2N50A

Novel structural components contribute to the high thermal stability of acyl carrier protein from enterococcus faecalis
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
MTREEVLQKVAKIISNHFDIEADQVTDQLNIKDDLNADSISVMEFVLELEDEFGTEISDEDAEKIETVGAAVDYIVSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Acyl carrier protein
publication title Novel Structural Components Contribute to the High Thermal Stability of Acyl Carrier Protein from Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis v583
total genus 20
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2015-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n50A00
2QNWA 2FHSC 4R0MA 2AFEA 3GZMA 1DV5A 2MR7A 4H2WC 3CE7A 2K0XA 2CGQA 2L0QA 2LTEA 5KP7B 1X3OA 2K94A 2KORA 2LIWA 2FACA 5CZDB 2FVAA 2JGPA 1L0HA 2KGEA 2LMLA 2EHSA 5EJDA 2CG5B 2KOPA 1L0IA 2FQ1A 2DNWA 2K92A 1ACPA 2K93A 2FADA 4HKGA 2K0YA 2N50A 2EHTA 2N6ZA 1HY8A 4H2YC 2MVUA 2N6YA 2JU2A 2M5RA 5KP8B 2KGDA 2VSQA 2XZ1C 1F80D 2FQ2A 2L9FA 2L22A 2KR5A 2GDYA 4CA3A 2KG8A 4DG9A 3NY7B 1VKUA 2KG9A 3EJEA 3EJBA 2FVEA 4BPHA 1OR5A 4NEOA 2KWLA 1T8KA 2LIUA 2FAEA 1DNYA 2MVVA 2KOSA 2ROQA 2X2BA 4BPFA 3LMOA 2KW2A 2LKIA 2MF4A 2AF8A 1NQ4A 5HV8A 2GDXA 2FVFA 3RG2A 2MD9A 2AVAA 2KGCA 5KP6B 2PNGA 2JU1A 2MR8A 2KOQA 2KGAA 2GDWA 2N5IA 2FQ0A 2LPKA 1AF8A 1KLPA 2K2QA 2XZ0D 2N5HA 2CNRA 4PXHB 3GZLA 2MY5A 2LOLA 5HVCA 1HQBA 2CQ8A 3EJDA 4H2XC 4MRTC 4BPGA 2L4BA 4IZ6A 2N98A 2AFDA 2JQ4A 2KG6A 2KOOA 4PWVB 2LL8A
chains in the Genus database with same CATH superfamily
1VQ9P 1RNIA 2FHSC 2ONTA 3GZMA 1D1DA 4H2WC 3NTEA 3CCMP 3G1GA 1UNKA 5HGNA 1K73Q 1GXHA 2K94A 2LIWA 1UJZA 1L0HA 2KGEA 2LMLA 2EHSA 2BHVA 2CG5B 1FR2A 2KOPA 3CXCO 1VQ7P 2FQ1A 5DCKA 1Q86Q 1ACPA 2K93A 4GR2A 1GPJA 3CPWO 2N50A 2N6ZA 1HY8A 2JU2A 3H47A 2GZGA 2P9XA 2VSQA 2XZ1C 2M8PA 2FQ2A 1W2BO 2L9FA 4XFYA 2KR5A 3U43A 5HGOA 2PENA 1AUMA 1EIAA 2JB0A 3EJBA 1OR5A 3G4SP 2CWOA 1DNYA 3CMEP 2X2BA 3DS5A 1EOQA 7CEIA 4COPA 2GDXA 3CCSP 2MD9A 2AVAA 2KOQA 1M6EX 2LF4A 2N5IA 3G1IA 3DPHA 2M8NA 2K2QA 2K5XA 3DS2A 5F2NA 3CCQP 3MGEA 4MRTC 2XV6A 3CCJP 1YI2P 3G6EP 3G21A 4PWVB 1VQLP 