2N A;  3CCJ P;  1OR5 A;  5F2O A;  2GYK A;  1L0H A;  1Q82 Q;  4XFY A;  2LOL A;  1K9M Q;  1W2B O;  2N5H A;  2LIW A;  1AYI A;  1GPJ A;  2N5I A;  3WBH A;  2KW2 A;  1VQK P;  3DPH A;  2FHS C;  2MVU A;  1VQ4 P;  2JQ4 A;  5HGN A;  2FVF A;  1K73 Q;  1A8O A;  2GDX A;  2VLP A;  2MD9 A;  2L9F A;  3CPW O;  2Z46 A;  1M74 A;  1ACP A;  2XT1 A;  1MZ8 A;  2Z44 A;  1FR2 A;  4XRQ A;  2K0D X;  1Q7Y Q;  1L0I A;  3B4Q A;  3G71 P;  2KG9 A;  1NQ4 A;  2JBG A;  1GXG A;  1VQO P;  5JPA A;  3LMO A;  2EIA A;  2L6E A;  2PEK A;  5KP8 B;  3H0D A;  1YJN P;  1EOQ A;  3EJD A;  3U43 A;  3M1M A;  4MRT C;  4H2Y C;  1KLP A;  3Q20 A;  2M8L A;  2JO0 A;  2K0X A;  1HY8 A;  5DCK A;  3B5I A;  1VQM P;  1Q81 Q;  5HVC A;  4COP A;  2GZG A;  3CMA P;  3CCV P;  2X2B A;  3I55 P;  2KOP A;  2CG5 B;  2CNR A;  4M0I A;  4PWV B;  4PXH B;  3DS1 A;  1RO0 A;  3CD6 P;  3HZQ A;  1YHQ P;  4QNB A;  4DG9 A;  1VQN P;  2DGY A;  2XV6 A;  2EHS A;  2K93 A;  2LKI A;  2NO8 A;  3LRY A;  2GZF A;  3G1G A;  4HKG A;  3NY7 B;  2VSQ A;  2MR8 A;  5HGO A;  1VQ9 P;  1UNK A;  2JU1 A;  2XXM A;  2KOO A;  3RG6 C;  2Z45 A;  1AUM A;  1M6N A;  2OTL P;  2E1M A;  5CZD B;  1YIT P;  2KWL A;  3CC7 P;  1ZNV A;  2VLN A;  4GR6 A;  2OAR A;  3GKL C;  2LML A;  3G6E P;  1VQP P;  1KD1 Q;  3CCS P;  2K92 A;  2QEX P;  1YIJ P;  1AF8 A;  5F2K A;  3DS2 A;  2KOR A;  2JU2 A;  1QVG O;  3HYB A;  1YI2 P;  2KGD A;  2L0Q A;  1JJ2 O;  2JYG A;  4U0C A;  2PY8 A;  2JB0 A;  2MR7 A;  1BXI A;  2GZE A;  1D1D A;  1VQ5 P;  1RNI A;  4F37 A;  2FQ0 A;  2ERH A;  2M5R A;  5I4T G;  4UHP B;  3CCR P;  2FQ2 A;  2VLO A;  4U0F A;  2EFJ A;  1K30 A;  3DS3 A;  2PEQ A;  2L4B A;  4PH0 A;  2FQ1 A;  1CEI A;  1F80 D;  2JAZ A;  1QRJ A;  2AVA A;  2WPT A;  1IMP A;  4U0D A;  2P9X A;  2K94 A;  3E2D A;  2DNW A;  5HGL A;  3MGE A;  4NEO A;  2JGP A;  2VLQ A;  2AFE A;  1S72 P;  5BS1 A;  3DS0 A;  3G28 A;  3P05 A;  5EJD A;  1IMQ A;  3H4E A;  3CC2 P;  1E0H A;  2MF4 A;  3CXC O;  2M8N A;  1K8A Q;  1Q86 Q;  3CC4 P;  3G1I A;  3GZL A;  2K5X A;  2KGE A;  3OW2 O;  2PEI A;  5HGM A;  2XZ0 D;  4CA3 A;  3NTE A;  4XFZ A;  3CME P;  4IZ6 A;  1QVF O;  3G26 A;  4R0M A;  2N98 A;  3VRL C;  1YJ9 P;  1NJI Q;  2FAD A;  3CCM P;  2PEN A;  2N6Y A;  2N50 A; 
#chains in the Genus database with same CATH homology
 1DNY A;  3LMO A;  2KOR A;  2JU2 A;  2KOQ A;  5KP8 B;  3EJD A;  2KGD A;  3GZM A;  5HV8 A;  4MRT C;  2L0Q A;  4H2Y C;  1KLP A;  2LPK A;  2EHT A;  2KGA A;  2L22 A;  2K0X A;  1HY8 A;  2LIU A;  2MR7 A;  4BPG A;  2K2Q A;  2AFD A;  2MY5 A;  5HVC A;  2FQ0 A;  2M5R A;  2FAC A;  2X2B A;  4BPH A;  1DV5 A;  2KOP A;  2CG5 B;  2FQ2 A;  2N6Z A;  2CNR A;  4PWV B;  4PXH B;  2CGQ A;  2K0Y A;  5KP6 B;  2AF8 A;  2L4B A;  2FQ1 A;  1F80 D;  4H2W C;  2GDW A;  4DG9 A;  2AVA A;  3EJB A;  5KP7 B;  2K94 A;  1OR5 A;  2DNW A;  2KG6 A;  2EHS A;  1L0H A;  2K93 A;  2LKI A;  2FVA A;  2LOL A;  1T8K A;  4NEO A;  2JGP A;  2N5H A;  2LIW A;  2AFE A;  2N5I A;  3CE7 A;  3RG2 A;  4HKG A;  2QNW A;  5EJD A;  3EJE A;  2KW2 A;  3NY7 B;  1VKU A;  2FHS C;  2VSQ A;  2MR8 A;  2MVU A;  1X3O A;  2JQ4 A;  2MF4 A;  2JU1 A;  2KOO A;  2FVF A;  2GDX A;  1HQB A;  2MD9 A;  3GZL A;  2KGE A;  2LTE A;  4H2X C;  2L9F A;  2LL8 A;  2XZ1 C;  2MVV A;  2XZ0 D;  5CZD B;  2FVE A;  2KWL A;  4CA3 A;  1ACP A;  4IZ6 A;  2ROQ A;  2KG8 A;  4R0M A;  2N98 A;  2FAE A;  1L0I A;  4BPF A;  2KG9 A;  1NQ4 A;  2LML A;  2FAD A;  2KOS A;  2KR5 A;  2GDY A;  2KGC A;  2PNG A;  2CQ8 A;  2N6Y A;  2K92 A;  2N50 A;  1AF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...