1YHQP 1Q81Q 3G71P 1VQOP 3CE7A 2GZFA 3LRYA 2K0XA 1QRJA 5HGLA 5KP7B 3E2DA 2KORA 3WBHA 1RO2A 1L0IA 2DNWA 1ZMBA 3G29A 1QVGO 2L6EA 2K0YA 2EHTA 4H2YC 1Q7YQ 4WYMA 3CCLP 2M5RA 5KP8B 2XT1A 1AYIA 2KODA 1VKUA 2KG9A 2FVEA 4BPHA 4NEOA 1T8KA 2LIUA 2FAEA 2MVVA 2GYKA 4BPFA 1NQ4A 2BUOA 2ERHA 4IPYA 3HYBA 2FVFA 3RG2A 3I55P 2JAZA 5KP6B 3DS0A 3B4QA 2MR8A 2EFJA 2VLNA 3G28A 2KGAA 2LPKA 1AF8A 2OARA 2PEKA 4XRQA 2XZ0D 4U0CA 2N5HA 4M0IA 4PXHB 2MY5A 2K0DX 2LOLA 1HQBA 2PEMA 4H2XC 3RG6C 1VQ4P 3OW2O 4BPGA 1ZNVA 3DTJA 2M8LA 5BS1A 2AFDA 2JQ4A 1JJ2O 2OTLP 5F2KA 3H4EA 4U0DA 1DV5A 1K8AQ 3P05A 2CGQA 2LTEA 3GKLC 1QVFO 2Z45A 2JGPA 2QA4P 3CC7P 3CMAP 3CCUP 2JBGA 2VLQA 2EG5A 1CEIA 4PH1A 1BXIA 2N6YA 1M74A 3M1MA 1YJWP 1F80D 3CCEP 1VQ8P 4COCA 2PEIA 2GDYA 3CD6P 4U0EA 4U0FA 4CA3A 2KG8A 4DG9A 3NY7B 3CC2P 1Z6MA 1E6JP 2GZIA 2VLOA 2KWLA 1A8OA 2ROQA 3LMOA 2LKIA 2MF4A 2AF8A 5HV8A 1KC8Q 3I56P 1BAJA 2KGCA 2PNGA 4XFZA 2FQ0A 3Q20A 1KLPA 4PH0A 2E1MA 1VQ5P 2CNRA 2Z44A 1YIJP 4U0BA 2CQ8A 3EJDA 1VQPP 1RO0A 3B5IA 2L4BA 4IZ6A 3VRLC 2PEQA 2KG6A 1A43A 2KOOA 3HZQA 2QNWA 4R0MA 2AFEA 3G26A 2MR7A 1K9MQ 2PEJA 2JO0A 4U0AA 2L0QA 1X3OA 2FACA 5CZDB 2FVAA 4QNBA 5EJDA 1GXGA 1E0HA 2XXMA 2K92A 2FADA 2Z46A 3DS4A 4HKGA 1M6NA 5F2OA 3CCVP 1M1KQ 3GJNA 2JYGA 2MVUA 2KGDA 1YITP 2OTJP 2PEOA 1YJNP 4UHPB 1VQNP 2L22A 1K30A 4QKOA 4GR6A 2PY8A 1VQMP 3EJEA 1YJ9P 1IMQA 1IUQA 5HGMA 1MZ8A 5EW5E 2QEXP 1VQKP 2KOSA 2JYLA 2KW2A 4XROA 1Q82Q 1NJIQ 5JPAA 3CC4P 1M90Q 1S72P 2JU1A 3DS3A 5I4TG 3G0VA 1VHNA 2GDWA 1KQSO 1N8RQ 4F37A 2VLPA 2GZJA 1VQ6P 1KD1Q 3CCRP 2EIAA 3H0DA 1EMVA 3GZLA 5BS2A 5HVCA 2WPTA 2GZEA 2DGYA 2N98A 1IMPA 2NO8A 3DS1A 2LL8A 4XFXA
chains in the Genus database with same CATH topology
2QNWA 2FHSC 4R0MA 2AFEA 3GZMA 1DV5A 2MR7A 4H2WC 3CE7A 2K0XA 2CGQA 2L0QA 2LTEA 5KP7B 1X3OA 2K94A 2KORA 2LIWA 2FACA 5CZDB 2FVAA 2JGPA 1L0HA 2KGEA 2LMLA 2EHSA 5EJDA 2CG5B 2KOPA 1L0IA 2FQ1A 2DNWA 2K92A 1ACPA 2K93A 2FADA 4HKGA 2K0YA 2N50A 2EHTA 2N6ZA 1HY8A 4H2YC 2MVUA 2N6YA 2JU2A 2M5RA 5KP8B 2KGDA 2VSQA 2XZ1C 1F80D 2FQ2A 2L9FA 2L22A 2KR5A 2GDYA 4CA3A 2KG8A 4DG9A 3NY7B 1VKUA 2KG9A 3EJEA 3EJBA 2FVEA 4BPHA 1OR5A 4NEOA 2KWLA 1T8KA 2LIUA 2FAEA 1DNYA 2MVVA 2KOSA 2ROQA 2X2BA 4BPFA 3LMOA 2KW2A 2LKIA 2MF4A 2AF8A 1NQ4A 5HV8A 2GDXA 2FVFA 3RG2A 2MD9A 2AVAA 2KGCA 5KP6B 2PNGA 2JU1A 2MR8A 2KOQA 2KGAA 2GDWA 2N5IA 2FQ0A 2LPKA 1AF8A 1KLPA 2K2QA 2XZ0D 2N5HA 2CNRA 4PXHB 3GZLA 2MY5A 2LOLA 5HVCA 1HQBA 2CQ8A 3EJDA 4H2XC 4MRTC 4BPGA 2L4BA 4IZ6A 2N98A 2AFDA 2JQ4A 2KG6A 2KOOA 4PWVB 2LL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QNW A;  2FHS C;  4R0M A;  2AFE A;  3GZM A;  1DV5 A;  2MR7 A;  4H2W C;  3CE7 A;  2K0X A;  2CGQ A;  2L0Q A;  2LTE A;  5KP7 B;  1X3O A;  2K94 A;  2KOR A;  2LIW A;  2FAC A;  5CZD B;  2FVA A;  2JGP A;  1L0H A;  2KGE A;  2LML A;  2EHS A;  5EJD A;  2CG5 B;  2KOP A;  1L0I A;  2FQ1 A;  2DNW A;  2K92 A;  1ACP A;  2K93 A;  2FAD A;  4HKG A;  2K0Y A;  2N50 A;  2EHT A;  2N6Z A;  1HY8 A;  4H2Y C;  2MVU A;  2N6Y A;  2JU2 A;  2M5R A;  5KP8 B;  2KGD A;  2VSQ A;  2XZ1 C;  1F80 D;  2FQ2 A;  2L9F A;  2L22 A;  2KR5 A;  2GDY A;  4CA3 A;  2KG8 A;  4DG9 A;  3NY7 B;  1VKU A;  2KG9 A;  3EJE A;  3EJB A;  2FVE A;  4BPH A;  1OR5 A;  4NEO A;  2KWL A;  1T8K A;  2LIU A;  2FAE A;  1DNY A;  2MVV A;  2KOS A;  2ROQ A;  2X2B A;  4BPF A;  3LMO A;  2KW2 A;  2LKI A;  2MF4 A;  2AF8 A;  1NQ4 A;  5HV8 A;  2GDX A;  2FVF A;  3RG2 A;  2MD9 A;  2AVA A;  2KGC A;  5KP6 B;  2PNG A;  2JU1 A;  2MR8 A;  2KOQ A;  2KGA A;  2GDW A;  2N5I A;  2FQ0 A;  2LPK A;  1AF8 A;  1KLP A;  2K2Q A;  2XZ0 D;  2N5H A;  2CNR A;  4PXH B;  3GZL A;  2MY5 A;  2LOL A;  5HVC A;  1HQB A;  2CQ8 A;  3EJD A;  4H2X C;  4MRT C;  4BPG A;  2L4B A;  4IZ6 A;  2N98 A;  2AFD A;  2JQ4 A;  2KG6 A;  2KOO A;  4PWV B;  2LL8 A; 
#chains in the Genus database with same CATH topology
 1VQ9 P;  1RNI A;  2FHS C;  2ONT A;  3GZM A;  1D1D A;  4H2W C;  3NTE A;  3CCM P;  3G1G A;  1UNK A;  5HGN A;  1K73 Q;  1GXH A;  2K94 A;  2LIW A;  1UJZ A;  1L0H A;  2KGE A;  2LML A;  2EHS A;  2BHV A;  2CG5 B;  1FR2 A;  2KOP A;  3CXC O;  1VQ7 P;  2FQ1 A;  5DCK A;  1Q86 Q;  1ACP A;  2K93 A;  4GR2 A;  1GPJ A;  3CPW O;  2N50 A;  2N6Z A;  1HY8 A;  2JU2 A;  3H47 A;  2GZG A;  2P9X A;  2VSQ A;  2XZ1 C;  2M8P A;  2FQ2 A;  1W2B O;  2L9F A;  4XFY A;  2KR5 A;  3U43 A;  5HGO A;  2PEN A;  1AUM A;  1EIA A;  2JB0 A;  3EJB A;  1OR5 A;  3G4S P;  2CWO A;  1DNY A;  3CME P;  2X2B A;  3DS5 A;  1EOQ A;  7CEI A;  4COP A;  2GDX A;  3CCS P;  2MD9 A;  2AVA A;  2KOQ A;  1M6E X;  2LF4 A;  2N5I A;  3G1I A;  3DPH A;  2M8N A;  2K2Q A;  2K5X A;  3DS2 A;  5F2N A;  3CCQ P;  3MGE A;  4MRT C;  2XV6 A;  3CCJ P;  1YI2 P;  3G6E P;  3G21 A;  4PWV B;  1VQL P;  1YHQ P;  1Q81 Q;  3G71 P;  1VQO P;  3CE7 A;  2GZF A;  3LRY A;  2K0X A;  1QRJ A;  5HGL A;  5KP7 B;  3E2D A;  2KOR A;  3WBH A;  1RO2 A;  1L0I A;  2DNW A;  1ZMB A;  3G29 A;  1QVG O;  2L6E A;  2K0Y A;  2EHT A;  4H2Y C;  1Q7Y Q;  4WYM A;  3CCL P;  2M5R A;  5KP8 B;  2XT1 A;  1AYI A;  2KOD A;  1VKU A;  2KG9 A;  2FVE A;  4BPH A;  4NEO A;  1T8K A;  2LIU A;  2FAE A;  2MVV A;  2GYK A;  4BPF A;  1NQ4 A;  2BUO A;  2ERH A;  4IPY A;  3HYB A;  2FVF A;  3RG2 A;  3I55 P;  2JAZ A;  5KP6 B;  3DS0 A;  3B4Q A;  2MR8 A;  2EFJ A;  2VLN A;  3G28 A;  2KGA A;  2LPK A;  1AF8 A;  2OAR A;  2PEK A;  4XRQ A;  2XZ0 D;  4U0C A;  2N5H A;  4M0I A;  4PXH B;  2MY5 A;  2K0D X;  2LOL A;  1HQB A;  2PEM A;  4H2X C;  3RG6 C;  1VQ4 P;  3OW2 O;  4BPG A;  1ZNV A;  3DTJ A;  2M8L A;  5BS1 A;  2AFD A;  2JQ4 A;  1JJ2 O;  2OTL P;  5F2K A;  3H4E A;  4U0D A;  1DV5 A;  1K8A Q;  3P05 A;  2CGQ A;  2LTE A;  3GKL C;  1QVF O;  2Z45 A;  2JGP A;  2QA4 P;  3CC7 P;  3CMA P;  3CCU P;  2JBG A;  2VLQ A;  2EG5 A;  1CEI A;  4PH1 A;  1BXI A;  2N6Y A;  1M74 A;  3M1M A;  1YJW P;  1F80 D;  3CCE P;  1VQ8 P;  4COC A;  2PEI A;  2GDY A;  3CD6 P;  4U0E A;  4U0F A;  4CA3 A;  2KG8 A;  4DG9 A;  3NY7 B;  3CC2 P;  1Z6M A;  1E6J P;  2GZI A;  2VLO A;  2KWL A;  1A8O A;  2ROQ A;  3LMO A;  2LKI A;  2MF4 A;  2AF8 A;  5HV8 A;  1KC8 Q;  3I56 P;  1BAJ A;  2KGC A;  2PNG A;  4XFZ A;  2FQ0 A;  3Q20 A;  1KLP A;  4PH0 A;  2E1M A;  1VQ5 P;  2CNR A;  2Z44 A;  1YIJ P;  4U0B A;  2CQ8 A;  3EJD A;  1VQP P;  1RO0 A;  3B5I A;  2L4B A;  4IZ6 A;  3VRL C;  2PEQ A;  2KG6 A;  1A43 A;  2KOO A;  3HZQ A;  2QNW A;  4R0M A;  2AFE A;  3G26 A;  2MR7 A;  1K9M Q;  2PEJ A;  2JO0 A;  4U0A A;  2L0Q A;  1X3O A;  2FAC A;  5CZD B;  2FVA A;  4QNB A;  5EJD A;  1GXG A;  1E0H A;  2XXM A;  2K92 A;  2FAD A;  2Z46 A;  3DS4 A;  4HKG A;  1M6N A;  5F2O A;  3CCV P;  1M1K Q;  3GJN A;  2JYG A;  2MVU A;  2KGD A;  1YIT P;  2OTJ P;  2PEO A;  1YJN P;  4UHP B;  1VQN P;  2L22 A;  1K30 A;  4QKO A;  4GR6 A;  2PY8 A;  1VQM P;  3EJE A;  1YJ9 P;  1IMQ A;  1IUQ A;  5HGM A;  1MZ8 A;  5EW5 E;  2QEX P;  1VQK P;  2KOS A;  2JYL A;  2KW2 A;  4XRO A;  1Q82 Q;  1NJI Q;  5JPA A;  3CC4 P;  1M90 Q;  1S72 P;  2JU1 A;  3DS3 A;  5I4T G;  3G0V A;  1VHN A;  2GDW A;  1KQS O;  1N8R Q;  4F37 A;  2VLP A;  2GZJ A;  1VQ6 P;  1KD1 Q;  3CCR P;  2EIA A;  3H0D A;  1EMV A;  3GZL A;  5BS2 A;  5HVC A;  2WPT A;  2GZE A;  2DGY A;  2N98 A;  1IMP A;  2NO8 A;  3DS1 A;  2LL8 A;  4XFX A; 
#chains in the Genus database with same CATH homology
 2QNW A;  2FHS C;  4R0M A;  2AFE A;  3GZM A;  1DV5 A;  2MR7 A;  4H2W C;  3CE7 A;  2K0X A;  2CGQ A;  2L0Q A;  2LTE A;  5KP7 B;  1X3O A;  2K94 A;  2KOR A;  2LIW A;  2FAC A;  5CZD B;  2FVA A;  2JGP A;  1L0H A;  2KGE A;  2LML A;  2EHS A;  5EJD A;  2CG5 B;  2KOP A;  1L0I A;  2FQ1 A;  2DNW A;  2K92 A;  1ACP A;  2K93 A;  2FAD A;  4HKG A;  2K0Y A;  2N50 A;  2EHT A;  2N6Z A;  1HY8 A;  4H2Y C;  2MVU A;  2N6Y A;  2JU2 A;  2M5R A;  5KP8 B;  2KGD A;  2VSQ A;  2XZ1 C;  1F80 D;  2FQ2 A;  2L9F A;  2L22 A;  2KR5 A;  2GDY A;  4CA3 A;  2KG8 A;  4DG9 A;  3NY7 B;  1VKU A;  2KG9 A;  3EJE A;  3EJB A;  2FVE A;  4BPH A;  1OR5 A;  4NEO A;  2KWL A;  1T8K A;  2LIU A;  2FAE A;  1DNY A;  2MVV A;  2KOS A;  2ROQ A;  2X2B A;  4BPF A;  3LMO A;  2KW2 A;  2LKI A;  2MF4 A;  2AF8 A;  1NQ4 A;  5HV8 A;  2GDX A;  2FVF A;  3RG2 A;  2MD9 A;  2AVA A;  2KGC A;  5KP6 B;  2PNG A;  2JU1 A;  2MR8 A;  2KOQ A;  2KGA A;  2GDW A;  2N5I A;  2FQ0 A;  2LPK A;  1AF8 A;  1KLP A;  2K2Q A;  2XZ0 D;  2N5H A;  2CNR A;  4PXH B;  3GZL A;  2MY5 A;  2LOL A;  5HVC A;  1HQB A;  2CQ8 A;  3EJD A;  4H2X C;  4MRT C;  4BPG A;  2L4B A;  4IZ6 A;  2N98 A;  2AFD A;  2JQ4 A;  2KG6 A;  2KOO A;  4PWV B;  2LL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...